# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_1/input_1.fa_chunk_0000007 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 5849119, name = Scaffold_7) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 Scaffold_7 AUGUSTUS gene 4432 4788 0.97 + . g1 Scaffold_7 AUGUSTUS transcript 4432 4788 0.97 + . g1.t1 Scaffold_7 AUGUSTUS start_codon 4432 4434 . + 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_7 AUGUSTUS CDS 4432 4788 0.97 + 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_7 AUGUSTUS stop_codon 4786 4788 . + 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MSPKEVKKSQKKKEKEEEKKKRRLDAAKSKKGKAKDNDNDPANAELDVEPETETVHPHIPPKSVNVRLTKVEVGKLTR # INSLALPEVGQATATTPEEKTKSTKGNMRLKSLQPTVEGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 Scaffold_7 AUGUSTUS gene 7497 8793 0.68 + . g2 Scaffold_7 AUGUSTUS transcript 7497 8793 0.68 + . g2.t1 Scaffold_7 AUGUSTUS start_codon 7497 7499 . + 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_7 AUGUSTUS CDS 7497 7673 0.74 + 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_7 AUGUSTUS CDS 7999 8793 0.88 + 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_7 AUGUSTUS stop_codon 8791 8793 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MISGWSHDKDSAQLPAGITEITPKALDVEPGLDSEDQTSSKLGEKSIAEALNFAGLNNSTQDLPIPITLPHITPTSRV # PQKSNIRLTISIPSAHIPRLDDPPYPSIPALAVSDLQNVYACRSSPSPQPIPSLERTESSSLSPLTPLEEDDDYSPVKNWKNVYDMVAEDTMDCSSPL # TPLTDDSSPLRDRETYDTCAESKPMGGDGQENVHKSSSSSTVSCLQGSSPVSVRKSINNTNIQPTLGQKQVDISLIPSPSIPSNEESLPVQGWNDSLY # GGSKNVMKNLKFNKKKETLQTPQDGSSTDAIESHSTLSSTKADVKEKCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 Scaffold_7 AUGUSTUS gene 11298 12071 1 + . g3 Scaffold_7 AUGUSTUS transcript 11298 12071 1 + . g3.t1 Scaffold_7 AUGUSTUS start_codon 11298 11300 . + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_7 AUGUSTUS CDS 11298 12071 1 + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_7 AUGUSTUS stop_codon 12069 12071 . + 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MALGHELGIRIVPKSGFPANILRAKKINVIEDATSEKLELPIAIEGVPVTNDSFAMAIDTICSTQVDTSNDGPFTVEN # DVDVSIVSMESESTLSPLVDVIMREAPSMSMADLRHECNEHSNSNQLSEPDVNADQSSQMIAKESTSSNELMLIETNFDGLIRMEFPEAVATFQEGVY # NDYEDDPHAVTSSWPEEVTDNTNETEEPSLELPSKSQNATAKRKTYVREDMHFILVHGDALVLSGDDFEYAIERKGMGLCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 Scaffold_7 AUGUSTUS gene 13067 13375 0.98 + . g4 Scaffold_7 AUGUSTUS transcript 13067 13375 0.98 + . g4.t1 Scaffold_7 AUGUSTUS start_codon 13067 13069 . + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_7 AUGUSTUS CDS 13067 13375 0.98 + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_7 AUGUSTUS stop_codon 13373 13375 . + 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MDKDKDNDYPLDYDGGTDELVNSQPLQDDDTDNNRSQTVPEEDFQISTDYDHEPSFAIAPTVFLSDPAALASHMLQLS # RVLRRWAQPSRVTTNPSPVRPGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 Scaffold_7 AUGUSTUS gene 16538 17029 0.25 + . g5 Scaffold_7 AUGUSTUS transcript 16538 17029 0.25 + . g5.t1 Scaffold_7 AUGUSTUS start_codon 16538 16540 . + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_7 AUGUSTUS CDS 16538 17029 0.25 + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_7 AUGUSTUS stop_codon 17027 17029 . + 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MKTRASIAWSWNTPALPSIDQLTADWEQLMLDYIHHITDTPLPGPNPPAPVSAVDPVTEPSQEVVVEQSPEVPVAPVS # SSSIGFQPQVPLFLPEQESPTSPSPPPPSPTLPPLFGSVVNLAIDLTGDDDELYKTEESCVARVSMTGEVVNLAPGQGIIKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 Scaffold_7 AUGUSTUS gene 17867 18826 0.31 - . g6 Scaffold_7 AUGUSTUS transcript 17867 18826 0.31 - . g6.t1 Scaffold_7 AUGUSTUS stop_codon 17867 17869 . - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_7 AUGUSTUS CDS 17867 18826 0.31 - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_7 AUGUSTUS start_codon 18824 18826 . - 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MNEDLLVNRVREAPKDTTIIEALRRIARNEEESLVWEDGLIKRGGHIYIPDVGALQREVLQSYHDHKLRGHPGEKHTK # KLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLCPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAEDF # ANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIKSRLSTVYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNNTPNTTTG # VSPFFANKGYHPKLSITLEQVQGAEINGTHPNLKELHAYSRNESG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 Scaffold_7 AUGUSTUS gene 29711 30589 0.73 + . g7 Scaffold_7 AUGUSTUS transcript 29711 30589 0.73 + . g7.t1 Scaffold_7 AUGUSTUS start_codon 29711 29713 . + 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_7 AUGUSTUS CDS 29711 30589 0.73 + 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_7 AUGUSTUS stop_codon 30587 30589 . + 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MLQGIIEELRSLLMSASALHHQELLQASAAERTQMEARLMGSLQDDIRGITRSELKLLESNLQQKLTSLLPMEAINRL # LSSLENTFTHLYDPVPPTQGLPTSTPPPKWPSVQYEPHQSGKLPSTPPKPIPPSQQRHTPRISSTTQLPSLLTCLQDGPSALQPETVSFDSKHSMITA # GKRRAMEHEEDSRDSKRHPHNSRTAHSVSVFLPSEWDPLPFTIDRIFTMYYRWSSDFDAAVHVTLPRVGFITCIGGNQLKLSFSPKGLEEFLRAWNTY # HNVVPGLANVVVCRDNAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 Scaffold_7 AUGUSTUS gene 32657 33016 0.84 + . g8 Scaffold_7 AUGUSTUS transcript 32657 33016 0.84 + . g8.t1 Scaffold_7 AUGUSTUS start_codon 32657 32659 . + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_7 AUGUSTUS CDS 32657 33016 0.84 + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_7 AUGUSTUS stop_codon 33014 33016 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MNPPDPLTTHFDPARLQEEATQANTIPLPSPPSSHPDFNLDITVLNVAAVKAYLKRTSHSDAKGADSATYSQLMSIPN # DRLALLFGRAFRNNELPSSWLTSIIIAVPKPGKDLTNPANY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 Scaffold_7 AUGUSTUS gene 42236 42724 0.82 - . g9 Scaffold_7 AUGUSTUS transcript 42236 42724 0.82 - . g9.t1 Scaffold_7 AUGUSTUS stop_codon 42236 42238 . - 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_7 AUGUSTUS CDS 42236 42724 0.82 - 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_7 AUGUSTUS start_codon 42722 42724 . - 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MLDSKEWGFKEADIVLYCDACPTGMGFWFHYDDKTLGYQCMIPDDHEKPIFYFEALTVVSAILHTIKLPFVPRVFVFT # DNTNMVDMFHSLKAKQLYNPLLLTTVDHAICSNIQFRVAHIRREENGIADALSRFDYTRLMHLAPSMKIYNFTPPQLVLGAEQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 Scaffold_7 AUGUSTUS gene 43118 43483 0.68 - . g10 Scaffold_7 AUGUSTUS transcript 43118 43483 0.68 - . g10.t1 Scaffold_7 AUGUSTUS stop_codon 43118 43120 . - 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_7 AUGUSTUS CDS 43118 43483 0.68 - 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_7 AUGUSTUS start_codon 43481 43483 . - 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MDNLHDLGAALIHVRRVYGCSVNLVVFKSDVSAAYRRLPMDPHWQIKQVVGFGDRYNVNQCNNFGSRDGGGLYGSFMA # LILWVAIYVKFIVDLFAWVDDTFGWDFEGNLAYYAPYAEFYPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 Scaffold_7 AUGUSTUS gene 43694 44569 0.63 - . g11 Scaffold_7 AUGUSTUS transcript 43694 44569 0.63 - . g11.t1 Scaffold_7 AUGUSTUS stop_codon 43694 43696 . - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_7 AUGUSTUS CDS 43694 44569 0.63 - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_7 AUGUSTUS start_codon 44567 44569 . - 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MRPLLTNARPRRLVRSSSNSDRQSLEKGLTTPETGRLSLPSTPKPSHLSFPIEQMSSKNTASISLDSLEPFLNSIMTK # SSTMTRPSVIESLNLDNMSSPILVSSRTSSCIGSKPLPPKLENQDKEKISLEGANLARGTMKVNAQTQPSPVGTNTSAESVTKMTIPVQNAQTKYWSR # RPHYARALMWDDVEKPTENMSLADSSVYMTPLPRPPRDVILDDTVLDTIRKNPHLFNITTPINVNRFQTLLNSHPNQEFVESVCTGFRQGFWPRASGN # KPGTPLVLDRTCELHDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 Scaffold_7 AUGUSTUS gene 45889 46725 0.81 + . g12 Scaffold_7 AUGUSTUS transcript 45889 46725 0.81 + . g12.t1 Scaffold_7 AUGUSTUS start_codon 45889 45891 . + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_7 AUGUSTUS CDS 45889 46725 0.81 + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_7 AUGUSTUS stop_codon 46723 46725 . + 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [METPTAIPIIPRLRVSRHHQSTAYDYSGSVNLSEAGPSRLPNSTDFLEPNLHAENTDDDEQDTPKLHPISALPTDSSS # PYPEDTPAARLKAVLERTSARSRPPPAPIPSSGSTTDLESDFDLPTIGSSQPSLARENLNSLFSRALREPGDTPQKSFKGKIRRRNSVDTSEFESSPR # VAKVKDDRRVVEGKRRSLSDDELSSSNSALYFTRFQAGSNYNAVSIDRSQAAVFNTLRQRLNSSNQRKQKTQASEQQNTSDLDRSFQYFFDQILVNIL # FASG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 Scaffold_7 AUGUSTUS gene 48799 49896 0.39 + . g13 Scaffold_7 AUGUSTUS transcript 48799 49896 0.39 + . g13.t1 Scaffold_7 AUGUSTUS start_codon 48799 48801 . + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_7 AUGUSTUS CDS 48799 49896 0.39 + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_7 AUGUSTUS stop_codon 49894 49896 . + 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MTRQTVILLVSQNLSATTRISDNFSIDTDTEAEESNQLVQENTPTLRPNGALPSIEAPDPVEASSAYVSFETGASLQK # IIASPPSPPLSSPSDGPSTPEAEVSFSFPSTPPRRDSRNPTKLEFQTPSPPKNLPDLPDPPSDSSDHEDHEYPAPIKGNLSSLKTPKPPGAWTATPLP # PRTHALLRSNSLPTDDENDSGLATPAASLSRAATMPPRTPALPGGWMNTPANRKSVRFHEETAAGSLKAETVAPKVEEAVHAVVKSLGSSPNSKVGTT # GDDNRQTSPSLAHSPRKATTIRVVDAFGREEKKGISDSIRIVDAMGQIVVEDSMESGSSIVPGIPPTRQKALEHVRNGLHELVEEMNDEEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 Scaffold_7 AUGUSTUS gene 51086 51493 0.98 - . g14 Scaffold_7 AUGUSTUS transcript 51086 51493 0.98 - . g14.t1 Scaffold_7 AUGUSTUS stop_codon 51086 51088 . - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_7 AUGUSTUS CDS 51086 51493 0.98 - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_7 AUGUSTUS start_codon 51491 51493 . - 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MVIFTKVSEETVDRSTPAKGSRPTIRKTTKRRYEFLLTNKDRVSFINCGSPNTIRDLKISITGRPENSVDDNQMEKIL # RLLSEGAGGRSIGANYQIKLDWDWGSNSDTSKERTEKSNETETSHNEDVRKKDGKLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 Scaffold_7 AUGUSTUS gene 65863 67822 0.44 - . g15 Scaffold_7 AUGUSTUS transcript 65863 67822 0.44 - . g15.t1 Scaffold_7 AUGUSTUS stop_codon 65863 65865 . - 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_7 AUGUSTUS CDS 65863 67129 0.66 - 1 transcript_id "g15.t1"; gene_id "g15"; Scaffold_7 AUGUSTUS CDS 67209 67822 0.44 - 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_7 AUGUSTUS start_codon 67820 67822 . - 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MSRSLMDNLASIRTDISLTETEDSWEKICRGIVSFSEFIRASSTNGTHEIITKARELHRPIINAMKSERTRLSGPAID # LISTLASELGTDFEPLLHLFFPTLLLLCARTSKVVVGRARSCILCIIETTQLVTVIPYFIQAIRDKSVSLRTVAAESTLACLNSLNPPDLEKEERTKD # IEAFIKMSVRDANAEVRKIGKQIYQAYEFFIAPLTPTSKKYLGLSSRPKSAIELGGVSGPPPQVSSSSSSRVPDSKPQAPKLVKKASQASLPSSVSSR # TQPGPHVQRGIANSTSRSRPHSAMDLHAGPTREDTHLAHLSQNNPVRPNLPLSRSESAATSNGHFRSTSTTLLAHNASCKPTNVSAAPQRVLVAPVPN # VPAPSFKSTSGPVRVDPRAVRDHNPPGSKKPALSSDESDVTAKKPDVKSVRDKVESKKTELPKLVSESKEEPRKEGSNSLLNKRSLRSLNKIQQPPNG # KNGQNPRDALKTSTSSVTTASTSKIPSVSSQTKNAPHYTQPVASSRARTVSASTSASVAARAPFPRTRTISSSASTSSLDVSAKTRPPAVRARTASST # AASTSAAIVAVARSRETTTSNSIDANSSRSATSSKTLSKPVWAVPLALAQSCQCLANG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 Scaffold_7 AUGUSTUS gene 69186 69740 0.95 + . g16 Scaffold_7 AUGUSTUS transcript 69186 69740 0.95 + . g16.t1 Scaffold_7 AUGUSTUS start_codon 69186 69188 . + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_7 AUGUSTUS CDS 69186 69740 0.95 + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_7 AUGUSTUS stop_codon 69738 69740 . + 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MEDSPQLVATSGIAYYMSPPHTIREAIVDPIHTGIYITFMLSACALFSKTWIEVSGSGPRDVAKQLKDQQMVKEDSSV # AVEEFAYSLFQVMAGHREGSMYKELKRVIPTAAAFGGAILGLLSVAADLMGAIGSGTGILMAVTIIYSCKWIFRCSKVSCSDACLDWEIGMRESGGPE # MAALGDLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 Scaffold_7 AUGUSTUS gene 70558 70686 0.43 - . g17 Scaffold_7 AUGUSTUS transcript 70558 70686 0.43 - . g17.t1 Scaffold_7 AUGUSTUS stop_codon 70558 70560 . - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_7 AUGUSTUS CDS 70558 70686 0.43 - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_7 AUGUSTUS start_codon 70684 70686 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MLNAFNDSKYLERLTGLDQLYEDGEKALEDVEWIEGDDEDDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 Scaffold_7 AUGUSTUS gene 71612 73205 0.28 - . g18 Scaffold_7 AUGUSTUS transcript 71612 73205 0.28 - . g18.t1 Scaffold_7 AUGUSTUS stop_codon 71612 71614 . - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_7 AUGUSTUS CDS 71612 72635 0.43 - 1 transcript_id "g18.t1"; gene_id "g18"; Scaffold_7 AUGUSTUS CDS 72697 73205 0.29 - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_7 AUGUSTUS start_codon 73203 73205 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MYQYGIALTTLNYDDPTIVQFTPLPSLTHPSFWHKLTEHKLDVLKLSDAGVDITATYRVGRLIEDREGGPGAFVGVGG # SLGVEEESFGQGHSSYETSLVYASIAHSIFSPAIGSAVAKGVVKNYNTIEDFKAADKSKLFNEAADKVLPMCFSNTRCSNYPSDLDIDPNSAYYYWFA # FPAFTSTPAWHIDANPGWISAGTAESTYSKEQMKVIYDQLHSLGQQSAYFLIRSSGSNEINVVAIEDYRPDTDTIETTTIGFIDPSAQPQNPGWPLRN # LLAYFRALYPQSTSKLRILSWRDAEFPRGEEGWKSRVGVIFIGPDGVSTEESDAKTRPNAVGWEKNVQGKLGPRMADLAPMMDPVRYGIPLPHLLPPS # NLAFRLANQAVDLNLKLMRWRILPELNLEKISETKCLLLGAGTLGCYVARCLMVNPTSHLSLVLIFNGSIQGWGVRTITFVDSSKVSFSNPVRQPLFK # FEDCLNGGKPKAECAAERLKEVWPGIVSCPIPIRWNIHNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 Scaffold_7 AUGUSTUS gene 73681 75998 0.42 + . g19 Scaffold_7 AUGUSTUS transcript 73681 75998 0.42 + . g19.t1 Scaffold_7 AUGUSTUS start_codon 73681 73683 . + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_7 AUGUSTUS CDS 73681 74244 0.44 + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_7 AUGUSTUS CDS 75051 75998 0.92 + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_7 AUGUSTUS stop_codon 75996 75998 . + 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MVVRMLAAPSHWSTAPPPRLPPNSDLHMKTCSENGPWFISALPTVQIFVLQNWIKLLPLSMNYVGLYCPCPSVKLYGV # PLGQSNPDLPLQPVFISVDPARDTPSTIRTYLTDFHPSFVGLVGNFEQTKSVCKAYRVYFSTPPDADPKGDYLVDHSIFVYLMDPEGRFVEAFGQTAE # KEEMVDKIRQFVALTTDDIVPDLVDSAPSTPPLARRNSTASVTRPDTPPIDTLPPPLPVPETLPPIVNQTDNLHNTHTSQSSDHYRAFVHARSSGDHE # VALLAVNNFRAALAAKLVDPSIYEFNALSLYHTRPRGSPLADIQDLYNTMISLGIHPNVRTHITLILAHCDRDHEVVWALNGIEQKLKSQRILNPSAE # YSLSSEDQARKDALEKENNFASAVSLFQILRTMPHKEHLQIQLFSSLLSCCAHYGAVDIAIMVWEIVEQHSLQPSAVLYKSMIQTFARVGELNAAEDV # FADFRNNQQPVELHGAPQGLNLLPVLLFASGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 Scaffold_7 AUGUSTUS gene 76882 77262 0.37 + . g20 Scaffold_7 AUGUSTUS transcript 76882 77262 0.37 + . g20.t1 Scaffold_7 AUGUSTUS start_codon 76882 76884 . + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_7 AUGUSTUS CDS 76882 77262 0.37 + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_7 AUGUSTUS stop_codon 77260 77262 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MELSHKQLKALCVAGATLEMVEPHHRPNFAGLVPLLEDLVQQKYNISQPLGEHDVRQHVFSALMYDRSAYQVKSLIGE # LGLETVFKTYLDTTEPAAATPSPSIALSNFNDFSSGTGYSSYKSVDFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 Scaffold_7 AUGUSTUS gene 77540 78720 0.41 + . g21 Scaffold_7 AUGUSTUS transcript 77540 78720 0.41 + . g21.t1 Scaffold_7 AUGUSTUS start_codon 77540 77542 . + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_7 AUGUSTUS CDS 77540 78124 0.55 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_7 AUGUSTUS CDS 78202 78720 0.71 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_7 AUGUSTUS stop_codon 78718 78720 . + 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MESNKQLQSDAWFLFEDGMIIAMAQAGEIDAAHVHRQRILEQGGAPSADAYGGLILNVKDTTDDTSNAMALFNESQSL # HVVPNHYLYNNIISKLAKARKADAALDLFTRMKASGIAPSSITYGAVIGACARVGDAASAEALYAEMVSVPNFKPRIPPFNTMMQLYTTTKPNRDRAL # FFYHELLKYNVHPTSYTYKPLDIPRMEAVFQELTDNHRVELQGTHFATLINAYGCVAKDLDKALAAYDYVFHHPRKPVIDALVFEAIANVCVAHRRID # LMPQFVTKMSEVGVHMTAYIVNVMIKGFAAVGDIASARELFESLVDPPEGIAALHNHAPHEPSKMPSVNPMEPVFREVDVFIDFLCYFSDMPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 Scaffold_7 AUGUSTUS gene 80696 81826 0.62 - . g22 Scaffold_7 AUGUSTUS transcript 80696 81826 0.62 - . g22.t1 Scaffold_7 AUGUSTUS stop_codon 80696 80698 . - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_7 AUGUSTUS CDS 80696 81263 0.67 - 1 transcript_id "g22.t1"; gene_id "g22"; Scaffold_7 AUGUSTUS CDS 81339 81826 0.62 - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_7 AUGUSTUS start_codon 81824 81826 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MNAVQDSAVDLFDSATDRVNKARTRVSGIRLPEFQAPQFLKNLFTEGDQDRTGKNQGEDGKRDNDGSSDSKQRPPSDN # ATIAALLAATMSSPSDSKTGNNGQLESQPNGLMNLTKKLIEIRSMLLSIDQNDSLKLPSIVVIGSQSSGKSSVLEAIVGHEFLPKGNNMVTRRPIELT # LVHTPTPPGETPSEYGEFPALGLGKIHSFTDIQRTLTDMNLAVPASEAVSNDPIDLRIYSPFVPDLTLIDLPGYVQIASLDQPESLKEKIAGLCDKYI # REPNIVLAVCAADVDLANSPALRASRKVDPLGLRTIGVVTKMDLVSPEEGAAILGGNRYPLHLGYVGVVTKAIGKQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 Scaffold_7 AUGUSTUS gene 85661 86230 0.47 - . g23 Scaffold_7 AUGUSTUS transcript 85661 86230 0.47 - . g23.t1 Scaffold_7 AUGUSTUS stop_codon 85661 85663 . - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_7 AUGUSTUS CDS 85661 86230 0.47 - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_7 AUGUSTUS start_codon 86228 86230 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MAYPTLFLTTVDHLRASPPSTKSLGITIHFVPPASQAVADMAQCATCDMAYPTLFLTTVDHLRASPPSTKSLGIEICV # LPPAPQAVADMAQCATCDMAYPTLFLTTVDHLRAHHHPQSHSELKSVFATCTQAVADMAQCATCDMAYPTLFLTTVDHLRASPPSTKSLGIEICVVPP # AFKQSQAGTVCHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 Scaffold_7 AUGUSTUS gene 86944 87837 0.06 + . g24 Scaffold_7 AUGUSTUS transcript 86944 87837 0.06 + . g24.t1 Scaffold_7 AUGUSTUS start_codon 86944 86946 . + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_7 AUGUSTUS CDS 86944 87050 0.38 + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_7 AUGUSTUS CDS 87132 87191 0.8 + 1 transcript_id "g24.t1"; gene_id "g24"; Scaffold_7 AUGUSTUS CDS 87329 87475 0.6 + 1 transcript_id "g24.t1"; gene_id "g24"; Scaffold_7 AUGUSTUS CDS 87558 87837 0.33 + 1 transcript_id "g24.t1"; gene_id "g24"; Scaffold_7 AUGUSTUS stop_codon 87835 87837 . + 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MSQVAPCHACDCLRCRWHNTVLIPSDFVDGGEARRWWHKVDLIPSDFVDGGEARRWWLTVVGHRVGYAMSQVAHLCQA # CDCLRCRWHTQILIPSDFVDGGEARRWWHTQILIPSDFVDGGEARRWLTVVGNSVGYAMSQVAPCAKPATACDAGGTTQILIPSDFVDGGEARRWLTV # VGNSVGYAMSQVAPCAKPATA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 Scaffold_7 AUGUSTUS gene 89186 89950 0.39 - . g25 Scaffold_7 AUGUSTUS transcript 89186 89950 0.39 - . g25.t1 Scaffold_7 AUGUSTUS stop_codon 89186 89188 . - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_7 AUGUSTUS CDS 89186 89950 0.39 - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_7 AUGUSTUS start_codon 89948 89950 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MAWCATCDMAYPTLFLTTVDHLRASPPSTKSLGITIHFVPPASQAVADMAQCATCDMAYPTLFLTTVDHLRASPPSTK # SLGIEICVLPPTPQAVADMAQCATCDMAYPTLFLTTVDHLRASPPSTKSLGIEICVLPPTPQAVADMAQCATCDMAYPTLFLTTVDHLRASPPSTKSL # GITIHFVPPASQAVADMAQCATCDMAYPTLFLTTVDHLRASPPSTKSLGIEICVLPPTPQAVADLMQCATCDMAYPTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 Scaffold_7 AUGUSTUS gene 90046 91784 0.55 - . g26 Scaffold_7 AUGUSTUS transcript 90046 91784 0.55 - . g26.t1 Scaffold_7 AUGUSTUS stop_codon 90046 90048 . - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_7 AUGUSTUS CDS 90046 91495 1 - 1 transcript_id "g26.t1"; gene_id "g26"; Scaffold_7 AUGUSTUS CDS 91579 91784 0.55 - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_7 AUGUSTUS start_codon 91782 91784 . - 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MAQCATCDMAYPTLCPTTVNHLTVVGNSVGYAMSQVAPCAMSATACDAGGTTQILIPSDFVDGGDAHRWWHKADFDSE # RASPPSTKSLGIKICVVPPASQAVADMAQGATCDMAYPTLFPTTVNHLRASPPSTKSLGITIHFVPPASQTVAGLAQCATCDMAYPTLCPTTVNHLRA # SPPSTKSLGIKICVVPPASQAVADMAQGATCDMAYPTLFPTTVNHLRASPPSTKSLGIKICVVPPASQAVAGLAQCATCDMTYPTPFLTTVNHLQASP # PSTKSLGIKICFVPPASQAVADMAQGATCDMAYPTLFPTTVNHLRASPPSTKSLGIKICVVPPASQAVADMAQGATCDMAYPTLFPTTVNHLRASPPS # TKSLRITIHFVPPASQTVAGLAQCATCDMAYPTLFPTTVNHLRASPPSTKSLGIKICVVPPASQAVAGLAQCATCDMTYPTPFPTTVNHLRASPPSTK # SLGIKICFVPPASQAVTGLAQCATCDMTYPTLFPTTVNHLRASPPSTKSLGIKSVLCHLHLKQSQAWRSVPLVTWHILHYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 Scaffold_7 AUGUSTUS gene 119494 119958 0.42 + . g27 Scaffold_7 AUGUSTUS transcript 119494 119958 0.42 + . g27.t1 Scaffold_7 AUGUSTUS start_codon 119494 119496 . + 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_7 AUGUSTUS CDS 119494 119540 0.42 + 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_7 AUGUSTUS CDS 119640 119958 0.74 + 1 transcript_id "g27.t1"; gene_id "g27"; Scaffold_7 AUGUSTUS stop_codon 119956 119958 . + 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MKRAFVDLKTEEDRLCMHNCAKRGTKRSSNNVVKRLETFVGRGCSREDSRPTVILNHSQLDHDRILDRLDDFGLREEA # QHILSGASETMTSDKLTNHPLVKEPKQLTDRGMSQRPLVISPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 Scaffold_7 AUGUSTUS gene 123979 125019 0.64 - . g28 Scaffold_7 AUGUSTUS transcript 123979 125019 0.64 - . g28.t1 Scaffold_7 AUGUSTUS stop_codon 123979 123981 . - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_7 AUGUSTUS CDS 123979 125019 0.64 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_7 AUGUSTUS start_codon 125017 125019 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MESFPIHCDNSTFPNGQPCNRRLHAREKPIEKSPKSKSRKKEHPVPNRTYSYQSLNHWIGWMYNRKELGQYLDRPYEK # PNNPDRTVSDLWDSDFLGEFVGPDGKNLFVSPGDTNESRLLFNLNADGFNPFGNRTAGKKVTVWGIYMVCINLPPTLRYKPENVFLVGVVPGPKEPTF # DQISFILTPLLDDLEVLWETGIFLNRTRRHSLGRSIRAALIALVCDLPAARLLAGFSHFSGNLPCSMCKESDLNNLDEPSFILRTMEEHRKLAAEWLA # AQSQEERDALYKTNGVRWSPLLRLVYWDPIQNTVIDPMHGFYLRILQRHCRDIWGMNVKFQDNDGGYRGTLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 Scaffold_7 AUGUSTUS gene 127680 128204 0.53 + . g29 Scaffold_7 AUGUSTUS transcript 127680 128204 0.53 + . g29.t1 Scaffold_7 AUGUSTUS start_codon 127680 127682 . + 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_7 AUGUSTUS CDS 127680 128204 0.53 + 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_7 AUGUSTUS stop_codon 128202 128204 . + 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MLKSSGEWRKLLGLELHGLKTDTKCASTRQKLVNELQQGLEMSNSLVCLVFVPRSELNSTIKTLDLSDLQNVVPRWQN # KEVAGRIPDDICRQVLHEIYTVSFKAELLLADQYLYELQSEGFDGDGFGYDELDASSREDRKIKVMSFMPGFTTGVIGFGPEIKANVNGVSMHCIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 Scaffold_7 AUGUSTUS gene 135597 136741 0.56 + . g30 Scaffold_7 AUGUSTUS transcript 135597 136741 0.56 + . g30.t1 Scaffold_7 AUGUSTUS start_codon 135597 135599 . + 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_7 AUGUSTUS CDS 135597 136158 0.57 + 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_7 AUGUSTUS CDS 136230 136741 0.96 + 2 transcript_id "g30.t1"; gene_id "g30"; Scaffold_7 AUGUSTUS stop_codon 136739 136741 . + 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MDVSGDAQLTLTQRARKTSSTLYSNASRNNTFTNTRDAGTLPTTIRFPPLFSSDFGPAALLYPSPTLTTHINFGEDLG # LTYPHSYDSNDRNDLHSNSNPNPQVNNGGSHSDNTYSAFNIPRPTIELPLDELLRGMDRFDGMEGMEGLDGGDDMDGLRNQFAPGAAGGERSWRPWSP # AFFATLSQKGSTSSSTPPLFSTTSLVPPSKNNNANDFYGEDESQDVEMFDHSSSAYDHLNHLYDDNPNNEHISSFDYDLNSAEPIQIPITTVSGNSLH # ALFGDSPGGRSDGRLLTPFEETLSFSGQHGHLSRHNSHTSSSSHHTHLSNHEDDAESGVDVDVESDNSDSESDLSRRPNNLCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 Scaffold_7 AUGUSTUS gene 136854 137795 0.99 + . g31 Scaffold_7 AUGUSTUS transcript 136854 137795 0.99 + . g31.t1 Scaffold_7 AUGUSTUS start_codon 136854 136856 . + 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_7 AUGUSTUS CDS 136854 137795 0.99 + 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_7 AUGUSTUS stop_codon 137793 137795 . + 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MPVHTNKPGYFGKGSVEIGPAAGPGEGPIRRIAISSESLYTQPFEGIKTVYDVLEYAARTHGTRRALGWRDTVDIHEE # EKEVKKVVGGKEVTEKKKWKYFQLSERSMRCAFHQSIFYSVNWQLMANACGSISTTIATAYDTLGESGLTHSLNEPESVGLFTNAELLPTLYKVLANT # PSIKFVVYDGEPSENLVGDINAVRESIQVFSIDEIRELGKSKPTEPLRARLPKPETMACIMYTSGSTVPPKGVCVTHANLVASIGAVYKLLGPHLTYD # DTYLAYLPLAHVLEYIVELIMLFVTTPPGCILRLSPCHC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 Scaffold_7 AUGUSTUS gene 156553 156897 0.84 - . g32 Scaffold_7 AUGUSTUS transcript 156553 156897 0.84 - . g32.t1 Scaffold_7 AUGUSTUS stop_codon 156553 156555 . - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_7 AUGUSTUS CDS 156553 156897 0.84 - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_7 AUGUSTUS start_codon 156895 156897 . - 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MRAQEDDYFNHNGGTSETIFTTSPSPNQTSFPSFPMPSLSGVVMPGSPVSSPIVELPPTSTSTFTGMAPPKNGMSPDD # MLRAYAERKAAAGAVRAGTRKISNPSPLAWEMIQTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 Scaffold_7 AUGUSTUS gene 165056 165904 0.98 - . g33 Scaffold_7 AUGUSTUS transcript 165056 165904 0.98 - . g33.t1 Scaffold_7 AUGUSTUS stop_codon 165056 165058 . - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_7 AUGUSTUS CDS 165056 165904 0.98 - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_7 AUGUSTUS start_codon 165902 165904 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MEYPTPFPITVDHLRASTPSTKSLGIKICVVPPASQAVAGLAQCATGDMAYPTPFPTTVDHLRASTPSTKSLGIKICV # VPPASQAVADMAPCATCDMAYPTLFLTTVDHLRASPPSTKSLGIEICVLPPAPQAVADMTQCATCDMAYPGLFPTTVDHLQASPPSTKSLGITIHFVP # PASQAVADMAQCATCDMAYPTLFLTTVDHLRASPPSTKSLRIEICVLPPTPQAVADMTQCATCDMAYPGLFPTTVDHLQASPPSTKSLGITICVVPPA # SQAVADMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 Scaffold_7 AUGUSTUS gene 170611 170931 0.69 - . g34 Scaffold_7 AUGUSTUS transcript 170611 170931 0.69 - . g34.t1 Scaffold_7 AUGUSTUS stop_codon 170611 170613 . - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_7 AUGUSTUS CDS 170611 170931 0.69 - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_7 AUGUSTUS start_codon 170929 170931 . - 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MPTQKPKVIKDAVASPAMTVDLGAEVGVGADWDHLNKRRQRARGEKVKRDFGIASQVRKSERQERKRAVWEVLMLKEE # QGKTGSSAAPKVTVVDDVDANSKPPHPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 Scaffold_7 AUGUSTUS gene 181399 183646 0.23 - . g35 Scaffold_7 AUGUSTUS transcript 181399 183646 0.23 - . g35.t1 Scaffold_7 AUGUSTUS stop_codon 181399 181401 . - 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_7 AUGUSTUS CDS 181399 182196 0.98 - 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_7 AUGUSTUS CDS 182957 183646 0.23 - 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_7 AUGUSTUS start_codon 183644 183646 . - 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MLARLWEQKRCLQEKDILQRKLANGMLRQQEERRRSEYRANRREEDRRLQEKLRQEAEERKRQKDYEQAREGTKERWT # ARRFWRLGGGLSKFKFVCRKGRFTLLRRQQPEWKRIVWNHHTWARSRAYRDLKRQEAALRANSVGGGNAPPLRGVSIDKPNPGNVVNPCPTENIVANI # PVCMIDEAADIKGMGHDAIPDALDTRTQEMDLFTRNNGPNGAFLPERVAEVVRLYLHGKIDELLEAGIIEQCDPSEVKCVSPTTLAKKAHEGGGLTLE # ELQHRLNDQCVEVGLPPCFDLPPRPGPASQPPEGGMAKPQKWRICQNFGKVNKLTEIAPMPQGDIHAKQLALSGHEFICFFDFASGFYAMEMDQGSRP # YTAFYVEGRGYFWYKQMPFGLTGAPSSFAHMTATRLGDLTTDGTMELFVDDGASAADDFETMYAQIHRILTRVQEKGLSLLAVKSAFFMSEGIFAGAK # VSKSGLPRTPLSLPQLSNGANPRMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 Scaffold_7 AUGUSTUS gene 183733 185430 0.89 - . g36 Scaffold_7 AUGUSTUS transcript 183733 185430 0.89 - . g36.t1 Scaffold_7 AUGUSTUS stop_codon 183733 183735 . - 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_7 AUGUSTUS CDS 183733 185430 0.89 - 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_7 AUGUSTUS start_codon 185428 185430 . - 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MRAQQIQQNEWASFIQDYVKASSPADDWLNKAPENALRKWPDFKVVFLDRFPAPEATSATPQEFDHQLIAMRITDNEL # LLRVEEAGYKYIEFAAELLRIAKLAGIDQTFASISSVHANLPRALHNRVGEDHANWSSFVSAIKKVSKAEIEENLEQDKCIRELERVAAAAEQVVYRP # RAQLPPVPETLSKSLGQSLARVNLGPVLSRPMSNRPVASLTEEQCAVLLANSTRLPHHPNTEQGRVDYGKQCAEWAHTHGNISVTYNTPVPLKPGTVA # VRSGECYRCGKLGHRSRECTGVDQILKREGDWRALCGQELPQLGTTMNINLVSSFDSELEGDAAYGVGKWGRINRLDGSCMIQSSEGLKHNVSCTFLA # SNEDDVVDLFTVESDMSRAKKMSVGLQAPSGEKLTLEALVDGGAMVAALDEKLFEHVKDRFPGWEPSVKRLRMANGVVVSARAQWRGRVILQGEEVEG # VLQVFNSGGGWDMLFRKPLLQAFGAVHDFGDDSVRVRKKAVEVFQEGLGKEVAVKSIPEDETAAVQHMSEDKVYTSDGASAKAQTQGSGMSNIQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 Scaffold_7 AUGUSTUS gene 189344 190546 0.49 + . g37 Scaffold_7 AUGUSTUS transcript 189344 190546 0.49 + . g37.t1 Scaffold_7 AUGUSTUS start_codon 189344 189346 . + 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_7 AUGUSTUS CDS 189344 190546 0.49 + 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_7 AUGUSTUS stop_codon 190544 190546 . + 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MSTLPEAMEEGQQFEYSTLYTGDGQPVQVLTPRRGQPPVVTPAQGRSTTRIESPILQAIAHRTGKQPQRRAASESPCD # PPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLNDDSGGLPRGEPGDPSGPGNPGGPGGPGGPRSPISPDIPNEQRAMLELLPGFKGSIETLGTILAA # LGRPSDSSESKSKVKEQETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPAMLANYCQEVLHIDNRYWKREAGKPFVARNPKK # GSSDFKTGSTNQQNNSQPSGSSAPFMPKPKPFSGGKPNNNGKPQNSLNSGQSGSQRPAFNHLGADGKVLPSEKERRIKNNLCLFCGGKHQIADCNKRK # ARESKGHAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 Scaffold_7 AUGUSTUS gene 191336 191689 0.18 + . g38 Scaffold_7 AUGUSTUS transcript 191336 191689 0.18 + . g38.t1 Scaffold_7 AUGUSTUS start_codon 191336 191338 . + 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_7 AUGUSTUS CDS 191336 191689 0.18 + 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_7 AUGUSTUS stop_codon 191687 191689 . + 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MLVWSLFFFVLSTQRSRPVPPTTPPPLLLSSTSSLYSKEYAKFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRI # YPLSEKELVALKDFIDKQLATGAITHLLASWLVKIMYTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 Scaffold_7 AUGUSTUS gene 197863 198510 0.75 - . g39 Scaffold_7 AUGUSTUS transcript 197863 198510 0.75 - . g39.t1 Scaffold_7 AUGUSTUS stop_codon 197863 197865 . - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_7 AUGUSTUS CDS 197863 198510 0.75 - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_7 AUGUSTUS start_codon 198508 198510 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREA # GKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGG # KHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 Scaffold_7 AUGUSTUS gene 200609 202225 0.71 + . g40 Scaffold_7 AUGUSTUS transcript 200609 202225 0.71 + . g40.t1 Scaffold_7 AUGUSTUS start_codon 200609 200611 . + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_7 AUGUSTUS CDS 200609 202225 0.71 + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_7 AUGUSTUS stop_codon 202223 202225 . + 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWLVPKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQ # EAFKNLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRMLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVT # DHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRHWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIM # DIKALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDDRIYVPNHSDLCLQVLRYFHDHPLSGHFGQNCTLEAVRRQYTWPKVRDFVHDYVTSCTT # CGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRLSKQAIFIPTYDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVS # AFFRALGKALSMELHYTSGYHPEANGQTERVNQTLEQYIRIYCSYQQDDWLPLLPIAEFTYNNAPMLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 Scaffold_7 AUGUSTUS gene 207544 208455 0.81 - . g41 Scaffold_7 AUGUSTUS transcript 207544 208455 0.81 - . g41.t1 Scaffold_7 AUGUSTUS stop_codon 207544 207546 . - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_7 AUGUSTUS CDS 207544 208455 0.81 - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_7 AUGUSTUS start_codon 208453 208455 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MATGSMVNIPRLPDKKQLVGEENWRPFKHEILFAVQSRGLTGYMDGTIPKPTLRAEDYPGPIYLTTATPPYSPTPYPE # EWELRDRLVAGAIVSNITDPIGLGVDETKRTCDIWQNLIKRFKKRDKQRIHLAETSLRHEVFDPSTDTMESHEKKMRNLLKKVHDLGGSTMDAQIRRI # VIFSMPPDWRQDVRTVPGNSSADAFTYLQTLWYQREEERKEEERDTKRVKALMAARFQLPSFSQPREQQSYAITAASLDISPRNAGQRAAEWKGKARR # TTTNQRQESMHRQQQQMKVPKPAKLARLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 Scaffold_7 AUGUSTUS gene 209449 210204 0.73 - . g42 Scaffold_7 AUGUSTUS transcript 209449 210204 0.73 - . g42.t1 Scaffold_7 AUGUSTUS stop_codon 209449 209451 . - 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_7 AUGUSTUS CDS 209449 210204 0.73 - 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_7 AUGUSTUS start_codon 210202 210204 . - 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MSEVRAYAISAIRKLPDIDPVDKIVLARTYDIPTWLAPSFNEILQRSQSLTESDVDKLGIPTIVRLMELRDRVRPHIY # SPNGAWILGSARMETSVDFTAVICTVFPESQVEGMSDPIDEGIRDHDLDCNSRVVSSPTPVQSTNATGPVGAGSKAGFARALSPAELPTVDPTSQNQS # PTPVGFSSKAKHRPEPESTLSQDPRPASPWGLHKAPSTLAPFYGVATTLDPSLDASNQISMTAGTVIKNRKKSTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 Scaffold_7 AUGUSTUS gene 212587 213075 0.74 - . g43 Scaffold_7 AUGUSTUS transcript 212587 213075 0.74 - . g43.t1 Scaffold_7 AUGUSTUS stop_codon 212587 212589 . - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_7 AUGUSTUS CDS 212587 213075 0.74 - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_7 AUGUSTUS start_codon 213073 213075 . - 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MIPSPKVPTYDKDPKMSVKDVANKVAEVVRESKHEFVMCNFAPPDMVGHTGVFDAAVEAISHTDEAVGTVYKACQDAG # YILLITADHGNAEQMKNLETGAPHTAHTTNAVPFIMTGDPEKFKFTEDKDDGEQEPGALCDVAPTILDLLGLEQPKGVLCGSFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 Scaffold_7 AUGUSTUS gene 213184 213471 0.32 - . g44 Scaffold_7 AUGUSTUS transcript 213184 213471 0.32 - . g44.t1 Scaffold_7 AUGUSTUS stop_codon 213184 213186 . - 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_7 AUGUSTUS CDS 213184 213471 0.32 - 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_7 AUGUSTUS start_codon 213469 213471 . - 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MREIATVLGSLDKPMEVNIPKDLVCPLRVIHPILPANILLSLQHITTMSQYNSEFPFPVAFPPQVMTNVLAETLASQG # VKQAHIAGMYIPSNLPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 Scaffold_7 AUGUSTUS gene 217923 219069 0.32 + . g45 Scaffold_7 AUGUSTUS transcript 217923 219069 0.32 + . g45.t1 Scaffold_7 AUGUSTUS start_codon 217923 217925 . + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_7 AUGUSTUS CDS 217923 218437 0.46 + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_7 AUGUSTUS CDS 218493 218691 0.55 + 1 transcript_id "g45.t1"; gene_id "g45"; Scaffold_7 AUGUSTUS CDS 218755 219069 1 + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_7 AUGUSTUS stop_codon 219067 219069 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MPKLTLLTLSSKPKSIQIRRILLGLCRWQERGAIIINNHRIYEWILKLPHRPEVLVTHSKDLGQILKAIHTTSSKVGG # AIDIPTAIAVAQLALKHRENKNLRQRIIVFVGSPLEGPAADEKGMVKLAKKLKKNNVAVDVVCFGDGIEEPVSGQEDKSVLKSFVENATSSDNSHLVV # VPPGPRLISDALISSPILSDDRSASIPTELGGTGGDGPSASSGGDFEFGVDPSLDPELAMVSALRISMQEAQAREVAASTEASSSDASQPATTSSTVP # AESTEDEEEALLAQAIKMSSEEDVDMESAGTTKPSETDAPMNEDDEDEEAAIARAIAMSMQQDEQDKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 Scaffold_7 AUGUSTUS gene 225217 226446 0.6 + . g46 Scaffold_7 AUGUSTUS transcript 225217 226446 0.6 + . g46.t1 Scaffold_7 AUGUSTUS start_codon 225217 225219 . + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_7 AUGUSTUS CDS 225217 226446 0.6 + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_7 AUGUSTUS stop_codon 226444 226446 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MGFKSPSCNVAQSNGYWHAVSKINFNRFNYYSLPPQYPKQPPYARTPCCTFPFLFNQYIFQTSIQTRKNSSPFLCSSY # NSDETTQTKRVFPIVINFHGGGFTIGRATDDARWARAVVHYADAVVVSVDYRLAPEHPFPIAIEDGVDATLYLIEHAEELKIDPHRIAYSGFSAGGNM # SFSVPIRLAEEYRIRKTKRDAGSDTSSAMTQEGTVIAISSWYPSIDYTNTRDERRKTNVRSDKDLPKFFTNLFDSSYLYPVNGVDLKSPWLSPGIAPN # EMIKDLPENIVFYTCEWDELCAEADRFHHRLVNDFGKKVVYKKVMGVTHAFDKTPNPLHWDPKIETMYRDACRELRTVFYGSSSDSALEEAVAEGKEG # QQATVTTRMEDIKFPSSQDSLATVGSRYQEPVAGSTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 Scaffold_7 AUGUSTUS gene 231020 232509 0.61 - . g47 Scaffold_7 AUGUSTUS transcript 231020 232509 0.61 - . g47.t1 Scaffold_7 AUGUSTUS stop_codon 231020 231022 . - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_7 AUGUSTUS CDS 231020 232162 0.77 - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_7 AUGUSTUS CDS 232228 232509 0.61 - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_7 AUGUSTUS start_codon 232507 232509 . - 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MYRFAGMTQHVADVLAHKVFNILDDPEDDSKRISASGFGTWVRDLPDLLADDPKPRKGHQRNVSISSATQGFSISAST # PMSHRPQSRQASGSTTHPGASELSTVFDQEIEVEEVEARKYEDREECADVISEEGLNSRSQSAHKRRKRGARKGKGAATAPNTPKDETLATLAVASQS # LAREISKTSKLSGRTGSSTSLSASASSRRSRPYEPVSMYPLPTPLLSSTKPLVSRYPPTSASSMPAAPSSAPATATSVNKKPSKWKLSFGKASAAALV # PGGALHDDASSMLSTDSNSPMSGTASNVTSLIMALEAPAINSASITNLNDEDGLSTFNRGRRGRGSPPSSLYHDAHHSSRSPMPPRSPNRDRWDDRRS # DRAISPNSTRSGRPLASSASSVVSSNWRSSMSTNASMSSSAFTRYSNSSIRSVSTAATSVSSNSWRTNGKYATSSTSSYHAAHPGLPKNVKSESVKAT # FRIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 Scaffold_7 AUGUSTUS gene 233310 234116 0.67 - . g48 Scaffold_7 AUGUSTUS transcript 233310 234116 0.67 - . g48.t1 Scaffold_7 AUGUSTUS stop_codon 233310 233312 . - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_7 AUGUSTUS CDS 233310 234116 0.67 - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_7 AUGUSTUS start_codon 234114 234116 . - 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MLQYSTYPSLSSQASTKSAIGKDNSDYFRHNEPSSTRLSSSVNNKRVHRDSLSNRSSYAFSNPLSITTNLLSSPTASS # PSTMSSKPPRSPYISSRQALSPSPSAHPWSSSSAAKTPVDSRPTSPTQSVNSMALEDVLAAGDIVGEGATLQDETITLVSIGDPVSVRSDTPDYEQPA # KEFEVVRRLGAGSYAVVYLVCEVLYRPPPSEDGHTFGTLDLDDVSSQRPKTVYGREYALKCLSKANLDEEALAAQMSEVCYLQRMMCLHLLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 Scaffold_7 AUGUSTUS gene 236194 236571 0.48 - . g49 Scaffold_7 AUGUSTUS transcript 236194 236571 0.48 - . g49.t1 Scaffold_7 AUGUSTUS stop_codon 236194 236196 . - 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_7 AUGUSTUS CDS 236194 236571 0.48 - 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_7 AUGUSTUS start_codon 236569 236571 . - 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MELGFIESLRRRWDVLGITREGTGVSQNVKNIVSEKDQFLDVDMDEGTTTAGTEKARDAELERLDQEGDEGTAARKQI # LDGVIVKAVMDSAVQGELFLSMLPVISFPTALRIGVFISRTCVAPAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 Scaffold_7 AUGUSTUS gene 238979 240168 0.36 + . g50 Scaffold_7 AUGUSTUS transcript 238979 240168 0.36 + . g50.t1 Scaffold_7 AUGUSTUS start_codon 238979 238981 . + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_7 AUGUSTUS CDS 238979 239714 0.38 + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_7 AUGUSTUS CDS 239888 240168 0.93 + 2 transcript_id "g50.t1"; gene_id "g50"; Scaffold_7 AUGUSTUS stop_codon 240166 240168 . + 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MPRLALNNYLYRGELVECIENISWVEEMACAIYHTTAHVARIYGSSSSGDPLQLHGNVCAHPLDICSIAKRLPWSPVD # LNDLITVVFVGKAKLNEDDVKKLKPYFVRRNVIRLLLCDLCRRNRLYTGLYMLDDSMLELYPDNDLLPGLQDRIVYDHDSSADELFGTESTGFDDHPA # ELLGGSKQDSVLLERSGVYDPESQDVPARFMTASSIHNIAQSLPVPGADVVLRYDRDPINEYNNPDLFPAHLHTTLWVSSNKFCDIAPMLLSVSPTVL # LDLADKLKNEKDKSDFSDEEINAFQLLNNVNIIAAKIPGSQASKQLQEIKYVVIMAILVCHIYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 Scaffold_7 AUGUSTUS gene 240521 243807 0.51 + . g51 Scaffold_7 AUGUSTUS transcript 240521 243807 0.51 + . g51.t1 Scaffold_7 AUGUSTUS start_codon 240521 240523 . + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_7 AUGUSTUS CDS 240521 241115 0.52 + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_7 AUGUSTUS CDS 241211 243807 0.78 + 2 transcript_id "g51.t1"; gene_id "g51"; Scaffold_7 AUGUSTUS stop_codon 243805 243807 . + 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MHEVEDYCSQFLAFFDSIIQYHLPKVDDILVEGYEPRIEMPPDVPSIGSDNITFLNWQRLFEDEHKKIGERFQRHQCR # PVCHKGHSSTSNCRFGYPHEVIESSRFDVKENSIIFARRESDVNGHNPDLLVYTRHNHDIKCILSGKAAKAAMFYISDYITKMPLSTDILLSTLSKAV # SSITAEELDSDPIISSKKLLHRFILPSGNLMLFVKQLYDCNFDSNNLDSDKSELDIQLLLGFKDGKMFSYSQIIDYWYRDTLLVDMCFYDFIRYVSLQ # MQSKSRTVNTSDTRLGVLSRYKLMVGHPLYDTHELIRHTNYKQGDVGKEFVPVMVGAVPPRKHHKDYSLFVIAHFKPFSNSKTLVDDSIDVDFENLIL # SDEHKRILCNWEEIHECVDQRDAERLRKRADFLAKSIQLPDNVYSALDDDDELSVFVVPGSLKNHDRKLDNQELQLLKTDLTCAAWLKEPSVSIKQSI # VNSSSNNLNLPLLSDVSVQKWINEGKIMADRVASLRHNKQNVLDQHAQNVENNDLVDNNGFHNSKGFGRLNDVDCEKFTPMQLKAKIAGDFELNDEQL # IAFEIIASMIIFREILKIPEWIAKQALVMNLTGPGGTGKTHVICAVQKVMEYYGMDHTYQALAPTGNAASLVNGKTIHSGLNISVREHKNGRSKRPLG # ELSENVAVFATVKKNNSLRKEWKDVCLLLIDEVSMVDSILLADIDGSLRYAKEKPDEFFGGINVIFCGDPFQYPPVGTPLYIPIRSSGKQTDEELMRR # LGRMAWKSINTVVELHKQKRMEGDVEYAAAVGRLRLRQCNNSDVDLFNSRAIKTQSNPHGVIFNNESQYFASIIVSKNSIRRALNEYKAAAICKGIHS # PSLIAVVAHDEIQYKDSGESGSRSKKLFPSFYEQAQLLAMDTSSGKLRAGLPGVLNLYIGMPVIMKHENLNTELGITNGARGFLRKLELLTDNNGFTY # CKYALVEFPDSKVQLEGLPKGYFPIKSRSWRCSTYIFNKDKKKVLVSVVRMQLPFEPLFALTGQGAQGHTLAAICVCYILVDMVHMFLHLDLEVVKGC # LSLER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 Scaffold_7 AUGUSTUS gene 243876 244979 0.86 + . g52 Scaffold_7 AUGUSTUS transcript 243876 244979 0.86 + . g52.t1 Scaffold_7 AUGUSTUS start_codon 243876 243878 . + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_7 AUGUSTUS CDS 243876 244979 0.86 + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_7 AUGUSTUS stop_codon 244977 244979 . + 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MAHNTKIVWGFEEGILKDVPDAEGEQRLNFSNVHYEFTGYSSKKRKYADSDFNEKVHKSTKITGNEVTSLNKSIYVNH # IVPKGPSWDSDNWSCCFDTALVVLYNCYICMSDNSRNLWHSQSSSKQVFKHLGELYGNSVKQMYTSVWNVVRDLWRSEIFSVFGSGYLQHGHVLLPVS # TLIQCHSCEWSDVYLELHGRCDLHGVVHRYMGSVKCYNLLAKQLEPVYSHGAVISSTQSYIDVLHSVNYVDISSDTACDSHCVSSFIVHNVSTQVIAF # ELNGVVGIVPSDELNIPVYNTSMCLKYRLNSVIYYGDNHFTARVINTSGMWLYDGQVNGGIFENNILFNGEVGIDMTELNGRKAHIYLYVLCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 Scaffold_7 AUGUSTUS gene 247610 247936 0.99 - . g53 Scaffold_7 AUGUSTUS transcript 247610 247936 0.99 - . g53.t1 Scaffold_7 AUGUSTUS stop_codon 247610 247612 . - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_7 AUGUSTUS CDS 247610 247936 0.99 - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_7 AUGUSTUS start_codon 247934 247936 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MKTLLSLSQESWKVPVEADSSDYANGAVIVTNVDGKWRPVAFRSRSLNEVERNYEIYDKEMMAIMDSLSDWRQYLLGA # KEPVEVLRSPESPVFPETSEVESTTSQMGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 Scaffold_7 AUGUSTUS gene 250879 251487 0.84 - . g54 Scaffold_7 AUGUSTUS transcript 250879 251487 0.84 - . g54.t1 Scaffold_7 AUGUSTUS stop_codon 250879 250881 . - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_7 AUGUSTUS CDS 250879 251260 1 - 1 transcript_id "g54.t1"; gene_id "g54"; Scaffold_7 AUGUSTUS CDS 251363 251487 0.84 - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_7 AUGUSTUS start_codon 251485 251487 . - 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MSNPTPDPAPTTPVTTPHVHGKSLLRDLISLMAINPVQRVALWVQNYTDDNFDNDEEEWAITWKGFKDTLNASFLDKG # LTENSQEKLEHLRQGPNERAEDFFKEFEVIMRDAEYAKDTPYIIRLIEMNVKPKLIDQVYGTSNEQIEKFEELKQKSISIDDMWWHREEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 Scaffold_7 AUGUSTUS gene 255349 256503 0.88 + . g55 Scaffold_7 AUGUSTUS transcript 255349 256503 0.88 + . g55.t1 Scaffold_7 AUGUSTUS start_codon 255349 255351 . + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_7 AUGUSTUS CDS 255349 256503 0.88 + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_7 AUGUSTUS stop_codon 256501 256503 . + 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANA # MSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 Scaffold_7 AUGUSTUS gene 256554 258203 0.88 + . g56 Scaffold_7 AUGUSTUS transcript 256554 258203 0.88 + . g56.t1 Scaffold_7 AUGUSTUS start_codon 256554 256556 . + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_7 AUGUSTUS CDS 256554 258203 0.88 + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_7 AUGUSTUS stop_codon 258201 258203 . + 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFFQDFVTRNHVRCAPLHKPIDVFN # IDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPEL # EPPAENPHIEVPLEATLEPRESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSE # SASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLV # ADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMV # REVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNFGNYEGSWDLQTSTDALSGILPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 Scaffold_7 AUGUSTUS gene 258482 260266 0.47 + . g57 Scaffold_7 AUGUSTUS transcript 258482 260266 0.47 + . g57.t1 Scaffold_7 AUGUSTUS start_codon 258482 258484 . + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_7 AUGUSTUS CDS 258482 260266 0.47 + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_7 AUGUSTUS stop_codon 260264 260266 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVH # HVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHD # HPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPC # TSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVI # NSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLG # DRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSW # EPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 Scaffold_7 AUGUSTUS gene 271586 272209 0.59 - . g58 Scaffold_7 AUGUSTUS transcript 271586 272209 0.59 - . g58.t1 Scaffold_7 AUGUSTUS stop_codon 271586 271588 . - 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_7 AUGUSTUS CDS 271586 272209 0.59 - 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_7 AUGUSTUS start_codon 272207 272209 . - 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MQTTNVKIKFETFNDHNFLIDVSGPDSVVLQGLSLLQEELPAEISFHVPEAYHKRIIGVGGRSIQRIMKKYGVYVKFS # NAEEFAALGGYNDNDDNVIARTPAKNALNLDNLKQSVMELVNPRFVTQPPHYFDRHSQFLTRIKTLSMKRCPSLVDIIALCWVKRRSSFTISRQRQTL # KYGSLTKKQPLTWSLSLAQRAKFKLRQPCFW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 Scaffold_7 AUGUSTUS gene 284719 286002 0.5 + . g59 Scaffold_7 AUGUSTUS transcript 284719 286002 0.5 + . g59.t1 Scaffold_7 AUGUSTUS start_codon 284719 284721 . + 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_7 AUGUSTUS CDS 284719 285160 0.59 + 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_7 AUGUSTUS CDS 285287 286002 0.6 + 2 transcript_id "g59.t1"; gene_id "g59"; Scaffold_7 AUGUSTUS stop_codon 286000 286002 . + 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MLALGCEDGTIRFISVADDTLTHFKRLDRVKGRILSVAWGPPIPKENTSEDEDENDDDDDEWIDSWLVAGCSDSSLRK # WDASTGRMLDKMGTDKIRGERTLVWTVATLGSVTVIFRRRYPSYTPHLRDGTIISGDSLGMVKFWDSRTSYSSGVDQKLVQYSRVKTSQGSENSSEVR # SKMRWMQTSSRRMHAHDVRSLAIWPPYTPLPSSHKRHFPSDIAPVIASGGLDMSVVVTPAALPSSTLLSKVINPLATSVHANFDDSYHRRLAYSSGPS # STSAIHIARQARLVSCMQESRLSIWRILKRPSLSDEDEEEMMEETDSADWEKCVEMELDVHTNLVASAISDDGKWLVASDLYETKLFHLITDVGFSCY # STEARLSLIGILG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 Scaffold_7 AUGUSTUS gene 286043 286471 0.25 + . g60 Scaffold_7 AUGUSTUS transcript 286043 286471 0.25 + . g60.t1 Scaffold_7 AUGUSTUS start_codon 286043 286045 . + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_7 AUGUSTUS CDS 286043 286471 0.25 + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_7 AUGUSTUS stop_codon 286469 286471 . + 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MISLHLPPKTASTGGLSFAFTPDSTKLVMSTALTSYILVIDISEEKPRVLRKFDHHRQRNNLSNDRVTKDLKTINDDV # EMGSDVEEDSSDDDDSPLLGSVTRMAVSADGQWLATSDDRSRTHIFNLDSIQVGILGSHKLLYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 Scaffold_7 AUGUSTUS gene 298800 299138 0.95 - . g61 Scaffold_7 AUGUSTUS transcript 298800 299138 0.95 - . g61.t1 Scaffold_7 AUGUSTUS stop_codon 298800 298802 . - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_7 AUGUSTUS CDS 298800 299138 0.95 - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_7 AUGUSTUS start_codon 299136 299138 . - 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MFMRYFPGGGVGHTVNQGFFQSTPDDAENEPRGEESGDEEDELESDSEMHRTIMPPSQAQAEQPFAIDSDESVDGESS # RDSDGSFDSDPEGDDDLNETDLDDWQWDDGYGSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 Scaffold_7 AUGUSTUS gene 300735 303541 0.69 + . g62 Scaffold_7 AUGUSTUS transcript 300735 303541 0.69 + . g62.t1 Scaffold_7 AUGUSTUS start_codon 300735 300737 . + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_7 AUGUSTUS CDS 300735 302063 0.87 + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_7 AUGUSTUS CDS 302132 303541 0.72 + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_7 AUGUSTUS stop_codon 303539 303541 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MASTPSTSNASVAYAPHYALVASTSACGFDWSDEPCGIEVQRIEEVEDEDALTTRITIEDCPNEIEESLAYVTIAQPT # LTQPTSGAPLDSGATDHFFRHREAFTDYREIPIRYGHAAQAGDGFPIVGRGSVTRNVFTNGKWACVTFKNALHAPSLASDLLSVSQLDKAGCKTVFGL # NRAVVSKDNHSLFGASVRDGMYVVEMEPLPAAFLSTNSPVSLCQWHRRLAHGSPDTICIMSDKDLVDGLTITSREVPGKCVDCILARQTTRPYDKPSN # PNVDPLELVAIDLWGPSRVPTAAGNKYMMVISDSGSGTHGGEFLKDKGDATTIPAFDEYRIRAEAESGKKIRTVISDNSFNTEAWRRYFNSHNIRHVT # TTPYSSAQNGLAERAIRQITEDMRANLRDSGLPPPYWAHAADHAIYTRNLIPSRRHPNQIPREILTGKRQDVDGGDKIDDRGIECTFLGYAPGSGNYI # CQDKQGRIIDSRSVIFEEGVPHRTRDSDEVDFLDEVPLQSRTDTTIPPSPPSPLTPLPKSPEPAEPERAMRRSRAEIWGTIPTRSSARLNPPMEPIPA # ASLASDPFSRLSCELDDYLALMSSDPISTSVPRSYSEALRQDKDRWLAAMDVEMENHRQKGTWELVDPPPGANIMDCRWVYDIKKDNEGRAIRDKARL # VGKGFTQQLGVDYTETWAAVSRLESIRMLAAVAASLGLELWQVDFVAAYLNSIPEVDIYMRQPPGYVTPETEGKVCLLLKTIYGTMQGAHDWANTLDK # SFTSLGYQASKADPCIRTKRHPGVTITATYTDDVWGASESRELGEKAKAELAALWDIKDVGENHRLLGMRVEQNLERGIVKLSQQGYFEEVFTRFKLE # NLTPRSTPLPVGINLDSSMSPKTESEKSEMVETLSTTSWLRNVGTASNST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 Scaffold_7 AUGUSTUS gene 308829 309386 0.95 + . g63 Scaffold_7 AUGUSTUS transcript 308829 309386 0.95 + . g63.t1 Scaffold_7 AUGUSTUS start_codon 308829 308831 . + 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_7 AUGUSTUS CDS 308829 309386 0.95 + 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_7 AUGUSTUS stop_codon 309384 309386 . + 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHYESPEDDGTEEKLVDGERIFWFDWDGYLSDQG # HIKVQTATTDAATPYLAEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGRIRPSRSPMASPFFFVKKKDGT # LRPVQIIES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 Scaffold_7 AUGUSTUS gene 309668 310981 0.33 + . g64 Scaffold_7 AUGUSTUS transcript 309668 310981 0.33 + . g64.t1 Scaffold_7 AUGUSTUS start_codon 309668 309670 . + 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_7 AUGUSTUS CDS 309668 310981 0.33 + 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_7 AUGUSTUS stop_codon 310979 310981 . + 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MDDILIFTDNIEEHRIIVRKVLDILKANKLYLKPEKCTFEAREVEYLGIIVGNGQIRMDPKKVEAVRTWQPPQKKREL # QSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDAFNQLKDRIIEDVTLIIPRETGKFRIEADSSDYANGAVLSQNVDGKWRPVAFRSRSL # NEVERNYEIYDKEMMAIMDSLADWRQYLLGAKEPVEVFTDHQNLQYFRKPQKLNRRQARWVVEIAEYHIELFHKPGKSMGKADALSRMSGLEKGENDN # TDVTLLKPEFFISQVTDQTSAPEDDLLNLIRRKKNQRDKLVQVALESKDKEWLETEDGLAVWQGRIYVPKDKELRGRIIQAHHDAQTAGHPGRYKTIE # LITRNYWWPGISRDVRIYVEGCEKCQATKTHRTKPVGPLHPHDVPSEPWEIIGTDMIGELPVWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 Scaffold_7 AUGUSTUS gene 311414 312010 0.93 + . g65 Scaffold_7 AUGUSTUS transcript 311414 312010 0.93 + . g65.t1 Scaffold_7 AUGUSTUS start_codon 311414 311416 . + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_7 AUGUSTUS CDS 311414 312010 0.93 + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_7 AUGUSTUS stop_codon 312008 312010 . + 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MTSQNPTAQEFADSMKRIREEVGSALKKAAEDMKRQYDKHRNEAIEYKAGDKVWLEGTNITTDRPMKKLGDKRFGPFK # VLEKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPTQPRNTEPPPEVVGEEEEYEVEEVVDARKYRNGIQYKVKWRGYGPHEMTWEPAANMTNA # KEAVQDFHKKYPNKPRPRTLKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 Scaffold_7 AUGUSTUS gene 314731 315687 0.54 + . g66 Scaffold_7 AUGUSTUS transcript 314731 315687 0.54 + . g66.t1 Scaffold_7 AUGUSTUS start_codon 314731 314733 . + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_7 AUGUSTUS CDS 314731 315687 0.54 + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_7 AUGUSTUS stop_codon 315685 315687 . + 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKV # EDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTT # PRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQ # MNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 Scaffold_7 AUGUSTUS gene 315717 318033 0.44 + . g67 Scaffold_7 AUGUSTUS transcript 315717 318033 0.44 + . g67.t1 Scaffold_7 AUGUSTUS start_codon 315717 315719 . + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_7 AUGUSTUS CDS 315717 317148 0.92 + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_7 AUGUSTUS CDS 317223 317463 0.52 + 2 transcript_id "g67.t1"; gene_id "g67"; Scaffold_7 AUGUSTUS CDS 317556 318033 0.98 + 1 transcript_id "g67.t1"; gene_id "g67"; Scaffold_7 AUGUSTUS stop_codon 318031 318033 . + 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSES # TETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIK # LNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 Scaffold_7 AUGUSTUS gene 318228 319079 0.79 + . g68 Scaffold_7 AUGUSTUS transcript 318228 319079 0.79 + . g68.t1 Scaffold_7 AUGUSTUS start_codon 318228 318230 . + 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_7 AUGUSTUS CDS 318228 319079 0.79 + 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_7 AUGUSTUS stop_codon 319077 319079 . + 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIA # QVVLEWPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 Scaffold_7 AUGUSTUS gene 319126 321196 0.3 + . g69 Scaffold_7 AUGUSTUS transcript 319126 321196 0.3 + . g69.t1 Scaffold_7 AUGUSTUS start_codon 319126 319128 . + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_7 AUGUSTUS CDS 319126 320229 0.37 + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_7 AUGUSTUS CDS 320378 321196 0.5 + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_7 AUGUSTUS stop_codon 321194 321196 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKK # KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSR # ITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVF # SRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKKSTDEL # LKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIK # GIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYR # AQALSKHNSFIEKVRRREMQIKLQSYEDLNENIDIQLKIGISNQVNWSRLGILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 Scaffold_7 AUGUSTUS gene 321235 321492 0.5 + . g70 Scaffold_7 AUGUSTUS transcript 321235 321492 0.5 + . g70.t1 Scaffold_7 AUGUSTUS start_codon 321235 321237 . + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_7 AUGUSTUS CDS 321235 321492 0.5 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_7 AUGUSTUS stop_codon 321490 321492 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 Scaffold_7 AUGUSTUS gene 321753 322430 0.94 - . g71 Scaffold_7 AUGUSTUS transcript 321753 322430 0.94 - . g71.t1 Scaffold_7 AUGUSTUS stop_codon 321753 321755 . - 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_7 AUGUSTUS CDS 321753 322180 1 - 2 transcript_id "g71.t1"; gene_id "g71"; Scaffold_7 AUGUSTUS CDS 322262 322430 0.94 - 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_7 AUGUSTUS start_codon 322428 322430 . - 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MFCIHDSFHVVESSQHSLSHTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTP # PAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVE # RATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 Scaffold_7 AUGUSTUS gene 324239 324583 0.87 - . g72 Scaffold_7 AUGUSTUS transcript 324239 324583 0.87 - . g72.t1 Scaffold_7 AUGUSTUS stop_codon 324239 324241 . - 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_7 AUGUSTUS CDS 324239 324583 0.87 - 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_7 AUGUSTUS start_codon 324581 324583 . - 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 Scaffold_7 AUGUSTUS gene 325834 326283 0.42 - . g73 Scaffold_7 AUGUSTUS transcript 325834 326283 0.42 - . g73.t1 Scaffold_7 AUGUSTUS stop_codon 325834 325836 . - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_7 AUGUSTUS CDS 325834 326283 0.42 - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_7 AUGUSTUS start_codon 326281 326283 . - 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MRLVPSKDLDVFASLHGKVSPAVASKISTPSPPLEIKPSTSVPKAPVAPPRLIRRNRELESLKADASTFCEYQLNSLI # YYLYSFNLVVVSSPRSTYSKDSDNELLSGFPSAGSASRAFSSSTKVPMGRKEPKPKTTIKVVEXLPQAQLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 Scaffold_7 AUGUSTUS gene 336558 339694 0.08 + . g74 Scaffold_7 AUGUSTUS transcript 336558 339694 0.08 + . g74.t1 Scaffold_7 AUGUSTUS start_codon 336558 336560 . + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_7 AUGUSTUS CDS 336558 336650 0.5 + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_7 AUGUSTUS CDS 336715 337124 0.51 + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_7 AUGUSTUS CDS 337249 337645 0.81 + 1 transcript_id "g74.t1"; gene_id "g74"; Scaffold_7 AUGUSTUS CDS 337729 337834 0.47 + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_7 AUGUSTUS CDS 338892 339694 1 + 2 transcript_id "g74.t1"; gene_id "g74"; Scaffold_7 AUGUSTUS stop_codon 339692 339694 . + 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPPAVRETTPTSAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNN # HDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPRSSNLLTSPTSNVLCWNSSRGSRVPLRPLVPSSPLSAVPLTALNPRARSRSQSGSAKEWFV # PDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPAT # LADYRQEVLRIDNRYWKREETRSVRLPSLFGAVHAEPKPFSGGKPNNNGKPQNSSNSGQSGEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEI # AADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISD # LLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEF # FGGYGNIGFTPTPRSANSIWILLSIWVIFFLPTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 Scaffold_7 AUGUSTUS gene 347786 348214 0.94 - . g75 Scaffold_7 AUGUSTUS transcript 347786 348214 0.94 - . g75.t1 Scaffold_7 AUGUSTUS stop_codon 347786 347788 . - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_7 AUGUSTUS CDS 347786 348214 0.94 - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_7 AUGUSTUS start_codon 348212 348214 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MAHLPEPVMLADYRQEVLCIDNCYWKCGETQKREAGKPFIAQNPKKGSSDFKTGSTNQQNNSQPSGSSALFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 Scaffold_7 AUGUSTUS gene 348259 349352 0.35 - . g76 Scaffold_7 AUGUSTUS transcript 348259 349352 0.35 - . g76.t1 Scaffold_7 AUGUSTUS stop_codon 348259 348261 . - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_7 AUGUSTUS CDS 348259 348505 0.66 - 1 transcript_id "g76.t1"; gene_id "g76"; Scaffold_7 AUGUSTUS CDS 348677 348980 0.41 - 2 transcript_id "g76.t1"; gene_id "g76"; Scaffold_7 AUGUSTUS CDS 349082 349352 0.41 - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_7 AUGUSTUS start_codon 349350 349352 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MPPKTRAQSRANFEENTFFTTAQSSAPFSESISAIGQPCRRNRSFGPATVPTTLTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPCCGQPRESPRDPPLTSIWTLVITMIKTLLSTLTTPGADNNNDNLENDSGDLPHGEPGDPSGPGGPGGPGGPHFPISPDIPTSNMLCWNFSQD # SRVPLKPLVPFSPPRPGSAKERFVPDILNPDLNSLPAWSSSFKALVKPLQDNFGVYDAQGEAEDSLSNLKMKETENIRKYNIRFNTLAASTNWDSAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 Scaffold_7 AUGUSTUS gene 351878 352684 0.59 + . g77 Scaffold_7 AUGUSTUS transcript 351878 352684 0.59 + . g77.t1 Scaffold_7 AUGUSTUS start_codon 351878 351880 . + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_7 AUGUSTUS CDS 351878 352208 0.59 + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_7 AUGUSTUS CDS 352386 352684 0.82 + 2 transcript_id "g77.t1"; gene_id "g77"; Scaffold_7 AUGUSTUS stop_codon 352682 352684 . + 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MSTSQSGNYGRRKHYIPLESNPEVFTELIHTLGVSSSLSFQDVYSLNDPDLLSLVPRPVFGLVLIFPAMEDYDKVLEE # DKKTRPNAYTGKGEDEPVIWFEQTIGNACGLYEASEKVEYAHAHAGKSGHTAAPDPKDDVEHHYVAFVTSNTGNGDVYEMDGMKQGPLKTDVTLKEGE # DLLTEAGRNLIKAFIEREQGRSIGFSLMALVKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 Scaffold_7 AUGUSTUS gene 352761 353627 0.99 - . g78 Scaffold_7 AUGUSTUS transcript 352761 353627 0.99 - . g78.t1 Scaffold_7 AUGUSTUS stop_codon 352761 352763 . - 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_7 AUGUSTUS CDS 352761 353627 0.99 - 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_7 AUGUSTUS start_codon 353625 353627 . - 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MDSFIRSKYESRRWALDGPPPSDPSVLENGTPSKPAAPSAPATPVQQAPAPSQATHTPTNSISATRSTTSTRHQLLST # GLVNRPVGPVPTPSPPATAAPTVTAPAPAPQNDLFSLDFHAPPTRTNTTTDNSTPEQRKDVKQDILSLFSAAPPQSSSAMNSGFGQLSGVPAQAASPW # GAAPVAAQAPVTSMMGSNGTGMWGTSSGWANAPAVPAQSNVWGASAAPAVPQQQFNLYASSNDIWGSSSTVAPVATGEVRICLAHSRRLVLQSPKRTM # RLEIFGEGSSRIIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 Scaffold_7 AUGUSTUS gene 357738 359217 0.94 - . g79 Scaffold_7 AUGUSTUS transcript 357738 359217 0.94 - . g79.t1 Scaffold_7 AUGUSTUS stop_codon 357738 357740 . - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_7 AUGUSTUS CDS 357738 358732 0.95 - 2 transcript_id "g79.t1"; gene_id "g79"; Scaffold_7 AUGUSTUS CDS 358818 359217 0.96 - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_7 AUGUSTUS start_codon 359215 359217 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MRSSLLPSSLRTRKVSFQHAGDPHLDVIHEVEERGGDSNGFEQTVLQDVYSSSPTLSSDIDFCNSDLPLSQSSATSVS # DILRDEVLKDSSSSTIEAQFAQDLHGRLAKLSGGSETVYTSSIPPSSRTQSSTTSSVPSLFIIYSNFRSLDRSMKPLSVENQSTPSPLTRKRPRPSAS # FHVHSPYLIANSANHKKRRLLRHATIADPNRYATRTASFRRALSLRSQAPDIQEEPHLTVIPTPASLNAGTSSLCSALDLEPSPGWIPTVPCSPEPEQ # PAHTTPLRRAQNYRDPLFDPDVISPIAKDAQKAYDVSKKQARILSSKVPIIAPPPNHVYSPPLSEASQAKLRLIRFREREQMMRDTDFDMMHKTADVL # APSTPSTLAAEMIMRSVVVNEGHSEDVEMHLEELDDETDQLQADDSKVSRRTSYKRCAGIHGSGTRMIQWILEVCLDRTRPFPAFMFIWISI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 Scaffold_7 AUGUSTUS gene 362380 365191 0.2 - . g80 Scaffold_7 AUGUSTUS transcript 362380 365191 0.2 - . g80.t1 Scaffold_7 AUGUSTUS stop_codon 362380 362382 . - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_7 AUGUSTUS CDS 362380 362766 0.72 - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_7 AUGUSTUS CDS 362942 365191 0.23 - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_7 AUGUSTUS start_codon 365189 365191 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MDLPSNNSRQQRSSPANDGTSPSPTTAPPHGSHPQFQQMNHQQSQQPPQQPYPYPVQQQPQGSWTPSISAQPFYPSFY # QNHQQSPQGYPQLPQQAPYFDPANAQLAQWAYQQMMFNAQQGFIPPQQTRSSSGRSGSGPSPDYFAQNQMNPMFNPFPSGTPPPPHPNRTASVDQQQQ # QQQQNGQYPGFHPYRRPVRQGSSQSHPHAADGDWRPANMPIPPYARPDASGSSSSVNSTNSQRQRTNSNQSGNSGQNTPPGGSIRSRNGSPAAAGNQQ # PVSPATAARSSPSGSTSSTSSATPAAPKLPHNRNLSSSSAGSSTASSRPSGLAPSITSPPMSTTSSTPPSSASSSTNLRPARPSPLSQGTFTASEKRM # SRDDSDLAAMLESTPSAAMIRSGGLKGRLRRALTFNAQQQALKEEEDDDDASIKASALGSSSSKLKPKSAHSINTVVGQSNPGGGVPSPDIDDAESTA # TVQTKKKSRAASLFNSRLNASTDNISLSSTVSSASVMIRKLGSMGKLARRNSLAGITSLFKDKEKKNKEKEKEEGESADKKGKKKKSAKAEASEASVS # HVTAELDRSAGDWGGPEMNGLSPAAKLARQHTLKSNAEAAAKAKAQQEAAVAAAAAAAVSSTQPNGYGSGAGVPTWEKNTHTRQGSVSPVKGGGGFRI # NEDGTRVLVEDDDEDRSDDGHYGVPTQSTGEYNPEGWDDDEDWDGEDDEDVTIRMGIGRVSLDNEYEEPDPWATDIRRSVERTRAELGPLARIPSPDP # DHIDGLHRHGSHSSGHGSNSTITAAPTIPPLSFEPSAPSPIRATNFDSPRDSIDSTSTVSHVPHAPEKSSLLFSHSNSSAPALSTISSKAPTLTHRSA # TTPSKRLAFANNLSVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 Scaffold_7 AUGUSTUS gene 369758 370279 0.61 - . g81 Scaffold_7 AUGUSTUS transcript 369758 370279 0.61 - . g81.t1 Scaffold_7 AUGUSTUS stop_codon 369758 369760 . - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_7 AUGUSTUS CDS 369758 370279 0.61 - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_7 AUGUSTUS start_codon 370277 370279 . - 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MSTEYIIPQTQIAAVIEEAGGELKIKKDHPVKRPEELAPGECLVKLECSGSCFPRARRGWDLTKVSTTSGACHSDLHA # ALGDWPVPPRLPLIGGHEGVGIVVAIGRNTVDSPVKLGDRVGIKWIANSCLNCDNVEKEESRVSILAIDLSWVAHVSFCFFCDLYFRPLLILTFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 Scaffold_7 AUGUSTUS gene 376186 376461 0.57 - . g82 Scaffold_7 AUGUSTUS transcript 376186 376461 0.57 - . g82.t1 Scaffold_7 AUGUSTUS stop_codon 376186 376188 . - 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_7 AUGUSTUS CDS 376186 376461 0.57 - 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_7 AUGUSTUS start_codon 376459 376461 . - 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MFTKFRMQAALAEIAVEDLSKEDAEEDKDFIVETCVYQIHLVNLLFLILQNYIDEEDVFESDFESTDEEEPAAAEHEP # IENEEKQAKRYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 Scaffold_7 AUGUSTUS gene 376918 377283 0.76 - . g83 Scaffold_7 AUGUSTUS transcript 376918 377283 0.76 - . g83.t1 Scaffold_7 AUGUSTUS stop_codon 376918 376920 . - 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_7 AUGUSTUS CDS 376918 377283 0.76 - 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_7 AUGUSTUS start_codon 377281 377283 . - 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MHDKWSTTILQELLDISGGDPWTKWKRTRSERGLPLLPGEEKATVYAPPDRGAATFMNLKEWRDSAQARALAQEKAEK # EKKEKAKAKEKEKKKAAEVHVAELSAEVLENLRTKTGAAAILP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 Scaffold_7 AUGUSTUS gene 378199 380563 0.3 + . g84 Scaffold_7 AUGUSTUS transcript 378199 380563 0.3 + . g84.t1 Scaffold_7 AUGUSTUS start_codon 378199 378201 . + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_7 AUGUSTUS CDS 378199 378205 0.3 + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_7 AUGUSTUS CDS 378369 380563 0.99 + 2 transcript_id "g84.t1"; gene_id "g84"; Scaffold_7 AUGUSTUS stop_codon 380561 380563 . + 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MQPSLHVSNNADPIVTPKSPTIARNNVASSPKASVSVRTLNGRIRKPAPVYSSGSLSPGGSVINSSTRPARTTPIASS # TSGVSTISDALDISPGASLLPSAPLRHSRSKSVRILVPDDAVFGTFSRSISSPDYRRASGRSGFGSGFVNSRQLSGSSTPLPSPLEAVLEYADDSGVG # LGPDQGREHDFEQTENLLSSSFSDSEAEEADEGKDGGGGDGTDTDDDLDGNLRVSGFLLANGLCPKIITDLWFAFCFQTSFTETQSVRNITHNNCNTN # GLDMPHNLPASGVGVAPISSHSHSVSWVSNVLNNRESWAPSDHRSRNDSPLTQSFVDPRTNPRNQEDMYTTDQIASSGGGGNYLYIQNSTSGSPSGTL # GELTPETRPRTPESHRHSHPIYQPSTHIRTSSSTSRNISSRLCHNYTPLLPGMSSVVALEKTEYLIILESFLEGPSELKHRHSSPGNVRVRIVGGRST # WREYLHPGAYAVMFIEDQECLVNIVKELGVEDHHRTETIPRNTPAKPPNPASDTSDSDVAINHNANPHYMSWRPGMHITVTLAGVPFLVVQVKRLRLL # KNTKDAVAGETTPAAEYNYPMAQIAGISEQWWALPENGSHVVLILGIEKRRREYLVRVIRRLTTTSLALVVPTSLNDGTQAERASESPGSDSTFKVMF # KENHHTHVLSEDSQEPQSHSPGQLPLRLLSARRRFPLPYRRSFLCFLPVRLPLQCRTSSFLQRDIDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 Scaffold_7 AUGUSTUS gene 383662 384757 0.38 + . g85 Scaffold_7 AUGUSTUS transcript 383662 384757 0.38 + . g85.t1 Scaffold_7 AUGUSTUS start_codon 383662 383664 . + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_7 AUGUSTUS CDS 383662 383686 0.38 + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_7 AUGUSTUS CDS 384060 384757 0.96 + 2 transcript_id "g85.t1"; gene_id "g85"; Scaffold_7 AUGUSTUS stop_codon 384755 384757 . + 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MFTRNEMYYPPLPSISRTSNFVGDETPTIPTPAGNSASRPTASSSIHSDTSPLAGPDPSVWSNQQQQQLMQALLGGMG # GMAGMPGMPGLTGMGGVNPGQQAIGSSAIDPAFAENPLAAMLMGAQAGQNGGAPPFMPPGMGFGKAPDKHGNGAQVKSSPSLMQKLLPLVHLVALWTL # LAYFVIYIEPRTQSVFADVSEVTSWSGIITKWAELAKRRPQAEIIQGWSVAAVVRFSLNLRVAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 Scaffold_7 AUGUSTUS gene 389099 390699 0.64 + . g86 Scaffold_7 AUGUSTUS transcript 389099 390699 0.64 + . g86.t1 Scaffold_7 AUGUSTUS start_codon 389099 389101 . + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_7 AUGUSTUS CDS 389099 389793 0.64 + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_7 AUGUSTUS CDS 389835 390699 1 + 1 transcript_id "g86.t1"; gene_id "g86"; Scaffold_7 AUGUSTUS stop_codon 390697 390699 . + 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MPTVLTASHGVTSMPSSSFSSSSSTLLMLPPSMSPSLLSGSSPSSSSSPLDPLLTSIRHLLSRALSLPCSTAAQAFIQ # LVQPTLRFQVALDALLPLLDGDLQTSSATANADTINRSSNNQVAQRILVSFILYSLYAPHPISINPFRSALLMTFVNERERAIRAANVHAETNIVTRV # TGNSSSEQLVWVLWKILRGDGNDIGPYTPSTLARSPLPPKLAAINLILDESDDNDFTSRDNYYTAARNAGSGTLFNTDSTTNTSRATTFVTPSEDLEN # AVISRGLTLLLAARERVLSLSERRTLEPIFPALAASDIITPRDLSSIVTFNPDVAYPLFVELLTTSVSSPSTFIDLLDILPYLPSSLSTFDLMGKLLR # DARLIPIPNAIAHLLIINGHDHDENHTPESRVPLGKLIRYQVLARFMHECIERLEKEEKERTSLEGSVGSSDGDDTWGRGVRNLCRFYLSLIKLNIVQ # NPNSANWENYEIESFSADSVEMAHFALRNSRFEEARMLYGVLATGGFDM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 Scaffold_7 AUGUSTUS gene 393225 395098 0.91 - . g87 Scaffold_7 AUGUSTUS transcript 393225 395098 0.91 - . g87.t1 Scaffold_7 AUGUSTUS stop_codon 393225 393227 . - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_7 AUGUSTUS CDS 393225 394596 0.99 - 1 transcript_id "g87.t1"; gene_id "g87"; Scaffold_7 AUGUSTUS CDS 394776 395098 0.92 - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_7 AUGUSTUS start_codon 395096 395098 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MADLTSLTPSQTRALGQLRDLTNGGDDEVAMGVLRSVDWDVQRAAEMIFDGQTGAESSRTGESRNNISSRVNLEDSQG # RRYEEFDVDDSEQGLLRPREPVSYALIHSTTPGRTTVRRAGGGIERWIRELEEETGAICAGSADNVDATGVQVNTSAEAGPSTLTSRHTSATGSGSSK # LLPPFQLGTYDSILRLCQSSFRIGCIILVSAEHDSTAEFKDTTLTNDELVQILVDNNIVCWGGDIRDKEAYEAGLKLGATTYPFVAFMGMQPSRNFTS # SSGSTTTTASQSTPALTVLSRHLGASACTSSALTTHLRETLLPRVKPYLDRTRMQREAVERERTRERELREAQDRAFEETKRRDKERILKKMEEEKVE # LQRKQAEEDQMRMENELRERQRIEAQEQTEERDRWRTWFRKVLPAEPNATETIRIAIRMPDGRRLMRRFDMHEDTLDTLYAYVDTELVSTSVSSSSSS # SSSYSFETLHTLLSTRVPKTNEWWGFTLVSAYPRQLIPWSPNTLLGNIKAVSGGQLVVEIVNSRVNGDRKNAGGKGKGKAQDEDEYETESSDED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 Scaffold_7 AUGUSTUS gene 404741 405268 0.9 - . g88 Scaffold_7 AUGUSTUS transcript 404741 405268 0.9 - . g88.t1 Scaffold_7 AUGUSTUS stop_codon 404741 404743 . - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_7 AUGUSTUS CDS 404741 405268 0.9 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_7 AUGUSTUS start_codon 405266 405268 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MFNILGPLINPAGPKGMVLGIAEPELGAPFAQSLRDGGVERALVVCGQERLDEISCAGLTWAWELKDGKISELTLQPA # LFGLNSHPLSSVAGGKPEENAATFKTLLTSGTDIPARLKPVLDFVCMNASALLVVAGVAADYKEGTRLALESITNGNAWAALETFRESGKQASSPNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 Scaffold_7 AUGUSTUS gene 413277 414883 0.26 + . g89 Scaffold_7 AUGUSTUS transcript 413277 414883 0.26 + . g89.t1 Scaffold_7 AUGUSTUS start_codon 413277 413279 . + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_7 AUGUSTUS CDS 413277 413446 0.28 + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_7 AUGUSTUS CDS 413808 414132 0.47 + 1 transcript_id "g89.t1"; gene_id "g89"; Scaffold_7 AUGUSTUS CDS 414320 414883 0.69 + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_7 AUGUSTUS stop_codon 414881 414883 . + 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MKPNKPLEPPTPRTSVLGLDRLAKEKRAATADEGSRKKAKYDDDGNEPVFKSACAYSWDSTPRSVRGGPADAPSVRVP # NVGWDSTPRSSRGGDASGWGGARNRGWDTPTPRVARGESPEEDRAWTVDAREWEEEQVRLDRDWYTGTESGMAGDDDYNPWHSTRISNADNDLWEANR # MLTSGVATRKTVDLDFEDESESTVHVMVHDLKPPFLDGRTVYTKQLDPINPIRDPTSDMAIFSKKGSALVKEKREQAERAKAAAKLAALGGTSLGNIM # GVKDEEAEAEGMAISFPIPNFSELHIHVSYRSFFPQPKRKGKKRKPRRREKTITRATPNLLRTSSPLLVSAPLLDPGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 Scaffold_7 AUGUSTUS gene 423239 424860 0.79 + . g90 Scaffold_7 AUGUSTUS transcript 423239 424860 0.79 + . g90.t1 Scaffold_7 AUGUSTUS start_codon 423239 423241 . + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_7 AUGUSTUS CDS 423239 423409 0.8 + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_7 AUGUSTUS CDS 423487 424860 0.93 + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_7 AUGUSTUS stop_codon 424858 424860 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MGLDTPSKTKPQISPVSPLIHSHFRSASNASRSSRGDSPSVYEESSFMDMGDDNPRDQRFKYDEDQNSSLDSASALRD # SWQSGSVHDPGKRSINQSALRNVEGQQYVPVFAPEEPSSPSSPVPAVVITSPDDLVPRAGGRVPIVRNVGAVSNYSRPVRGSSGEPEDRNSGHNSEGT # MMIPGRPRHNSSAAPVLDADVFDPESKRRVLERNISKRRLNAGSPSSTSSFSGTRSDTGSTSTPSSSYYAQHINPGSGRSTPSHSSLSPPGNSLPISR # EMSPSPLSQTLRSRSPRPMAPSSLRTSQSHPEIALPRRPPSLRPDSPASLYSDAYSFYQLDSASPSPNGSKFKFDSPSRGFGSPTSQTNSNTPPPPMV # VVDPPDEAKSKADHYLQLGIKHHEANRLQESAICFEKSAKEGGGCGVGMLMWGLTLRHGWGCKKDEKGGFVWVRRAAEGAVADLERARMSGGTGDLAE # RVVVKAELVLAIYEVGQCFFHGWGVVKDQKMGVVGYFCCWFGHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 Scaffold_7 AUGUSTUS gene 431525 432985 0.86 - . g91 Scaffold_7 AUGUSTUS transcript 431525 432985 0.86 - . g91.t1 Scaffold_7 AUGUSTUS stop_codon 431525 431527 . - 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_7 AUGUSTUS CDS 431525 432985 0.86 - 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_7 AUGUSTUS start_codon 432983 432985 . - 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MIRPLKLAIIGGGPSGFYLASRLLSRFPQSYADSLRVHIFDRLWAPHGLVRYGVAPDHPEVKNCTHKFDSAASDPRLK # FFGNVNVASDGENALNGVPLSSLKKNYTHLVFATGCTEPNLHPLLPRDDGIIPALDIVHWYTRHPSNPSPPPLSSTNHVSIIGMGNVSLDVARMLLCP # PSLLEKYDVPSHVLDALRSSKVKHVSVIGRRGPLEAAFTTKELREMMNLPDVALRPLEKSVLDVQASTRQQSRTLDLLKKGSKAAFGTTLKTWSLDFY # RNPISVTVPSSNSPSYSLTLGHTVVDAATKRAGPLLDSNGAPITSVLPTSLIVPAMGFHAEPSSAAPYAQWYDLDQKHIKTLPGGRVSTTNLDTEEPK # IYASGWAATGAKGVLASTMMNAYSVAEAILEDWTNLTPSSTTSNTHPVAISSSPWDAPPSEILDGLSSANITTYEDWLAVDAEEVRRASAGGKERERM # DWNEAKKFLHGTAKQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 Scaffold_7 AUGUSTUS gene 433294 433874 0.66 - . g92 Scaffold_7 AUGUSTUS transcript 433294 433874 0.66 - . g92.t1 Scaffold_7 AUGUSTUS stop_codon 433294 433296 . - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_7 AUGUSTUS CDS 433294 433713 0.91 - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_7 AUGUSTUS CDS 433773 433874 0.67 - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_7 AUGUSTUS start_codon 433872 433874 . - 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MRRTSKSGVLTLPSSPLSSPGSSISTFELLYPRYYPDHDSALGFGSLSLTLEPKLSATPPLATVSSSLAGWNGLVVPQ # INQTVSTSPMSESSSAPPGWAITAPTEVNCHMYNPEGYASTMTPASYWNPGVVVESAALHNYNIGLMDQSTPEDYLMFDTPVAEEQQIFEGFCHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 Scaffold_7 AUGUSTUS gene 444939 445790 0.9 + . g93 Scaffold_7 AUGUSTUS transcript 444939 445790 0.9 + . g93.t1 Scaffold_7 AUGUSTUS start_codon 444939 444941 . + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_7 AUGUSTUS CDS 444939 445790 0.9 + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_7 AUGUSTUS stop_codon 445788 445790 . + 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MSSSATTTNYHVPMPAHHHFNLRVILLCANERYRVIAESFRENLRLSHHARKRAQAKGLKIDTAKATRCPQKLVSVLP # LHEIDTSVSPTINRAASEDLLPVIPAAQRRPVIPRITIPAPSAPRPVMGSDVSVSRTAVGPSKIFAPVALRGQGNPWRGPTSRFSITPNNELFQVNQP # VIPDVPQDMTEAEDDASSGSSDASSSGPSTPVRFICDLLALFLTKNSSLQDDFSSLMIRFKRKSLEVEDESAAFEKATKARNIFFFSFTNQLNKTSLA # VCTQGMVST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 Scaffold_7 AUGUSTUS gene 448108 448443 0.68 - . g94 Scaffold_7 AUGUSTUS transcript 448108 448443 0.68 - . g94.t1 Scaffold_7 AUGUSTUS stop_codon 448108 448110 . - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_7 AUGUSTUS CDS 448108 448443 0.68 - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_7 AUGUSTUS start_codon 448441 448443 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MPALPRSPKKEVSGLPKYSEDDYSPYDIHMQTAKGIPPSGLTDYQMSTAKGMTFGNDIRMDTAKASTSSVSTIKQSGL # PLRDRELLESSEVKRKATVAQLCVFLIYASDLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 Scaffold_7 AUGUSTUS gene 450905 452122 0.12 - . g95 Scaffold_7 AUGUSTUS transcript 450905 452122 0.12 - . g95.t1 Scaffold_7 AUGUSTUS stop_codon 450905 450907 . - 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_7 AUGUSTUS CDS 450905 451180 0.99 - 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_7 AUGUSTUS CDS 451237 451593 0.19 - 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_7 AUGUSTUS CDS 451721 452122 0.22 - 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_7 AUGUSTUS start_codon 452120 452122 . - 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MRPVVSYDDITLPYDSVSAVVQETSRIAAHNNNRTFTTNKSSSSKKRKRKSRHSAAATSGNHGNIGNNASFDGEEDED # AVYLEVEESRELTHEEIWDDSALIEAWNAAAEEYKVKLTLYHERIAKEREFYRHITKQKTSHPLPPSVVDVAATTSVKGPAVSTGTEADVAIESDSKP # LDFATFIPTHDAGLSLPGSAPPRMMPEGSNGVSKPDLSSYYTTALSSDLGSMVSQDEAFKRALEATYWSGYWTAVYHSQNQKKDTKSKSVEDVNAGEP # VDAGERGDETAFDAEMMDNDVKAILDISNDSTFDGEVDSIDGEGEGGGDEDGENDSLASSTEGDLVSTQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 Scaffold_7 AUGUSTUS gene 455718 456540 0.31 + . g96 Scaffold_7 AUGUSTUS transcript 455718 456540 0.31 + . g96.t1 Scaffold_7 AUGUSTUS start_codon 455718 455720 . + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_7 AUGUSTUS CDS 455718 456380 0.39 + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_7 AUGUSTUS CDS 456481 456540 0.5 + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_7 AUGUSTUS stop_codon 456538 456540 . + 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MSNNLKTLHLSQDRIRYSSIPFDNHIPATVSDLRLHGLRLESVGKVTYRNITSLDLGTLMSTNREWDALWDILSSRRI # HLRDFAIHHITRANHDMDKMLNYFQSYSGLESFSLKGPVWYDPSSYDSYAIQFYENVLPMHVETLTKLELKPEFESKWCFGVDNINIVRRCKRLRSLW # VKVDHRGLEPDVVPERLLVGTLYGDGNSPMSLGSSSAGASYPNLVKDSHLNQRATHHGLMIIRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 Scaffold_7 AUGUSTUS gene 457889 458995 0.63 - . g97 Scaffold_7 AUGUSTUS transcript 457889 458995 0.63 - . g97.t1 Scaffold_7 AUGUSTUS stop_codon 457889 457891 . - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_7 AUGUSTUS CDS 457889 458253 0.78 - 2 transcript_id "g97.t1"; gene_id "g97"; Scaffold_7 AUGUSTUS CDS 458564 458861 0.78 - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_7 AUGUSTUS CDS 458945 458995 0.99 - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_7 AUGUSTUS start_codon 458993 458995 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MGAHPTHFLVENVGGFELHTLGYTTAEFLLTPLQFGIPNSRLRYYLLAKTAPFSFPYIQAGKTYQYIPHGNEQNDEVS # STWLDPRMNPIADSELVDVNVRDIQHYLDNEDGSSLYLAQTSGQQDAVSILHPLRLRYFTPSELLRIFHFNLPSSPVGKDRETSLSTIHSTDGTDEKT # ENAASITVNGGQNDDHSGSTFTDKFFWPESISTKTKYRLIGNSVNVHVVTELINFLYEDRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 Scaffold_7 AUGUSTUS gene 460099 462915 0.18 + . g98 Scaffold_7 AUGUSTUS transcript 460099 462915 0.18 + . g98.t1 Scaffold_7 AUGUSTUS start_codon 460099 460101 . + 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_7 AUGUSTUS CDS 460099 460172 0.59 + 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_7 AUGUSTUS CDS 460514 461094 0.26 + 1 transcript_id "g98.t1"; gene_id "g98"; Scaffold_7 AUGUSTUS CDS 461174 462915 0.97 + 2 transcript_id "g98.t1"; gene_id "g98"; Scaffold_7 AUGUSTUS stop_codon 462913 462915 . + 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MSLPSSRSFASSSRSVIEPPASSSLNGLDSLVPFFAPPIPRKTPSPSPSEHHSSGLSSPFMAKSTPRPSSNSPPNLKE # TTSLFTAIPNGTVSTSAISTPPVSPLLASGSLSNTTTPPIPAGGELDRIHQVIQHQHDDRESRRPEYLTRAKRSISEVDFGGLMEDENLADRERFSSI # GITESPMKGRRIKLFQETSEESFEESLMAGGYGRYVSDVDLPRTGAPVNVVAHLEEVQQQEAPSRPLTEKEVRKQKRLDAFRSSSSSTSRLYPVEIEG # KGRVLLDVPTEHNDIDTSLATSKKRTPGKRKRKAEPTAKERRAAAAAAAAEESAEKPNWPDAEFPWRLRTEERTEQARVEEQERLEWIEKYLDRDTDE # EDDGEGGSIDGGVYGGAADAEDDEVLPSSVWGVVYEDGDDQPIPYRAGRGKMVPLSGDPNQPLKFKRRRSAYFPSDPADARAALLSKKNVRVLSFRRQ # RSISHRKSISGNEDDQILCICRGVDDGRELVQCDSCKTWYHLDCIGIDDILELGPPDNDWFCYRCENASDSPPFVEATVPVPYTEPTFAPTDETPRRR # QVDNQFFHPPVPVSPTQSWSLSVPHTPKTPTRGVTSNIEFSSGFSSSSSRYGPVTPRHQARDVRIISGGGSTPGGPFDVFGSDDSRFDPTSTPSRGIK # FGVPFATPNDKHTPSARVFHTPSKPSTRTGGGVPGSASFGASGFLSSALSERSSGDGIGRVEIGPYPYARPSHPGAPNDDSSPIRREGHRIRRIVDPP # TMSTRALFIEESPLARTKGKGRALDFGVGSHGIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 Scaffold_7 AUGUSTUS gene 466254 466586 0.59 + . g99 Scaffold_7 AUGUSTUS transcript 466254 466586 0.59 + . g99.t1 Scaffold_7 AUGUSTUS start_codon 466254 466256 . + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_7 AUGUSTUS CDS 466254 466586 0.59 + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_7 AUGUSTUS stop_codon 466584 466586 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MCAHWYPEGYVLPTSTAYPPGPHHPSYTPKVTSHHGAPKPWYAPHGQGSSQERSRPSPSPASRSSSSSHTHTSTDGFS # ASMPSHTMAGIGDPGLVSGVDYFKVLCDIPKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 Scaffold_7 AUGUSTUS gene 474210 474746 0.64 - . g100 Scaffold_7 AUGUSTUS transcript 474210 474746 0.64 - . g100.t1 Scaffold_7 AUGUSTUS stop_codon 474210 474212 . - 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_7 AUGUSTUS CDS 474210 474746 0.64 - 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_7 AUGUSTUS start_codon 474744 474746 . - 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MEVRSSSAPARAIFGPLTMGWSFQMQLQDLDKQSDRDAHDPRSPSGKLGPKRPPARSARTSSARTLSRTLSHSPTYPS # QIVRRSISCPQCQSDKRRQVDDTCMYTPAALAHTASVESQISNSSKSNGRSPQEFPSANRNRETPNRRTTSDSVTSSHLSSSSSSSSKLSIPNMLNPG # SA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 Scaffold_7 AUGUSTUS gene 484084 485603 0.69 + . g101 Scaffold_7 AUGUSTUS transcript 484084 485603 0.69 + . g101.t1 Scaffold_7 AUGUSTUS start_codon 484084 484086 . + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_7 AUGUSTUS CDS 484084 484224 0.95 + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_7 AUGUSTUS CDS 484311 485603 0.73 + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_7 AUGUSTUS stop_codon 485601 485603 . + 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MGSSQSKSAKAAVDEINERKIRQNPIVLRMEKSIKKSSRACRKMPRSEAEARRAAEDLHREAEQKRIKAEQEASDYAK # QAEKAQKARDDAVTAAEKARTAMEEAEARAKSEHRARDEAEVERKNAVLSAEEFRDRERSARDAAANAEEAKEKFQRLEEKARLTSEETEDELRKFKV # EREKTEKELARAHRREAQLADLQPVHEPTRAEHEQTKNDRQYIEGRLHLAIAGMAGSGKSSLINAFRGVSKGTASAAATGVVETTRTIGRYEDPHPDR # SKFVWYDIPGAGTANVSHTNYFIKQGLYIFDAIIVLFDSRFVDADITILENCKKFNIPAFIVRSKSDEHIKAIADEMREELDEDESEDEDDIRSKDRE # TRRTRIDADAKEEYISVTRQNVRENLQRAGLEDEQRIYLISRRTLLRIVRGKQVAQTKLIDEYELIKDVMAAIKERRIDPPPFKADPAKSGSYLNPFS # WGGWGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 Scaffold_7 AUGUSTUS gene 503222 505090 0.7 + . g102 Scaffold_7 AUGUSTUS transcript 503222 505090 0.7 + . g102.t1 Scaffold_7 AUGUSTUS start_codon 503222 503224 . + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_7 AUGUSTUS CDS 503222 504234 1 + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_7 AUGUSTUS CDS 504289 505090 0.7 + 1 transcript_id "g102.t1"; gene_id "g102"; Scaffold_7 AUGUSTUS stop_codon 505088 505090 . + 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MFALPLRRTCHVARVIAVRRSVSVSAPSNAEAIEATILKEVVPPSVLGKIEAAATKPSTSTLTHLPAKAKAPALTSGR # RKFASSRKRTTSTPAPVDPATTTVNTKRRPQISVDKPKNWNRPIAEGVLPAYDEALKLIMRDSEDLSKEARKVGKEIDALEAQAEAEEAQGNIEKFNS # ILEELESLRKKYQILSVQSQINMPSVRWTVNNAQLDPWNPAHLHLAEQRWRGQGALDLLMERIHQMHVVPDLLPGVHPSLDLHVTVPYPLNKQFKRSM # KSGGKSIVGVEPGSFLSPTQTARAPGLWAHAWHSDVRLYTMVMLDPDVPNEETRSFTTYLHWMKPNIPVSAVADPRAFISPSLLNSHTTYVPPHPQQG # TPYHRYTILLLPQPAKSVYSLNTEAKIFKDLANHNAERETIGVRINELNTKKAKAKGQGEVKGLTPAEFEELKTLSKQFTTTHAELSVSSPTSWPLPL # LKEHTTSQWLDIPVVPDSERRGFNLRQFIREWGLSGSDDSTLKDIGGSALGGGTSGQSLPGLRAQVNGGKGLGTEENNAVVVGGGVHMFRELWDETVS # GVFEVSVAEGRENEAKYALPKKVDRYEDLKGVRKYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 Scaffold_7 AUGUSTUS gene 511332 512399 0.4 - . g103 Scaffold_7 AUGUSTUS transcript 511332 512399 0.4 - . g103.t1 Scaffold_7 AUGUSTUS stop_codon 511332 511334 . - 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_7 AUGUSTUS CDS 511332 512399 0.4 - 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_7 AUGUSTUS start_codon 512397 512399 . - 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MPRWWNTTSSEQLQLLILQSGDAPFLATLPAGPVFTATYSTPSSGTPESAQTSLASLDSGITEVQSTASTSSSSHLSG # GKIAAAVIMPLLAVAALAVFFWIRRSRATVKEERKVWSEKVDQRMSVVSADWQSISPAGAQAAIRNSMAIRASMEAEARMSVAAVNLAGMGVQAPGGG # VGGFFIPGQGDPTVNPIVAMPVPSFPATAQLRPGLRSSAYSSAAAAARVSRVSFAADPAIPGRPSGESRRSIYDRERPSFDSSQRRSGYSQYSQNSAT # RGSRAFHYADGEMPPMPDGAAERASQFYALNSNTNFSTLGSHMNVSSSTIYSSSVDANRMSRMSRFDEVYGEDYSGEFGPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 Scaffold_7 AUGUSTUS gene 516745 518461 0.23 - . g104 Scaffold_7 AUGUSTUS transcript 516745 518461 0.23 - . g104.t1 Scaffold_7 AUGUSTUS stop_codon 516745 516747 . - 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_7 AUGUSTUS CDS 516745 517767 0.73 - 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_7 AUGUSTUS CDS 517907 518461 0.23 - 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_7 AUGUSTUS start_codon 518459 518461 . - 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MVRWCAHQMGREKAYDVDSIVKEVSEQNVRGLVDNWDEVAEKFKKDAEHYGLGSSAKKLGKLDESRLMWEGEPVPVRN # PELVDVLLKVQSAEMKMASSSGKDGKAPTKGSQGGKKAVAAYDSVLAALSDAEEVARKLSESESQKVSMKPVSSCWLFALRLRVHFAIPCSLSGAALP # TLFSFPCRHASSSTIPGSLASSGGGQIRDMHFVHTYIVYQLLSKRIQRDLLLVDALVGEADAAGAAGIKGKTISSTSTSSADPRLYPAIVKLLDSILQ # SLSQLRTLSIVDDNPDLSAAVDARIGFSKAKRCVNLAKCYIVIPGDKKYAEALTLLQHATIHLREARRVLETLGLSADDSDPNDEVEFYPLLEKDLEV # LEESINKEGLEYKRTWLEKGGAGVGEQQGGKGQKQKKPVFFNIALNYVDVDVELMERLRERAGMTPTAASTTQTSTGSTQNRIAQATLGSSKAPAIAA # PKAFASAVGPRAKAAVMEEGMSRSGTPEPRESDGNKAAGATSRLGSLLGGWWGKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 Scaffold_7 AUGUSTUS gene 519928 520533 0.73 - . g105 Scaffold_7 AUGUSTUS transcript 519928 520533 0.73 - . g105.t1 Scaffold_7 AUGUSTUS stop_codon 519928 519930 . - 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_7 AUGUSTUS CDS 519928 520533 0.73 - 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_7 AUGUSTUS start_codon 520531 520533 . - 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MHSGPKQLPVWLGRVSQLRGNVRYDDVLGFSKKTLIQSGDVPVIFFGQHDVFWVDFDPTTTTMKLIPFPPDQIPLKDK # GTSKVTLNSRLLVDLGLRIKFDEVGSRLWREKGLALISDAHFPQQIAQVLGMNPSDITLQNDFDCFDILLDALHHVGVFKPSKASFKKYEEVKARFKT # GVGIFQEVVPPANGKGMNAGKYMLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 Scaffold_7 AUGUSTUS gene 530038 530496 0.99 + . g106 Scaffold_7 AUGUSTUS transcript 530038 530496 0.99 + . g106.t1 Scaffold_7 AUGUSTUS start_codon 530038 530040 . + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_7 AUGUSTUS CDS 530038 530496 0.99 + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_7 AUGUSTUS stop_codon 530494 530496 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MSSTTTTIITENKAEQIVETTCNTVSATAGSSSTLALPLFGSPGQPTPKDRGQGPFESYPYTDLLPKVYPNPGEIGEP # LEDFVHVDPGMRALSHPNPRKFLQGATRIENFCPTIGTEVEGVNLVKLTPEERDELALEVARRRVLVGYISKRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 Scaffold_7 AUGUSTUS gene 534157 536196 0.74 + . g107 Scaffold_7 AUGUSTUS transcript 534157 536196 0.74 + . g107.t1 Scaffold_7 AUGUSTUS start_codon 534157 534159 . + 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_7 AUGUSTUS CDS 534157 536196 0.74 + 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_7 AUGUSTUS stop_codon 536194 536196 . + 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MAENQTGKRMRIIRVDGGGEFNNNLMEAYCADRGIIIEKIAPYSSSANGMAERGNRTVIEGVRTFLEESGLPRSFWAE # AAATFTYVDNFVPTARFPDRVPIEYWSNKRQDISHLRPFGCRAWATLPENRTEGKLARQAVECKLIGYMGRRGYRLWHQPSRTFMESRNVRFEEGEAH # RSREFTPENDDSELGGNQPAGELEPAAPTNGPTDQQLADQEGNEQWLPGPTPDSSPPPSSSESPPTPLRRSTRIRTPSRVAIENQALEEREHEAQANK # EEWVTDSPQQAGQTLALITANPWAFASATSDTWVPSTFKQAMKAPDIWLPPMQAEYDTLVAKGCWELVHLPPDANLTGGRWTYAIKWGPAGEVLKRKA # RWVAQGYTQIQGQDYDKTYGAVARMESVRIVLAIIATLRLSLFQVDFTAAFLNSPISHDVSMWQPDRFVKPGDEDKVCKLRKSIYGTMQGSHDWQETL # AAGYREDGYTTSRADPCIRYRRDGAEYTLTSTYGDDVCGGSSTEDGRLRAVSDLAKWWESSEVSSHVLLGMNVQQDPATKSVTISQKAYILRMLKHFQ # LLHVRRRHTPLPPNIKLCEALPHSPMMTYSSWQASRIVNLWAPSSGARHCEAWHKRPALVLSGLGLSKQDSCLGRTRGGGISAATGVGSLTSGGCGAW # VDLAKVLEWGKEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 Scaffold_7 AUGUSTUS gene 539341 539721 0.47 + . g108 Scaffold_7 AUGUSTUS transcript 539341 539721 0.47 + . g108.t1 Scaffold_7 AUGUSTUS start_codon 539341 539343 . + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_7 AUGUSTUS CDS 539341 539721 0.47 + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_7 AUGUSTUS stop_codon 539719 539721 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MARSITDAAIVLSLIAGKDPNDNFTLAQPPIVPDYTKALNPNALIGARIGVPRKVFLDGSDLTGNGSESAIGLAFEKA # LDVIRDLGATVLDPADLPSAEEIARSNNETVVLDTDFKASTYPVTLAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 Scaffold_7 AUGUSTUS gene 542704 543008 0.77 - . g109 Scaffold_7 AUGUSTUS transcript 542704 543008 0.77 - . g109.t1 Scaffold_7 AUGUSTUS stop_codon 542704 542706 . - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_7 AUGUSTUS CDS 542704 542866 0.9 - 1 transcript_id "g109.t1"; gene_id "g109"; Scaffold_7 AUGUSTUS CDS 542980 543008 0.78 - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_7 AUGUSTUS start_codon 543006 543008 . - 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MKLFHDTSNPEEGFDDEETFEDTLKKLEADVKKGRKKEKEKEGGTVDGEDVDEPMVSTLEFHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 Scaffold_7 AUGUSTUS gene 546221 546535 0.41 - . g110 Scaffold_7 AUGUSTUS transcript 546221 546535 0.41 - . g110.t1 Scaffold_7 AUGUSTUS stop_codon 546221 546223 . - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_7 AUGUSTUS CDS 546221 546535 0.41 - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_7 AUGUSTUS start_codon 546533 546535 . - 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MGILLVYDVTDERSFNSVFPKVSSFHHPLTSLFSDIRTWHANIEQHASEGVNKILVGNKSDWTDKKAVTEEQGRELAD # ELGIKFIETSAKVNEGVEEAFFTLAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 Scaffold_7 AUGUSTUS gene 547136 547976 0.34 + . g111 Scaffold_7 AUGUSTUS transcript 547136 547976 0.34 + . g111.t1 Scaffold_7 AUGUSTUS start_codon 547136 547138 . + 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_7 AUGUSTUS CDS 547136 547156 0.48 + 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_7 AUGUSTUS CDS 547205 547655 0.48 + 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_7 AUGUSTUS CDS 547711 547976 0.73 + 2 transcript_id "g111.t1"; gene_id "g111"; Scaffold_7 AUGUSTUS stop_codon 547974 547976 . + 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MVAERAGYTVTMFVVDVSKSMGATRTVALPPGPNGEERFAEMTHLQYALQYVKFKIQDMVPSLLLMSRLPKIECYFRH # RFMVPGKLINVEWLYLELKVAQIMLMSLMRANHRSETDNQINAQHGGYENVTEYIPICTPSAATLRELDELEPSEVFGDPVDAMIVAVEAQNKHLGTK # KTWTRKVILVTDGEGPIELEDWEATANKLNELSIALTVVGVDFDDQEFDYVQRDKPDFKVRSSLRFLSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 Scaffold_7 AUGUSTUS gene 548121 549919 0.08 + . g112 Scaffold_7 AUGUSTUS transcript 548121 549919 0.08 + . g112.t1 Scaffold_7 AUGUSTUS start_codon 548121 548123 . + 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_7 AUGUSTUS CDS 548121 548494 0.08 + 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_7 AUGUSTUS CDS 549060 549082 0.25 + 1 transcript_id "g112.t1"; gene_id "g112"; Scaffold_7 AUGUSTUS CDS 549408 549919 0.3 + 2 transcript_id "g112.t1"; gene_id "g112"; Scaffold_7 AUGUSTUS stop_codon 549917 549919 . + 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MNNVLRIGDVDTRTEEAMEILVKTCKCTSINRPKAFKKFAIRPKTAQEEEAEQQTMNADDGDENKVVTVTYAQLKART # EYYVDKSDGKEDEEDQVKIEEDGEPRPEDLEKVEKEELIRGFKYGTSLGIKTNKVPKVIKVARKDGHNHANDDDDEMLLLDRKPSTSKPSQSLSQAKI # SSKPAEDGSETEDDDEDGMLIDKAEPTPRPNPLPTPARSLNNDDDMDIDPQRDPDRVIGRTNPLADFRENLERGDIVTKVVEDMSAVIQEVILAPFAS # RRSKEMIECLIELREVCLQEDEVDAWNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 Scaffold_7 AUGUSTUS gene 550358 550660 0.48 - . g113 Scaffold_7 AUGUSTUS transcript 550358 550660 0.48 - . g113.t1 Scaffold_7 AUGUSTUS stop_codon 550358 550360 . - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_7 AUGUSTUS CDS 550358 550660 0.48 - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_7 AUGUSTUS start_codon 550658 550660 . - 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MPMRDIDNEQQLPEDEYATRAQLSRAWKEVEKALGVSLGSFSSTSSSSTSVSSTAPRDGFRKRAGGHANGKGRNETRR # ILEEEEMEWVEEQSASFQVART] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 Scaffold_7 AUGUSTUS gene 558042 559181 1 - . g114 Scaffold_7 AUGUSTUS transcript 558042 559181 1 - . g114.t1 Scaffold_7 AUGUSTUS stop_codon 558042 558044 . - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_7 AUGUSTUS CDS 558042 559181 1 - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_7 AUGUSTUS start_codon 559179 559181 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MHSVLDVASAPIEKKSKKDKKVKKKSKSVPVDPESVVPIEPAQIVSDNGDYEKPTKKKTKKRKHADLELEAAAEKDVQ # MDVDADPGTIFVVFCILNSMFLHSLTAPEVSEKRKKKKKKHSDEGQDIAADIVEPMEGKKEKKKKEKKDKVVESEFTDQKNVKSEKKDKKRKDKQPAE # NVVSQSGPSNESSTASSSTPAEISAFLTKHNITIHVPSSSPPVTPFIHFSQLPIPDPLRTFSAKFKEPSPVQACTWPPALEGKDVVGIAETGSGKTLA # FGVPALARLISSPPPPPSKSSPTITTLVLAPTRELALQTHEALEGLGEQFGIASVAVFGGVPKEGQVKMLKNLHKANSKLVTRIIVGTPGRILDLMSE # GACDLSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 Scaffold_7 AUGUSTUS gene 561975 563105 0.63 + . g115 Scaffold_7 AUGUSTUS transcript 561975 563105 0.63 + . g115.t1 Scaffold_7 AUGUSTUS start_codon 561975 561977 . + 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_7 AUGUSTUS CDS 561975 563105 0.63 + 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_7 AUGUSTUS stop_codon 563103 563105 . + 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MHFYIHTLPPNSPVVIPQPISIPLLQVAKVLDLPPVITFSDTVLYNWCLTVSSSDTDSLKSLNPDAIRCQTLFTDTPD # ESAFYLCSARIELHGVRALNIMRSSMDEIFVGDALAVARLTTYLISLSTIIGELKSLLLDVRKECDPEIYYNVVRPWFRGEDSDTYLDPGSGQTRRWI # FEGAGDYTDLNMLPPDRELSGASAGQSSLIHALDVFLGVNHERPNSPSFMKRMQRYMPRQHRQFLNHLAKNPRPLREFVMSASSMDSNDGALALKEAY # NHAVMSLKEFRDSHMIIATLYIMGPARRAADVAATSLVTSISETEAQAGPKVPNIVQTVPEATHTQVTDDATVGITGTGGTDLVQFLKGVRNQTIRTL # LSDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 Scaffold_7 AUGUSTUS gene 570725 571132 0.67 + . g116 Scaffold_7 AUGUSTUS transcript 570725 571132 0.67 + . g116.t1 Scaffold_7 AUGUSTUS start_codon 570725 570727 . + 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_7 AUGUSTUS CDS 570725 571132 0.67 + 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_7 AUGUSTUS stop_codon 571130 571132 . + 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MDLSPPEYMPHEAISSKGPWVKMKARSLVDLNIKVDFGSSKSKEESFNVFRNEEDFLEKVPKVLEMKDLKVENECDYY # DLMLQYMVKIEALDTTKYDLSRWEALKARIKAVKGYPQTEVPPPNEGKAYTLSIKDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 Scaffold_7 AUGUSTUS gene 582007 583967 1 + . g117 Scaffold_7 AUGUSTUS transcript 582007 583967 1 + . g117.t1 Scaffold_7 AUGUSTUS start_codon 582007 582009 . + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_7 AUGUSTUS CDS 582007 583192 1 + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_7 AUGUSTUS CDS 583297 583967 1 + 2 transcript_id "g117.t1"; gene_id "g117"; Scaffold_7 AUGUSTUS stop_codon 583965 583967 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MGLEHRTNSRQPPLITPSASPPSRSHSFSYNPHANIITSGKSSSSSGSSIRTGSRFSSTPLSTTETPDIPTLRSTTSR # LLSVWSTLADRYSLRVDQDDIVDIRTGQLVKDRGVVRGLNGKWDFGRFASVEDDEGDEQLEYEEDRNRGTEGVQEESDDELDSFAYLDHQQGLDGPQE # DIESPANPFMTLSNLTSRATHAIDPTNDEDDAADLRAFLEEERHRKETQGDAAEQDEISTGESRIEEGGSEFVTEIDTETEAGFTTEGEPFSDYDEVR # MLDTEKVDKVHRSPILRGKEGSEDELELWDASDFDILSSKKANEIPSSSKSKSHPHLITPPNSSTYSESHTDLFEPLVSSPPLLSPIYSSTRSKSRQR # SSTDHPPSTIMNPLPLLPRLPYHLSEKNENTGTAASVAGSKNPSRSKTANPELPPSYFTPSTSRMSKRHSSEAIRTSSSPQNAGKSVRHKGKGQTGAG # ELDKNSHSGKIEPKSTAVDVKGKSKAREIIEIDSSSDELPLDSITSSSRRLSAKARGKKRARSSGASWSSAAEWENDFHQATGGSTTINHRKSKLMGS # PTKKGRYTVLSDSEPEEVIHHTSAHSSCEIGGVSVIVSQNLVAHEHISVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 Scaffold_7 AUGUSTUS gene 584346 585467 0.82 + . g118 Scaffold_7 AUGUSTUS transcript 584346 585467 0.82 + . g118.t1 Scaffold_7 AUGUSTUS start_codon 584346 584348 . + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_7 AUGUSTUS CDS 584346 585467 0.82 + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_7 AUGUSTUS stop_codon 585465 585467 . + 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MRDTSPSRYVTTKCDDTGQSDTMLSPTRAASQSQIQKAFEGRAKDIISNAIKGLYSLLTPEGMTALQEQVQDQGSRPS # SHRRRISHPSTGHEMVYTPRRTSSRPHAPSDASITSSPGSLSNKAGSSFLYATPSSHRGRSHLQSHPDPTYSRGTLPPSSPYSELDEDRGHDYFEESD # KQDFESDDQPLPTSSPLKLISSSRRERSGPLNYRDRDFPNSRPRASSIVQRSRSRGRRVSFKEIASETQTKAGETRRTLSREISVEDPVQEIHREGKR # VEVDAMTLHREDDAGSDDSNGSDATRPRLAVQSRMRSVGTPGPPTYRGKRQQFRQRSPSILRAPTKSEPPELVETEPLPIRVPSRPKKVKAVGRRASR # N] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 Scaffold_7 AUGUSTUS gene 585597 586401 0.77 - . g119 Scaffold_7 AUGUSTUS transcript 585597 586401 0.77 - . g119.t1 Scaffold_7 AUGUSTUS stop_codon 585597 585599 . - 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_7 AUGUSTUS CDS 585597 586239 0.99 - 1 transcript_id "g119.t1"; gene_id "g119"; Scaffold_7 AUGUSTUS CDS 586376 586401 0.77 - 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_7 AUGUSTUS start_codon 586399 586401 . - 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MLSERTKAHSEKSLLPLPLSVLAGQDLSELEKKALAIAETKKKEEAEKAKQAEEAKQKAEAEAVKVEEEKAKKKAEEE # AARKKAEDDKVTTVTTEDGSTTTTTTTIVQKIITVTKKLVNGEEVSETKEDIVSDKDALTNTEGLNGVVAPGVEAVITVPSVPPVTVTVDSATQPDPK # RDQVDVSEENSIFLGFRVYTNKEAPVVIEGQLRHEMEVSAALALAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 Scaffold_7 AUGUSTUS gene 596468 597293 0.14 + . g120 Scaffold_7 AUGUSTUS transcript 596468 597293 0.14 + . g120.t1 Scaffold_7 AUGUSTUS start_codon 596468 596470 . + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_7 AUGUSTUS CDS 596468 596599 0.45 + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_7 AUGUSTUS CDS 596644 596802 0.57 + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_7 AUGUSTUS CDS 596866 597001 0.85 + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_7 AUGUSTUS CDS 597058 597293 0.48 + 2 transcript_id "g120.t1"; gene_id "g120"; Scaffold_7 AUGUSTUS stop_codon 597291 597293 . + 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MIGAIIIGVAYGVQVQPKDDPNITAASKMYSVLNAASVPGAFLVFSASDIFDQDILSFLKYVPAWFPGASFKQKAKAW # YGIRNATIRPPFMQVKQALIDGTANDSFASRCLANAEHFNPDSDSDCLSEEEEMIMQTAGTLYEGGADTGKTALRTFLLAMMCFPDAQHAAQEELDHV # IGQKRLPDYQDMDDPATLPYVRAIILECLRYVPMKSLVPLNIKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 Scaffold_7 AUGUSTUS gene 608507 609049 0.3 + . g121 Scaffold_7 AUGUSTUS transcript 608507 609049 0.3 + . g121.t1 Scaffold_7 AUGUSTUS start_codon 608507 608509 . + 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_7 AUGUSTUS CDS 608507 608717 0.3 + 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_7 AUGUSTUS CDS 608781 609049 0.53 + 2 transcript_id "g121.t1"; gene_id "g121"; Scaffold_7 AUGUSTUS stop_codon 609047 609049 . + 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFFSSPRSTR # SRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKSHQLLQKANPDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 Scaffold_7 AUGUSTUS gene 613261 614294 0.21 - . g122 Scaffold_7 AUGUSTUS transcript 613261 614294 0.21 - . g122.t1 Scaffold_7 AUGUSTUS stop_codon 613261 613263 . - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_7 AUGUSTUS CDS 613261 613552 0.31 - 1 transcript_id "g122.t1"; gene_id "g122"; Scaffold_7 AUGUSTUS CDS 613630 614294 0.34 - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_7 AUGUSTUS start_codon 614292 614294 . - 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQ # LDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 Scaffold_7 AUGUSTUS gene 614542 615690 0.92 - . g123 Scaffold_7 AUGUSTUS transcript 614542 615690 0.92 - . g123.t1 Scaffold_7 AUGUSTUS stop_codon 614542 614544 . - 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_7 AUGUSTUS CDS 614542 615690 0.92 - 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_7 AUGUSTUS start_codon 615688 615690 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVR # NYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEE # RSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYH # RILINLINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 Scaffold_7 AUGUSTUS gene 616445 617276 0.68 - . g124 Scaffold_7 AUGUSTUS transcript 616445 617276 0.68 - . g124.t1 Scaffold_7 AUGUSTUS stop_codon 616445 616447 . - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_7 AUGUSTUS CDS 616445 617198 0.98 - 1 transcript_id "g124.t1"; gene_id "g124"; Scaffold_7 AUGUSTUS CDS 617254 617276 0.68 - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_7 AUGUSTUS start_codon 617274 617276 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGPLKMNSFHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 Scaffold_7 AUGUSTUS gene 617635 619036 0.52 - . g125 Scaffold_7 AUGUSTUS transcript 617635 619036 0.52 - . g125.t1 Scaffold_7 AUGUSTUS stop_codon 617635 617637 . - 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_7 AUGUSTUS CDS 617635 618373 0.75 - 1 transcript_id "g125.t1"; gene_id "g125"; Scaffold_7 AUGUSTUS CDS 618456 619036 0.54 - 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_7 AUGUSTUS start_codon 619034 619036 . - 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKLLCARYAIGEVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVAN # QSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPF # DVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 Scaffold_7 AUGUSTUS gene 619066 619335 0.74 - . g126 Scaffold_7 AUGUSTUS transcript 619066 619335 0.74 - . g126.t1 Scaffold_7 AUGUSTUS stop_codon 619066 619068 . - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_7 AUGUSTUS CDS 619066 619335 0.74 - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_7 AUGUSTUS start_codon 619333 619335 . - 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 Scaffold_7 AUGUSTUS gene 619426 620584 0.57 - . g127 Scaffold_7 AUGUSTUS transcript 619426 620584 0.57 - . g127.t1 Scaffold_7 AUGUSTUS stop_codon 619426 619428 . - 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_7 AUGUSTUS CDS 619426 619864 0.67 - 1 transcript_id "g127.t1"; gene_id "g127"; Scaffold_7 AUGUSTUS CDS 620013 620584 0.64 - 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_7 AUGUSTUS start_codon 620582 620584 . - 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSIRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTGTTAMVALNKDLMEANMKEIRAVKSLQSHFKEGAD # IMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKFEWNSVGMFLVQVDRSFYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 Scaffold_7 AUGUSTUS gene 625711 626340 0.97 - . g128 Scaffold_7 AUGUSTUS transcript 625711 626340 0.97 - . g128.t1 Scaffold_7 AUGUSTUS stop_codon 625711 625713 . - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_7 AUGUSTUS CDS 625711 626340 0.97 - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_7 AUGUSTUS start_codon 626338 626340 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 Scaffold_7 AUGUSTUS gene 627621 628316 0.7 - . g129 Scaffold_7 AUGUSTUS transcript 627621 628316 0.7 - . g129.t1 Scaffold_7 AUGUSTUS stop_codon 627621 627623 . - 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_7 AUGUSTUS CDS 627621 628316 0.7 - 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_7 AUGUSTUS start_codon 628314 628316 . - 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MLEGIFIGYEDNRVGWRVRDTNGKDHFSDQVVFNESQFGRLHGPKTSKLPTEMVPSTTTKSTSTPTVEHPNTPKGPRP # RRTIKLTERGKEWRDGIRKRDELIAERRVNDGLSPNHTTQLNNDITGCSLACRIAEDNLSCLKDDTDIFFAALANIPIPLIPIPNKPTSTSKPRIFDL # KKPPSTRREMLLRPDAADWLTAEEKEITGLFELDVFEVMEICPKGKFPIGFEDGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 Scaffold_7 AUGUSTUS gene 628947 630129 0.33 - . g130 Scaffold_7 AUGUSTUS transcript 628947 630129 0.33 - . g130.t1 Scaffold_7 AUGUSTUS stop_codon 628947 628949 . - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_7 AUGUSTUS CDS 628947 629797 0.61 - 2 transcript_id "g130.t1"; gene_id "g130"; Scaffold_7 AUGUSTUS CDS 629928 630129 0.33 - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_7 AUGUSTUS start_codon 630127 630129 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MDIEKFNLKWSSTLTNFRNYGYDIPWDTLISKYISKLPSGPRYIYLKQVLEEEFNEPGVIPNRELSIKTSRHAASIQT # NTKPTAYVTTVNSTNTTSKIENVDTVPDVTTVVPTHNTTVRSTYPARRLKPFAALLSTFPSSPLPTEHPSHDQSFAYSSMVQKQQTLLDSACTNHIVN # DRSFFHTYDVDGAMAIQTANSGILSAQASGTCYFETQIVGTNDKLILEMHDCLFAPDAPVSLISVGAMLEHGFTFTILPHVVQIHPNPGHHFVADVVN # RLCVLRGKFIVPNKDSSDPIHFAMPVFVPWIPNGALFHERFGHPGVDLTTNFLLEKVRQALMNGMAPRCVEYVIRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 Scaffold_7 AUGUSTUS gene 636009 637172 0.93 + . g131 Scaffold_7 AUGUSTUS transcript 636009 637172 0.93 + . g131.t1 Scaffold_7 AUGUSTUS start_codon 636009 636011 . + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_7 AUGUSTUS CDS 636009 637172 0.93 + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_7 AUGUSTUS stop_codon 637170 637172 . + 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEALKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTAL # LPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQ # NCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDR # ANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 Scaffold_7 AUGUSTUS gene 644042 644712 0.93 + . g132 Scaffold_7 AUGUSTUS transcript 644042 644712 0.93 + . g132.t1 Scaffold_7 AUGUSTUS start_codon 644042 644044 . + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_7 AUGUSTUS CDS 644042 644092 1 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_7 AUGUSTUS CDS 644209 644712 0.93 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_7 AUGUSTUS stop_codon 644710 644712 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MDLESQIKSSGILQHHLRGTYDIVIPPDDANILTSKWVSRTKRDEQGKVTGHRARLVVRGFNQIPDVDYFPDETFAAA # RAILSTGAEQNMFIHQMDVKSAYLYGKLGDNEQIYMKAPPGVDIEVKAGQVLKLKLALYGLKQAGRRWYMRFREIMTSVGLTRSNFDHAVFYRTDPFC # IIFIYVDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 Scaffold_7 AUGUSTUS gene 647449 648102 0.33 - . g133 Scaffold_7 AUGUSTUS transcript 647449 648102 0.33 - . g133.t1 Scaffold_7 AUGUSTUS stop_codon 647449 647451 . - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_7 AUGUSTUS CDS 647449 647790 0.8 - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_7 AUGUSTUS CDS 647959 648102 0.33 - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_7 AUGUSTUS start_codon 648100 648102 . - 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MNAQNANVNGTDGMQNSTYRPNDDIEAWETKKDDDGNLLNAIVGCLSEGQFGGAEITIPEEMFNNTIIASIPNIFKPM # INALVVVAARTSVPLTTRELVSTIHAEASGHTQGQSGKKEPANYASGNFNCGRVDLTGIREIPEASPSGRGNGNRGGGQNRPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 Scaffold_7 AUGUSTUS gene 651735 652167 0.26 + . g134 Scaffold_7 AUGUSTUS transcript 651735 652167 0.26 + . g134.t1 Scaffold_7 AUGUSTUS start_codon 651735 651737 . + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_7 AUGUSTUS CDS 651735 651789 0.39 + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_7 AUGUSTUS CDS 651860 652167 0.34 + 2 transcript_id "g134.t1"; gene_id "g134"; Scaffold_7 AUGUSTUS stop_codon 652165 652167 . + 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MQNTPAEREIIPSVIWIRYPSLLSVDTLSKALNTLDILLSLLSLSGSDTSPPRSGSSGSGGGGEDLGSDDIGDEGRSS # TGLGGGSTGYSGFGAGAASGVPCGFWDDDDDAIGSGGAPCPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 Scaffold_7 AUGUSTUS gene 660817 662709 0.18 - . g135 Scaffold_7 AUGUSTUS transcript 660817 662709 0.18 - . g135.t1 Scaffold_7 AUGUSTUS stop_codon 660817 660819 . - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_7 AUGUSTUS CDS 660817 662709 0.18 - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_7 AUGUSTUS start_codon 662707 662709 . - 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MRIHVLTDHRTLENFESQKDLSRRQIRWREDLSQFDLEIAYIPGESNSAADALSRIKAGALPSDCVPSDFSTGGSTSV # NAWKSNPFVCSAVLSLSADVTFLAQIKEGYQSDPFVKKLIEGGSLVPGIERRNGLWFLDGRLIIPAYLSLREDLFHLAHDTCGHFGVDKSYSMLADSY # YWPNMRRDLSKHYVPGCEDCQRNKGRTAKNGKGPLHPLPVPESRCDSVAMDFIGPLPLDQGYDCILTMTDQLGSDLKIIPTNIDISAPALARLVFDTW # YCDNGLPLEWVSDRDKLFVSEFWSVLNKLSGVKIKMSSSFHPETDGSSERLNKTVNQAVRFYVERNQIGWVNALPKIRFDIMNSVNASTRLSMFQLRY # GRSPRILPPIVPVLDFKKTDPSQNASDAHTFLAEIANTVREARDNLALAKVVQAYQADKDRGPCELFKAGDLVMLSTWHRREIFKKSGEKRVAKFFPR # FDGPYEVLKAYPETSHYTLDMPNHPNAFPSFYVDQLKRYVPNRADLFPGRERGIPTPTIVDGFEEFEIDRIIDSRPRGHGWQFLVRWVDQSPSAGSHT # RHYMNVPRSMTGCVMEGMAPLNYWTRLTFSYSVSLFPNLFFSFFFFSSLIPALYFVFNWVGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 Scaffold_7 AUGUSTUS gene 664237 666601 0.42 - . g136 Scaffold_7 AUGUSTUS transcript 664237 666601 0.42 - . g136.t1 Scaffold_7 AUGUSTUS stop_codon 664237 664239 . - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_7 AUGUSTUS CDS 664237 664837 0.95 - 1 transcript_id "g136.t1"; gene_id "g136"; Scaffold_7 AUGUSTUS CDS 664986 666601 0.42 - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_7 AUGUSTUS start_codon 666599 666601 . - 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MSVLQDSKTSALAIVAKARREGLRSAGKNPIPSPIVVSEIETNSAESSSADCPQSFPTDSLPNETDSLLNESCSSPLQ # LSSDEDEMSTCVNESGRIELSMGKNGPRVKAGSVLSPEDLDDLYEDARCYAKLRAKDDIENVKDTIAEAFSARVHCDWFHAEKSAHLMLSLEQTESDT # SAPPTFPFLDVLRRKFCGHDWAQVHASCRDELRMVVGGVGCFDEYLSQVEGCNNRLKGVGNYLTPPQLLTIPACGILPTLTVIDEDMTYKAWVSACRD # LEVQFKSHLSSADQQGRRGAFPYNSAATTNNNNPAHKRNATSEPGSYPIKRPSSANGSSANGGSGGVFYMKSFKSMPEALQKEQHELLGRINTCPKCR # TAWATCSSNLDNCAGATLSVPWKPLTPKMVDWAISTHKSTNRPILYNVILKQAATRIPVAAVHGAPLEDISAYVKNSEGRAPVAAAIYGNLPVSHVAR # DSAVYGNFAAPALFRVQSVASSSFVAPVVGQQRLTRDDRDDEVDWSDGSGSPFQSQRIPAMCPVSHLLMVDDSSFAQATKMSVAMSEGSPSIFSASSY # CKVGLEDPSGAWTSRSIHALIVPSLCFPMILGIPFLAHNFLVTDYASCTVMDKTSGFGLMNPSVPTPHPLPSSPVQRCQEILNTYERSLDLKKTVLLE # LQGYFRDHPRLRASDPVLPFDVAAAVRARIECLSELERLRALGEDVKSRFELLFSCLPCAQVGPDSAPTLGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 Scaffold_7 AUGUSTUS gene 678398 679558 0.44 + . g137 Scaffold_7 AUGUSTUS transcript 678398 679558 0.44 + . g137.t1 Scaffold_7 AUGUSTUS start_codon 678398 678400 . + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_7 AUGUSTUS CDS 678398 679558 0.44 + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_7 AUGUSTUS stop_codon 679556 679558 . + 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRME # LSGHVSCASRQIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 Scaffold_7 AUGUSTUS gene 679653 681354 0.5 + . g138 Scaffold_7 AUGUSTUS transcript 679653 681354 0.5 + . g138.t1 Scaffold_7 AUGUSTUS start_codon 679653 679655 . + 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_7 AUGUSTUS CDS 679653 679885 0.56 + 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_7 AUGUSTUS CDS 680032 680296 0.5 + 1 transcript_id "g138.t1"; gene_id "g138"; Scaffold_7 AUGUSTUS CDS 680341 681354 0.85 + 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_7 AUGUSTUS stop_codon 681352 681354 . + 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MPRDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRV # LVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPMIMFNLGRITNQIDSHGYT # PAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQ # TDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRL # IAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYP # RGQKGRNIQINTSRYNEPKNVTPDNEKSTGEND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 Scaffold_7 AUGUSTUS gene 681627 682253 0.56 + . g139 Scaffold_7 AUGUSTUS transcript 681627 682253 0.56 + . g139.t1 Scaffold_7 AUGUSTUS start_codon 681627 681629 . + 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_7 AUGUSTUS CDS 681627 681631 0.56 + 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_7 AUGUSTUS CDS 681785 682253 0.68 + 1 transcript_id "g139.t1"; gene_id "g139"; Scaffold_7 AUGUSTUS stop_codon 682251 682253 . + 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MVLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRK # KGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 Scaffold_7 AUGUSTUS gene 683448 684365 0.52 + . g140 Scaffold_7 AUGUSTUS transcript 683448 684365 0.52 + . g140.t1 Scaffold_7 AUGUSTUS start_codon 683448 683450 . + 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_7 AUGUSTUS CDS 683448 684365 0.52 + 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_7 AUGUSTUS stop_codon 684363 684365 . + 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLD # ELIPLIGKYLSNPSDESLVKCQKMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 Scaffold_7 AUGUSTUS gene 684611 685018 0.25 + . g141 Scaffold_7 AUGUSTUS transcript 684611 685018 0.25 + . g141.t1 Scaffold_7 AUGUSTUS start_codon 684611 684613 . + 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_7 AUGUSTUS CDS 684611 685018 0.25 + 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_7 AUGUSTUS stop_codon 685016 685018 . + 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 Scaffold_7 AUGUSTUS gene 685980 686502 0.27 - . g142 Scaffold_7 AUGUSTUS transcript 685980 686502 0.27 - . g142.t1 Scaffold_7 AUGUSTUS stop_codon 685980 685982 . - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_7 AUGUSTUS CDS 685980 686407 1 - 2 transcript_id "g142.t1"; gene_id "g142"; Scaffold_7 AUGUSTUS CDS 686484 686502 0.27 - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_7 AUGUSTUS start_codon 686500 686502 . - 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MFLLTVLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSI # LKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 Scaffold_7 AUGUSTUS gene 688501 688845 0.53 - . g143 Scaffold_7 AUGUSTUS transcript 688501 688845 0.53 - . g143.t1 Scaffold_7 AUGUSTUS stop_codon 688501 688503 . - 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_7 AUGUSTUS CDS 688501 688845 0.53 - 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_7 AUGUSTUS start_codon 688843 688845 . - 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 Scaffold_7 AUGUSTUS gene 689757 690459 0.42 - . g144 Scaffold_7 AUGUSTUS transcript 689757 690459 0.42 - . g144.t1 Scaffold_7 AUGUSTUS stop_codon 689757 689759 . - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_7 AUGUSTUS CDS 689757 690193 0.77 - 2 transcript_id "g144.t1"; gene_id "g144"; Scaffold_7 AUGUSTUS CDS 690252 690459 0.57 - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_7 AUGUSTUS start_codon 690457 690459 . - 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS # KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE # DEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 Scaffold_7 AUGUSTUS gene 696956 697771 0.99 + . g145 Scaffold_7 AUGUSTUS transcript 696956 697771 0.99 + . g145.t1 Scaffold_7 AUGUSTUS start_codon 696956 696958 . + 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_7 AUGUSTUS CDS 696956 697771 0.99 + 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_7 AUGUSTUS stop_codon 697769 697771 . + 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MVNPSAQPVSSYSELGVVNVNFPVPSTPVEAYASSPYRLREQVPATSQQQQIVFTPKVPQFQLCQAQIAPGPTSNPRE # SSARNETVTPGVPINLWNTEEDHSDKRRFLVQHVDTDTEGLEIVRFFQVSCFLIQEEDFFKVLNLFFQSFTSVNGPFWTTLNSIGRFYVAFTDSREVN # TVIQLIAHEYPEWELIPMNAEEFARDTRMITPLPPSFDDTVVATVYCGSYSNFRPIDVTSKVKPYMELVGKVHSVQELQFGTPSDGSRLTTTNSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 Scaffold_7 AUGUSTUS gene 698052 698480 0.34 + . g146 Scaffold_7 AUGUSTUS transcript 698052 698480 0.34 + . g146.t1 Scaffold_7 AUGUSTUS start_codon 698052 698054 . + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_7 AUGUSTUS CDS 698052 698480 0.34 + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_7 AUGUSTUS stop_codon 698478 698480 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MGRRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTI # RMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESERPLETEIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 Scaffold_7 AUGUSTUS gene 698601 699267 0.15 + . g147 Scaffold_7 AUGUSTUS transcript 698601 699267 0.15 + . g147.t1 Scaffold_7 AUGUSTUS start_codon 698601 698603 . + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_7 AUGUSTUS CDS 698601 698615 0.15 + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_7 AUGUSTUS CDS 698713 699267 0.61 + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_7 AUGUSTUS stop_codon 699265 699267 . + 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MKNRQQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQ # LNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMFDMKYSKEE # LNHSKDLNRVLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 Scaffold_7 AUGUSTUS gene 699832 700418 0.58 + . g148 Scaffold_7 AUGUSTUS transcript 699832 700418 0.58 + . g148.t1 Scaffold_7 AUGUSTUS start_codon 699832 699834 . + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_7 AUGUSTUS CDS 699832 699838 0.58 + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_7 AUGUSTUS CDS 699919 700418 0.65 + 2 transcript_id "g148.t1"; gene_id "g148"; Scaffold_7 AUGUSTUS stop_codon 700416 700418 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MNRIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELD # QLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 Scaffold_7 AUGUSTUS gene 700532 701750 0.37 + . g149 Scaffold_7 AUGUSTUS transcript 700532 701750 0.37 + . g149.t1 Scaffold_7 AUGUSTUS start_codon 700532 700534 . + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_7 AUGUSTUS CDS 700532 700829 0.85 + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_7 AUGUSTUS CDS 701003 701462 0.86 + 2 transcript_id "g149.t1"; gene_id "g149"; Scaffold_7 AUGUSTUS CDS 701537 701750 0.44 + 1 transcript_id "g149.t1"; gene_id "g149"; Scaffold_7 AUGUSTUS stop_codon 701748 701750 . + 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAWIPLTKLWDVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGE # PINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLLDELIPLIGKYLSNPSDESLG # EMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKETYAHVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 Scaffold_7 AUGUSTUS gene 701962 702995 0.18 + . g150 Scaffold_7 AUGUSTUS transcript 701962 702995 0.18 + . g150.t1 Scaffold_7 AUGUSTUS start_codon 701962 701964 . + 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_7 AUGUSTUS CDS 701962 702626 0.25 + 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_7 AUGUSTUS CDS 702704 702995 0.22 + 1 transcript_id "g150.t1"; gene_id "g150"; Scaffold_7 AUGUSTUS stop_codon 702993 702995 . + 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKIGISNQVNWSRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQ # LDLMVEDEDEYWMAPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 Scaffold_7 AUGUSTUS gene 705824 706482 0.12 - . g151 Scaffold_7 AUGUSTUS transcript 705824 706482 0.12 - . g151.t1 Scaffold_7 AUGUSTUS stop_codon 705824 705826 . - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_7 AUGUSTUS CDS 705824 706371 1 - 2 transcript_id "g151.t1"; gene_id "g151"; Scaffold_7 AUGUSTUS CDS 706434 706482 0.12 - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_7 AUGUSTUS start_codon 706480 706482 . - 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MDALNALHTASSSSTHNLANSLRRAADLNDQLKQLGSLFDTTKELFLRSILDLQNAGTDPIVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLP # AIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 Scaffold_7 AUGUSTUS gene 707088 708561 0.15 - . g152 Scaffold_7 AUGUSTUS transcript 707088 708561 0.15 - . g152.t1 Scaffold_7 AUGUSTUS stop_codon 707088 707090 . - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_7 AUGUSTUS CDS 707088 707524 0.62 - 2 transcript_id "g152.t1"; gene_id "g152"; Scaffold_7 AUGUSTUS CDS 707584 707866 0.54 - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_7 AUGUSTUS CDS 707922 708053 0.23 - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_7 AUGUSTUS CDS 708139 708561 0.86 - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_7 AUGUSTUS start_codon 708559 708561 . - 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MASTSSQTQSSASTTRLPSSLLEAQVMLAGIPSKSTLPLFFESAVFKRLLEGDYSPPVVDSTNSPDYDGSGTFPAFSY # PRSLVPFCFPSDTSRPLSVASGLDLFCSAQMTVRTLQDLVDVDDSPPTESEIYNVFEEAAPFLENCPLFAEQVLLSAESLSLSLPAFLRDDLTQQWGI # PPEHRSSAAGVLEFERFPAIPIPFCLRFREGSAMMRMVSSKDLDVFASLRGKALSAVALKDTTSSPPLETQASTSVSKTLVAPPRLIRRNRELENLKA # DASSFLASPRSARSKDSDNELLSGFPLVDAVPRASSSTKVPVGKKEPKSKTTVKVVEASKASKPTPTAMVYKRVRLPPSSRKVAPTTVKGKSRQVVVS # EDSASNEVESEDEEEDEDEEEDSAPPPKRLKTTSSISGKSLFFFYFVFILLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 Scaffold_7 AUGUSTUS gene 713172 713402 0.92 + . g153 Scaffold_7 AUGUSTUS transcript 713172 713402 0.92 + . g153.t1 Scaffold_7 AUGUSTUS start_codon 713172 713174 . + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_7 AUGUSTUS CDS 713172 713402 0.92 + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_7 AUGUSTUS stop_codon 713400 713402 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKAEVFKGKDGAEAHCFMAQFQNWASEQPVSPKAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 Scaffold_7 AUGUSTUS gene 718917 720371 0.84 - . g154 Scaffold_7 AUGUSTUS transcript 718917 720371 0.84 - . g154.t1 Scaffold_7 AUGUSTUS stop_codon 718917 718919 . - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_7 AUGUSTUS CDS 718917 720371 0.84 - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_7 AUGUSTUS start_codon 720369 720371 . - 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MDIEALHQAIILALPKDPSSVVGLELAKDPSSECWSLGSDGLLRLDNRIYVPNHGNLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVCDYVTSCTTCGCNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFNTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGFEFVSAFFWALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDNWSHLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVWPEVDMKSDLARDFVINLDELHVFLREEILLAQSRYKEQADRKRISHPEFLIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI # SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNIAKILDSKLDRRYKHCPLCYYIRWAGYEGTDDEFSWVAVDEL # HADKLVPAFHARYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 Scaffold_7 AUGUSTUS gene 720556 721400 0.46 - . g155 Scaffold_7 AUGUSTUS transcript 720556 721400 0.46 - . g155.t1 Scaffold_7 AUGUSTUS stop_codon 720556 720558 . - 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_7 AUGUSTUS CDS 720556 721021 0.99 - 1 transcript_id "g155.t1"; gene_id "g155"; Scaffold_7 AUGUSTUS CDS 721135 721400 0.46 - 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_7 AUGUSTUS start_codon 721398 721400 . - 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MPFGLMNAPAAFQCFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHQKHVKEVLQWLRKHWLYANPDKCEFNMDTVEYL # GYILSPDGLTIDIIVPMTRLTRKGAPWIWDNDCQEAFENLKIAFTSAPILAHWEPNCPIIVETDASGYAIAVILSIQTVDGEIHPLAFLSRTLHAAEL # NYDTHDKELLAICEAFKAWRHYLEGSGDPVDVVTDHKNLEYSTTKILTHQQVRWSEYLHQFNMVICF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 Scaffold_7 AUGUSTUS gene 731958 732905 0.99 - . g156 Scaffold_7 AUGUSTUS transcript 731958 732905 0.99 - . g156.t1 Scaffold_7 AUGUSTUS stop_codon 731958 731960 . - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_7 AUGUSTUS CDS 731958 732905 0.99 - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_7 AUGUSTUS start_codon 732903 732905 . - 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MDPKKVEAVRTWQPPQKKRELQSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDAFNQLKDRIIEDVTLI # IPRETGKFRIEADSSDYANGAVLSQNVDGKWRPVAFRSRSLNEVERNYEIYDKEMMAIMDSLSDWRQYLLGAKEPVEVFTDHQNLQYFRKPQKLNRRQ # ARWVVEIAEYHIELFHKPGKSMGKADALSRMSGLEKGENDNTDVTLLKPEFFISQVTDQTSAPEDDLLNLIRRKKNQRDKLVQVALESKDKEWLETED # GLAVWQGRIYVPRTKSSEDESYRHIMMPRQQDTLAAIKLLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 Scaffold_7 AUGUSTUS gene 733123 734016 0.64 - . g157 Scaffold_7 AUGUSTUS transcript 733123 734016 0.64 - . g157.t1 Scaffold_7 AUGUSTUS stop_codon 733123 733125 . - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_7 AUGUSTUS CDS 733123 734016 0.64 - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_7 AUGUSTUS start_codon 734014 734016 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYL # PHYESPEDDGTEEKLVDGERIFWFDWDGYLSDQGHIKVQTATTDAATPYLAEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKA # LDEFLEENLRSGRIRPSRSPMASPFFFVKKKDGTLRPVQDYRKLNDMTVKNRYPLPLIQELIDKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTN # RGLFDPQLCFSDLQTHPPRSKHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 Scaffold_7 AUGUSTUS gene 735117 735494 0.53 - . g158 Scaffold_7 AUGUSTUS transcript 735117 735494 0.53 - . g158.t1 Scaffold_7 AUGUSTUS stop_codon 735117 735119 . - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_7 AUGUSTUS CDS 735117 735494 0.53 - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_7 AUGUSTUS start_codon 735492 735494 . - 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDIECLLPRQRTHRECSGEARTSPSGPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 Scaffold_7 AUGUSTUS gene 738572 738832 0.64 + . g159 Scaffold_7 AUGUSTUS transcript 738572 738832 0.64 + . g159.t1 Scaffold_7 AUGUSTUS start_codon 738572 738574 . + 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_7 AUGUSTUS CDS 738572 738832 0.64 + 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_7 AUGUSTUS stop_codon 738830 738832 . + 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MPNPFPNLTQSPPPPIEVDGEEEYNVAKILDSKLDRRYKCCPLRYYIQWAGYKGTNDEFSWAAADELHADELVPTFHT # RYPQKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 Scaffold_7 AUGUSTUS gene 744619 745218 0.75 - . g160 Scaffold_7 AUGUSTUS transcript 744619 745218 0.75 - . g160.t1 Scaffold_7 AUGUSTUS stop_codon 744619 744621 . - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_7 AUGUSTUS CDS 744619 745218 0.75 - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_7 AUGUSTUS start_codon 745216 745218 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVLRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSC # QEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVV # TDHKNLEYFLYYQGSHTPTGPMV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 Scaffold_7 AUGUSTUS gene 746029 746927 0.7 - . g161 Scaffold_7 AUGUSTUS transcript 746029 746927 0.7 - . g161.t1 Scaffold_7 AUGUSTUS stop_codon 746029 746031 . - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_7 AUGUSTUS CDS 746029 746208 0.85 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_7 AUGUSTUS CDS 746292 746927 0.74 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_7 AUGUSTUS start_codon 746925 746927 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MLELLSGSRAPLRPLVPSSPLSAVPLTALNQEQGQGAEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSY # LSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKD # EMARLPEPATLADYRQEVLRIDNRYWKREETRSARLPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSAVSAPRSTILVQMGKSFPPRRKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 Scaffold_7 AUGUSTUS gene 754350 755282 0.39 - . g162 Scaffold_7 AUGUSTUS transcript 754350 755282 0.39 - . g162.t1 Scaffold_7 AUGUSTUS stop_codon 754350 754352 . - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_7 AUGUSTUS CDS 754350 754733 0.6 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_7 AUGUSTUS CDS 754786 754902 0.74 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_7 AUGUSTUS CDS 754962 755282 0.65 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_7 AUGUSTUS start_codon 755280 755282 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MSVAQSMREAAQAAEEFAKAIGTPSLINGHTKGKGKTGDEEVINGKRKRVKKDPNAPKRPASSFFLFQNQIRQKVKEQ # HPDLPTAELRKLMSEQWSTLPEDQKNVGLHYKQLAEELKVVYSERKKNNARSPEQVAAADAVVAAAAATKKAPKSRKPTATDAPVVAKKPVIPPVSGS # DESDNESSEDDKVKLKTGKPTKNAPAPPRKGQKSEPFVPDSDEDDEEEDEDESDQVKQSSDEEEEEERKSNLQPKSQRRSITINLCRGASELPVPSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 Scaffold_7 AUGUSTUS gene 755747 757039 0.34 + . g163 Scaffold_7 AUGUSTUS transcript 755747 757039 0.34 + . g163.t1 Scaffold_7 AUGUSTUS start_codon 755747 755749 . + 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_7 AUGUSTUS CDS 755747 755922 0.35 + 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_7 AUGUSTUS CDS 756265 757039 0.5 + 1 transcript_id "g163.t1"; gene_id "g163"; Scaffold_7 AUGUSTUS stop_codon 757037 757039 . + 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MEQSNFYTTWLTSQPGQSTNSSTFDDWPKERPTTTTHASATPSTTLGEINDIFTELGGLPALTSVGGPSQSASQPPRA # YSQPLSLTSSPHTSLSAQPPQQNQAQQPFSFSSLSTIYHPSHNLPPALLNQYHSLQQQQSPPQLHLQQPQQVQQSQGTLSPQSLHSPSAFTVVAPNSF # YAQPSHQQNGLTSIPNAASSTTVSSLQPAHPLPTTAEQRAQLYAVIKPMLQAASFTGAGAVQTLAQRIDDFGTTEIDAQLRMEVLTKIRDGAGNHYFR # AWGENATALEITREWLKQAYAAKQDNPLSETTMPLLHVRSVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 Scaffold_7 AUGUSTUS gene 757571 757996 0.66 - . g164 Scaffold_7 AUGUSTUS transcript 757571 757996 0.66 - . g164.t1 Scaffold_7 AUGUSTUS stop_codon 757571 757573 . - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_7 AUGUSTUS CDS 757571 757996 0.66 - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_7 AUGUSTUS start_codon 757994 757996 . - 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MFGVPATLGGVFDEPGGGVAEEGAPITGDPLRPFDIDLRTSWKGSIDDGCATLLLTPFFPVPELPGRGSGAFLKLGSF # GFALGAEKNDESDLASFVGGVLVNSEEASFLTAMGFVDVAEPTAGFLDSGGALIGASSFRFLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 Scaffold_7 AUGUSTUS gene 760183 760890 0.64 - . g165 Scaffold_7 AUGUSTUS transcript 760183 760890 0.64 - . g165.t1 Scaffold_7 AUGUSTUS stop_codon 760183 760185 . - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_7 AUGUSTUS CDS 760183 760890 0.64 - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_7 AUGUSTUS start_codon 760888 760890 . - 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MSSSTSSNSPSPSSDSVHLLVLVHGMWGNPGHLAEMERIVKEVQPELHVLLAETNKEDSTYDGIDWGGERVAQEIVQE # IAHLRSQGKHVRRFSITGYSLGGLVSRYVVGILTQRGLFSPDSPDVIVPVNFNTIATPHFGLVKYNSFFSAISRTLGPKLLSRTGEQFYCVDKWGKSG # RPLLDVMSDPNLIFFQSMAQFKHVRIYANALNDLTVPYVTAAIETEDPFAEYETNGLQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 Scaffold_7 AUGUSTUS gene 762637 765064 0.99 + . g166 Scaffold_7 AUGUSTUS transcript 762637 765064 0.99 + . g166.t1 Scaffold_7 AUGUSTUS start_codon 762637 762639 . + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_7 AUGUSTUS CDS 762637 762929 0.99 + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_7 AUGUSTUS CDS 763015 765064 0.99 + 1 transcript_id "g166.t1"; gene_id "g166"; Scaffold_7 AUGUSTUS stop_codon 765062 765064 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MLNLRLLHRLGIVINIPSSSNAKITIETNGGGCGCGDDGDEEYYDDEDYDDGEDEGEDDEITQDSGYGSSDDLAAALG # SALATDSGDSSNALTGSAICSNATASDSSAGASATGSADGASSTSASTTGADSSSSTDTSSASSASSSAVSGSAADSGSSSTTGAATDSGSATSTAGN # ATDSGSASTSTSGSSSTDSGSSSTTGSATDSGSAATTSGSASTSGSASTSGTSTVETCNTAWQKCNTDWQGAGSNTGSYTCQKDYQSCIQGSSAGSSS # SSGTTSTSSGSSSSGSADTSSTSSTSGSADSGSAASSSGVGSTDSSSSTATAAASASATADADSSTSQDGDSNTGSSATDASSPTSSSTGTSSADTGS # STGTSSADTGSSSGTSSADAGSSTGTSTADSSSASSSTAADSSSASSTAAADSGSTGTESSAAASATASSDSSSATARGIDGSNSTSSATDCGCSDSS # NSTATASGTDSASSSAASGADSSSTDSGSAASATSTADASSSSSTTSSSGTDSSSGANSTATASTDSPSTPTATGAAASDSGSSASASGSTDTSSSSA # GATTNSTGTDSSSGANPSAAASTDSASTSTATGAAASDSSSAAGATTSATGSTGTDSSSGASSSAAASTDSASTSTATGAAASDSGSSASASGSADAS # SSTTSATGSTGSSGTDSSSGAANTTDSSSASTATGQQALVQIRLAARIAQELRRVPALLAQRMLLLQDHPVPTRPVAQQVLPVPLRPRLPLVLVPIRA # LQCYLEWYRLILLRLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 Scaffold_7 AUGUSTUS gene 766003 766833 0.52 - . g167 Scaffold_7 AUGUSTUS transcript 766003 766833 0.52 - . g167.t1 Scaffold_7 AUGUSTUS stop_codon 766003 766005 . - 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_7 AUGUSTUS CDS 766003 766833 0.52 - 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_7 AUGUSTUS start_codon 766831 766833 . - 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MGVDGNQSDFDATYISSHFTAVKQFHLWPQAALHTQWPGNGTAGDPIFDNFYASTMPSLISDEESSVKVRKALGDLLD # LIGVCSLLYARFKDTQLIYVFHLQPVVLLTHSQSGQYGWILGDTRPSLIKTIIALEPIGPPFINAVFPPLTPARPFGLTEIPVTYSPPIFFASDLKTE # IVPSLSNASLGTTCYHQAAPARQMVNLKEIPTLVVTSESSYHAIYDACTVGFLAQAGVPVTHVELASVGIKGNAHMMFMEKNGLEIAEQVVLDWIQKT # TL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 Scaffold_7 AUGUSTUS gene 769065 770833 0.63 + . g168 Scaffold_7 AUGUSTUS transcript 769065 770833 0.63 + . g168.t1 Scaffold_7 AUGUSTUS start_codon 769065 769067 . + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_7 AUGUSTUS CDS 769065 769239 0.63 + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_7 AUGUSTUS CDS 769299 770833 1 + 2 transcript_id "g168.t1"; gene_id "g168"; Scaffold_7 AUGUSTUS stop_codon 770831 770833 . + 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MGLPELPASSSEDNVIEKDYVRRRALWALEGKQNDASFSKVEIPELSSSEVEKKMFDFSSKSFSTPSNSGYGKRESFK # PSSSKDQLHTLVEEEEEEEDWDFQKSSPRKLPVSAVSLSNDDKLPTTPVTPDDAFAKQTASRPRPATLTLRPLSLTAGGLPTPSLTPSVRPGLRSLSL # VPNDEQTTRNSFNDVSPTPYLRARPANLQISTSRGSVDETSCAIPIRRSSISYKSSAAAAGLPTPEMTPTFSERRYSHNSLGSNTSVSGISNDEDFLQ # SNASYSRHRPLSASEQHFLFKSHNALLSRIQDLEKALIVRRTSVSSVPGSRPLSSSFSVTDSEDMSISSEPSDEMLRLVADLKAERDELKRDVDGWRV # RVGDLEKQIGLLGKRVEGERREAWVARSRTNLLEAEKNTFEKEYGQAKEEMARMEEEKNKEIAQLTAQVRTLEADKQRTIQDNAHLSGECEYWKVEAA # RLSKMRKDEMLISTVRSTYDTEHAPSAWRRGLHYDRLIRWKVQLMWTSGRLIVIMASDFRSKLSLKRMKGISMFMVRKFLKRTSRRITYRTKKTTVSW # I] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 Scaffold_7 AUGUSTUS gene 770949 771817 0.42 + . g169 Scaffold_7 AUGUSTUS transcript 770949 771817 0.42 + . g169.t1 Scaffold_7 AUGUSTUS start_codon 770949 770951 . + 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_7 AUGUSTUS CDS 770949 771262 0.42 + 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_7 AUGUSTUS CDS 771382 771817 0.93 + 1 transcript_id "g169.t1"; gene_id "g169"; Scaffold_7 AUGUSTUS stop_codon 771815 771817 . + 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MPSSPAIRASTLSSGSGSNTPSTLTPGSRSLSSSPVPSVASNMDALKSTRVQATVVPVHRSVGSLSKTWTFPRAQSAS # TSHDPRNDVDKFFDCLEDSETDSTGSRMVVEEQDSPRSLPVVIEEEEVEDDDEQTRVDDDDDMLGDNAGIKITLTPAAEDDNDEYLSSHIEDSDEEET # DADEENDEIAQQDRTVNVHDTETHPRFKSTRKPVPVLKSLTKGMMMMTSLLTSGNHFVFYTSAYLSNDNSSAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 Scaffold_7 AUGUSTUS gene 777567 777839 0.99 - . g170 Scaffold_7 AUGUSTUS transcript 777567 777839 0.99 - . g170.t1 Scaffold_7 AUGUSTUS stop_codon 777567 777569 . - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_7 AUGUSTUS CDS 777567 777839 0.99 - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_7 AUGUSTUS start_codon 777837 777839 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MSAITITYTVHPPIESVSPDELPTSRTIEVPINASQDGGNSYYSVLHEALEKAINEIGADLTIWRDAVGKLEMSKEAK # KNDVGEEEEDEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 Scaffold_7 AUGUSTUS gene 778498 778953 0.45 - . g171 Scaffold_7 AUGUSTUS transcript 778498 778953 0.45 - . g171.t1 Scaffold_7 AUGUSTUS stop_codon 778498 778500 . - 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_7 AUGUSTUS CDS 778498 778953 0.45 - 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_7 AUGUSTUS start_codon 778951 778953 . - 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MLYRVSPKTKCDLLTISLFLKMTKCGRFGANSFDYSPAAIRNSVLQSLHRLQTEYLDTVYLHDVEFVCTPVQAKQTGN # HALALTEEKAAYGLEEGQEGIIYGEGDQKILDAFAELRKMKEEGLIRSIGITGMFSSSFRISIFMTFVFKVTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 Scaffold_7 AUGUSTUS gene 782444 783121 0.67 - . g172 Scaffold_7 AUGUSTUS transcript 782444 783121 0.67 - . g172.t1 Scaffold_7 AUGUSTUS stop_codon 782444 782446 . - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_7 AUGUSTUS CDS 782444 783121 0.67 - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_7 AUGUSTUS start_codon 783119 783121 . - 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MASGLKKEDDFKNKAAFPLQDSMTKWVSRLALGLVLVSMCLLLDAIKVSVKSLFCSTLAGIVSQHRWYVLDPSSLHEL # AQAAIASSPDDTAGMIEHIVSNLTATYPSSTIALNTKSSEWVFNNAGGAMGAMYIIHASITEYLIIFGTPLGTEGHTGLHTADDYFNILVGEQWAFSP # GQLEMERYPAGSVHHLPRGTAKQYKMHKGCFALEYARGQPLHSWLHRSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 Scaffold_7 AUGUSTUS gene 786255 788384 0.11 + . g173 Scaffold_7 AUGUSTUS transcript 786255 788384 0.11 + . g173.t1 Scaffold_7 AUGUSTUS start_codon 786255 786257 . + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_7 AUGUSTUS CDS 786255 788384 0.11 + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_7 AUGUSTUS stop_codon 788382 788384 . + 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MQPAPGAPHSGDINNDIPLHPPSNSQGLPARNYRDFHPSYEPPDPTKSSFDPAHTAAEDARAHAIPFPSPPATHPVFN # DPICVEDIASIKSYLKRTSHSNSVGVDAATYDLLIDIDNDRLLPLFQRAIEQQDIPSSWLTSTIIALAKPGKDASKTCNYRAIALESCVLKFASLLVH # HKLCQALEQSHTIPPSQNGFREGFRTNNNAFILRTIIEKARSRGETIYAAFVDISNAFPSTNQSSLWNKLSDAGLTGKYFDWLRSLYNRMTYTIAHDG # QLSENFHAFSGVLMGDPSSPTLWNIFLSTFNLSTDPEDVELATVVISHLEHADDIVLISRGQAGLQHHLDSFETWCHNNALEISANKSWVMIFGHLPH # VLPHFTLSAEILKFRDVVRYVGTFFQSTHRNIFASHYTEKRDSAIGSARAITGCDLLVGNRRMPPAVTRQLYIALVDCHLTNGCEVMPDTDACLLQIL # EDVQIRFLRRMLGLSNNSVITPLYTETGIMPIRTRRATLCLRYLKYLMDLPNSHYASLALEENIKLRNSGSPCWLSDLDFAIAHLPGNHRLPSLHTLD # GDRIDNLIKSVDFSTKSELQTHIDSWSKLSLLRHRLEPKEEGPAKAQIIGLRHYLTQVSIHSHRRTITKLLCGDLTPQVFRGSPSPLRILTTTEQRTR # LCRACKHQPETPQHIFFQCPSLPSIIALRSTFIATMRQFRPSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 Scaffold_7 AUGUSTUS gene 791423 793434 0.41 - . g174 Scaffold_7 AUGUSTUS transcript 791423 793434 0.41 - . g174.t1 Scaffold_7 AUGUSTUS stop_codon 791423 791425 . - 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_7 AUGUSTUS CDS 791423 791667 0.99 - 2 transcript_id "g174.t1"; gene_id "g174"; Scaffold_7 AUGUSTUS CDS 791736 792173 0.99 - 2 transcript_id "g174.t1"; gene_id "g174"; Scaffold_7 AUGUSTUS CDS 792326 792716 0.8 - 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_7 AUGUSTUS CDS 792777 793118 0.52 - 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_7 AUGUSTUS CDS 793179 793358 1 - 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_7 AUGUSTUS CDS 793426 793434 1 - 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_7 AUGUSTUS start_codon 793432 793434 . - 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MADANALKDQGNKAFAAKDWDKAINLFSQAIAIDGSNHVLYSNRSAAYSGKKEWAAALKDAEKCIELNPTWSKGYARK # GAALHGSKSYDEAIAAYDAGLKIEDSAPLRKGLQEVKDAQGVFSQGYLYLSVMLIFPLAYDARGQKEDNPFASMFADPNLIGKLATNPRTSKHLSDPN # FLQFYQKNPQMLDMNDPRMIDVLGALMGIDMQGFSRPEGSSEIPTNDNTSPSPSAPASSPPPKPSPSAPPTEDVEMEEIDDEEAKAKKEAEALKKSGS # EAYKKRNFEEAAKYFQQAWDVWPKDITFLTNLGGGYHISFALKLRADYKLIAKAYGRVGFSYQRKGDLPSAIKYYEKSLTEHRTPDILNKLREAEKIK # ADAERKAYIDPEKSAIAREEGNVHFKAGDFATAVKSYEEAIKRDPVDPRGYNNRAAAYIKLVAFPEALKDVNKAIEVDPSFVKAYIRKANVLLSMREY # AKALEAVQEAELHDEGNKNATELKQLEYKIQTALYEQRGEETQEQTLERAMRDPEVAVSSVLMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 Scaffold_7 AUGUSTUS gene 800835 802270 0.51 + . g175 Scaffold_7 AUGUSTUS transcript 800835 802270 0.51 + . g175.t1 Scaffold_7 AUGUSTUS start_codon 800835 800837 . + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_7 AUGUSTUS CDS 800835 801480 0.51 + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_7 AUGUSTUS CDS 801540 802270 0.86 + 2 transcript_id "g175.t1"; gene_id "g175"; Scaffold_7 AUGUSTUS stop_codon 802268 802270 . + 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MFGRPLAIASHHFDTSLPSYCDPAVDKTGRLFLPNIALFRLAFILGDIMDDAVSVRPVPYDSVQANDRALKQWMDNLP # SELNLDEYKVARNLASTNANLRRLGVQSVIIRTSYHHIRFTLHRPYASAGISQSAQSSSASSKSASDNKHSQSLEIAVGAASELITLVGQSRPDFLAN # SSLAVPGHMNWGPFHVFSAAMFFSFQLIANSDQPGASLFHKASDILFALAPLYSVDFHLQNKEKREKERARILSVVRNLAFPYHDSHDPRRFGDSSPA # SNGSGRHIGNGSPIGSSSVSPPLTVVPASHARSDLPNMHSHAVYESSLHTHAAMSSMRTSSIYSHPGGTSNGQIQQSGGGGHPSSPLSQPQMSPTVMS # SNAQPMASMPSSASPNSYQPYITGAQPQVYSDSSRYAHYPHPGDDASMWGAAVGFGQREWSQFIDGFQPPPSGSSSVVAHHRHLQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 Scaffold_7 AUGUSTUS gene 804230 806077 0.35 - . g176 Scaffold_7 AUGUSTUS transcript 804230 806077 0.35 - . g176.t1 Scaffold_7 AUGUSTUS stop_codon 804230 804232 . - 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_7 AUGUSTUS CDS 804230 806077 0.35 - 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_7 AUGUSTUS start_codon 806075 806077 . - 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MVEKTMLDLSSVRNNGLSVWESALCAPETELTPANLEEVLMGKGSMADKYFDAVMRPNVFSTLTLRTAIDQYTDACLS # LPGPPPNPLTVTYASLEENIAAVVGCTVNLNRDPSTGALQHDKYWNALKRDWEGFIARCREIERSARWPLVLGAQGQGDVIVVERERISALVAEDLPI # HLHQVLSHDLRIADSQYDLFGILWTLRHKVGAQTMLSLESCLVDLMHQEIAFPFADILKDQAGQFHFKDNLDEGASLWLSGRLASIDSIDEAVRTSLD # VIGGLDMGIKREEDEVELLLPRPDSDWFKGLTASYIMSSTNARYELCLCLMSLLFFLVDDLSDWDPSLLAEVFAVFRGTATLRYIIQQPSSATTQTPL # DDVSSADDVVSLLQNMQVSRNRNHSTPTYSLVHRLLIQTGDTSHVLPGAAHRFLDNTGLLQSITPAVASKAEVSFCEKLRVLGYMHVSRELLSWLPRS # PGVSYVLSRIWLNAGRVDDAHSSSKSSLAALVHIFYTIYYFCGSLGFLTGPDNALGQEDRDALQNVLPSSQLFDSSYSFYLYMATLFKSNSLQHYEVH # FTQLALSVAPSNTDTSFLWHTVVRGYIDLGLFEEAYAAWISTPSDTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 Scaffold_7 AUGUSTUS gene 811533 812971 0.32 - . g177 Scaffold_7 AUGUSTUS transcript 811533 812971 0.32 - . g177.t1 Scaffold_7 AUGUSTUS stop_codon 811533 811535 . - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_7 AUGUSTUS CDS 811533 812285 0.87 - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_7 AUGUSTUS CDS 812339 812971 0.33 - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_7 AUGUSTUS start_codon 812969 812971 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MAKAMSQHFMDARLIENAADPSSNLFKDRGIYILTPKGLHVLERFISKNGINSDHLQNVFITQPICIKLLHLERRSAD # DEIIVSQSVITALFRRFVGRQANYPSQTTQPQDAFQRYNERARGVFLMDVTERAQPLLGKGQQHHKYCFAAVTALEWLCDFTSVVGREEAAEMAAQFV # RFGLITLVSDKRKNNDSAIIFTVRGSAPGGNSPVSQHGEFRCTAKAIYKITDEGRRVAHWDGSRPLGAHDSPNASSASLNAERSSVDNVSESGEKKGS # DAKIHRRISMAEKLNVNYQAAEKKNTKESNTERLNYILEEPSLRSLFREFLRSNFCEENLSFWLDVQDFKRKFNITSSAVAVNPPPRSGSRTTPGQAA # MERHHESLISTAFVIYNTYLAPSSTCELNIDHGLRNELVKYLDDVVTSLDGKPFAGKVEPEQANASNHDPFVRADPGTCLPTNGHRLCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 Scaffold_7 AUGUSTUS gene 814624 815082 0.79 + . g178 Scaffold_7 AUGUSTUS transcript 814624 815082 0.79 + . g178.t1 Scaffold_7 AUGUSTUS start_codon 814624 814626 . + 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_7 AUGUSTUS CDS 814624 815082 0.79 + 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_7 AUGUSTUS stop_codon 815080 815082 . + 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MFIKDTQGIQALLEQLQHSQAWKDAVASSYPDGSPQHILDTPQSSSAPQAVSVAALLSQLQTEPHPNVVDTSQNHHLA # AFQNDASESSFSMTLPASNNSVHRVDDHRYLTFQQALPLIARKSASPLFAEALKAVRHYSIMGQAPLISIFCCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 Scaffold_7 AUGUSTUS gene 819259 819849 0.78 - . g179 Scaffold_7 AUGUSTUS transcript 819259 819849 0.78 - . g179.t1 Scaffold_7 AUGUSTUS stop_codon 819259 819261 . - 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_7 AUGUSTUS CDS 819259 819849 0.78 - 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_7 AUGUSTUS start_codon 819847 819849 . - 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MVNISDFNSIANLLLQVKVLDKSGQEIVSVGFDRFGFNSEVPIDALRSLYLRSHYVVTSTSDKVDGDSLDPDAEEQQH # AKFTKGLSAYQSKSIFYPEDNSISYTTLARFPPVKLLAPSQRKRVLVTGGAGFVGSHLVDRLMLLGHDVTVLDNFFTGSRTTVSHWVGHPNFELVRHD # VVEPFMIECDRTSDRFASSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 Scaffold_7 AUGUSTUS gene 821509 821736 0.53 + . g180 Scaffold_7 AUGUSTUS transcript 821509 821736 0.53 + . g180.t1 Scaffold_7 AUGUSTUS start_codon 821509 821511 . + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_7 AUGUSTUS CDS 821509 821736 0.53 + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_7 AUGUSTUS stop_codon 821734 821736 . + 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MKFSDYVNRHQFLNSTFHSPNRYGSDLTPDQKDALLDVVRATPHAQISPEIRRELVNSVVRGAPRDDVSEDFEMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 Scaffold_7 AUGUSTUS gene 832730 833269 1 - . g181 Scaffold_7 AUGUSTUS transcript 832730 833269 1 - . g181.t1 Scaffold_7 AUGUSTUS stop_codon 832730 832732 . - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_7 AUGUSTUS CDS 832730 833269 1 - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_7 AUGUSTUS start_codon 833267 833269 . - 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MADQSENSSSETSSLNHTDHAPENDNSMDSDLDSKAALTLSVPTAPLKQAHPRPKPQPIPPSDSNSHSLHPVDSHESF # DVPITGDPGTDNAKDPQMSFEEEDNGVSKEDEAVETAIWSILGHKWIGQGLMFMVEWVDNDVIWESLLNIKDCVAPDDYLVHHGLAEPSKLSKKMYLV # SRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 Scaffold_7 AUGUSTUS gene 837781 839216 0.83 + . g182 Scaffold_7 AUGUSTUS transcript 837781 839216 0.83 + . g182.t1 Scaffold_7 AUGUSTUS start_codon 837781 837783 . + 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_7 AUGUSTUS CDS 837781 837799 0.86 + 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_7 AUGUSTUS CDS 837855 837976 0.92 + 2 transcript_id "g182.t1"; gene_id "g182"; Scaffold_7 AUGUSTUS CDS 838068 839216 0.96 + 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_7 AUGUSTUS stop_codon 839214 839216 . + 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MPRIRKKTSKRGSTNDRKKISQKVRESRKKKTKAAKKSVEWKSSKIAILAEVAEQRRLVTSSHHQLDSKLKLIVTNQA # AEEKQHRKDEKKRALKHVAEDAQDDNIEEDDGIASISAKRLTAKATSKPAPEAEESEGEDEPPILINRDLPHLHAVLDEADAVIQVLDARDPLSFRSS # YLEDLVHSKPGRKTLFVLNKIGTSLIYVPRAKSSVENGFTDCVPHESLVAWTSALRKQQPTFPFRSASSFLPGNPLAQLNTKGKGRAKNPVDDALGGD # AVLECLGHWAAEKENGSSLTVAVVGVTNVRHPSTVLNFQIIKHVLWQTGKSSLINSLAKTTVLPVYSLASSPRGPTTTTMPQEITIQVAGNRTLRVID # TPGYSWKIDKASSDWDEVRARDILLRNKGRIDRLKDPSGPGVSLCTQYTYLSLMEFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 Scaffold_7 AUGUSTUS gene 839471 840154 0.98 + . g183 Scaffold_7 AUGUSTUS transcript 839471 840154 0.98 + . g183.t1 Scaffold_7 AUGUSTUS start_codon 839471 839473 . + 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_7 AUGUSTUS CDS 839471 840154 0.98 + 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_7 AUGUSTUS stop_codon 840152 840154 . + 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MPSSNLVVDTPSTDARLQALYAKADEALASLKSRKAMRKAGGLVKISPGQVESREVISEVLYAELMETSDGEDNDGID # VDEANHIEAEEDEDEESEEDEDEEDGDKEEVENEEELEFEDEEVEVAPPASKSQKRKRADPISHPPNKKVSFVAKSHASKNKAISKADVSAVSESSTP # KSLSANPTTRKALKSSLKKMKPIANASSKNRPPKIRSDEGNRESYDFGKYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 Scaffold_7 AUGUSTUS gene 843229 843726 0.72 + . g184 Scaffold_7 AUGUSTUS transcript 843229 843726 0.72 + . g184.t1 Scaffold_7 AUGUSTUS start_codon 843229 843231 . + 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_7 AUGUSTUS CDS 843229 843726 0.72 + 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_7 AUGUSTUS stop_codon 843724 843726 . + 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MPRENRKRGKKHKFKTTDETIPYASSEPQAELEPQVGPSWIVTASGEDSEFNPEAPFGYVDADVKAYFRTVDLQIREW # QEGQQEHLDGDANVDPNAGQNDRNQNLIYCLILFTEKHMFFVAALSEMRGKEKQLATDPDCSIILERMAYSMDDFVRRVFLDSLSGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 Scaffold_7 AUGUSTUS gene 845877 846191 0.76 + . g185 Scaffold_7 AUGUSTUS transcript 845877 846191 0.76 + . g185.t1 Scaffold_7 AUGUSTUS start_codon 845877 845879 . + 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_7 AUGUSTUS CDS 845877 846191 0.76 + 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_7 AUGUSTUS stop_codon 846189 846191 . + 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MPTTPKNDSKNIPSAELADPSVFKKKRKRETRVKDEIDELFDSSHNNKKSKSHKVAAVDSSATVKVAKEPSGDTLMDK # GLKDIFDAIRAAPKTDHNKVKGRVKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 Scaffold_7 AUGUSTUS gene 846610 847401 0.87 + . g186 Scaffold_7 AUGUSTUS transcript 846610 847401 0.87 + . g186.t1 Scaffold_7 AUGUSTUS start_codon 846610 846612 . + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_7 AUGUSTUS CDS 846610 847401 0.87 + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_7 AUGUSTUS stop_codon 847399 847401 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MREFNHNLINSSDDDKVQNIIYHAQCLTYTPPEPDELIILEPPTELDPVLQRTSLITSELQTDIPLLFASLYSLLALF # LTSTTFRIVTSNLFLLARQYFSSSLVEGVRKVEHAAEIVARAAETTQNLTECAVNLVDQVHVAAEGVGLSAMGIGDVARDTERVALLAISEGGPLHGL # EGLKDHTHEITEHTICEVQARQKEHVARQQDMKEPTNNFVDESQRRQEQHLDADRAKAEASQTEDRKDAIIEAIQQVLSALLLILMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 Scaffold_7 AUGUSTUS gene 848264 850438 0.86 + . g187 Scaffold_7 AUGUSTUS transcript 848264 850438 0.86 + . g187.t1 Scaffold_7 AUGUSTUS start_codon 848264 848266 . + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_7 AUGUSTUS CDS 848264 850438 0.86 + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_7 AUGUSTUS stop_codon 850436 850438 . + 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MDYLFSQKNIAMTRPTTNHSYDPNPDATYSESVRREQRFPLPLPRVELVSDTSTFPSSSSLLPTGSEFSGTTTASRWL # EGALDMRLMHIRISDDKEMESQWKEDRLTSCFRWCCCSSPPSDITDPYVNAEGGYGAAYMRTTELERELGTRTRNQTDLANLLTPSSISITQWNETRV # DFFSSHTKTMVVDAEPLLIDLNVPGEDMNHEVPVQAPTLVGFDVATTSASPVTVPSTSPLRAPLNDMDRDPASEDPYIDSDDQRGHLLALVQDKSFEE # RSRSRGGRMKTEIKTLHKIRVHIEGILSSLPSILNEPNHTSRGEPANPHLSVTSKVTQRLTLENIAYYARYNVLSTVFGTWLGVRDEGVLDLEFEFQD # INGNIMGAAKDDGAFLDVDIDLDTSTWLENLFSLDDSGDESDPEADLPFRASNVRFVLPHTLNITPRLRTLPRSTLLSMLTSLPRQILLALLLRPVVL # PLAKLVIRRELESAFAQGIERGCNFVVGLTVRVFRGAKRRARKRAAKIKSEADVLATEGRMTAPPDLYGSQVSFGDVWASIMEVLGEITAVEEGPETI # VHTKMKEARARGVQVEHTVVELDGNSHESDRSQRELDQRVKDKLVATNTTTIAIGIAPQLLPDKADLVSNVLPSTEPTEVVDGVIGAIVQDAVDQAGE # VVKDGLEHAADVMQGAQNVVQKAADVAEGVREGIDEGRQRAEQMEEDEWGWRSVAFDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 Scaffold_7 AUGUSTUS gene 852895 853900 0.6 - . g188 Scaffold_7 AUGUSTUS transcript 852895 853900 0.6 - . g188.t1 Scaffold_7 AUGUSTUS stop_codon 852895 852897 . - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_7 AUGUSTUS CDS 852895 853194 0.84 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_7 AUGUSTUS CDS 853259 853900 0.62 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_7 AUGUSTUS start_codon 853898 853900 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MLHGPADLFVNSLQTVLLAKQVYPYLRGNVHAQTSPPAAFDIQKTVVHARKLVGLFEANGIPKYVLAYLFKCGVELIA # LIGRRSRVCIKIPTTAEGMVACAQLKTEGIQTLATCLFNVPQALAAHQAKCVYVAPYFNGIIAFFILILAHKVNAYYYFVTFQELRVHFEPTIWREYA # APGKEHPMSQVIFDVKAIYGKVGSKTKVMPASIVTPREVIGLVSLKPDHLTISGGILDKLAALPQVAPQDLDSGLKITEFAEEILSADYLASDGILLK # EALEKDVESTRKLNDALKLFDEAEKKTKEYIHEIAMKEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 Scaffold_7 AUGUSTUS gene 858206 859359 0.39 + . g189 Scaffold_7 AUGUSTUS transcript 858206 859359 0.39 + . g189.t1 Scaffold_7 AUGUSTUS start_codon 858206 858208 . + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_7 AUGUSTUS CDS 858206 858739 0.39 + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_7 AUGUSTUS CDS 858838 859359 0.64 + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_7 AUGUSTUS stop_codon 859357 859359 . + 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MNMDKGITLFRNILTFAFLLSLFLHRVEGETLGQTWKAEASITPIARCQEVIGYLLPRDSSNSLVNAPLTFPLTTDST # STTPAFTSTNTITSSASSTVVPPPSFPITSTRSVPSFTPTSSSTITSPVSTSTDSTAPSSSETQSSSSSSMTSSETSSSSQSTSISSSTTPPSSTSSS # SSSTSALSPSTSAPSTQSITGTSSPATPNHTSSSSSSNLSPSGTTSSPILTSSPVSSTISQSSNGGTSTSSTSSATQSVSIVSGSQSMSISDTSSSGT # ISSSQTFSTTSSPVITGSFSATSSGSSAPAHSSGIISGTGTGPGTSENLSTTGSGSSTLRSVFYSSKSENQNSYHHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 Scaffold_7 AUGUSTUS gene 859638 860648 1 + . g190 Scaffold_7 AUGUSTUS transcript 859638 860648 1 + . g190.t1 Scaffold_7 AUGUSTUS start_codon 859638 859640 . + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_7 AUGUSTUS CDS 859638 860648 1 + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_7 AUGUSTUS stop_codon 860646 860648 . + 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MNVFGQRLELGETPAAWWRLAEPGNNIPTSTNREPGLIKTSNEEKRWHQNQNEVPSSSEKRSVYAIAASVVGRVGVTN # NLSHNNNLGALFSDDEKEGLNNNFEGGRRTRGGPISTLAASVAKRTHLPLDRQNHRSGSDNRELEHTLPPSSSSTPMSHSSPPSSYFTPSRNHTPFPS # FPFTFYRASNSSSRNGSISPVQDVPATASVTDTDVSDQISYLGPVSHNRLIDVLDTEVQMPDQRGYIPIVRTDTRDTTGSSTYSASGMDYIPFMRRDT # ETDSYVQTAPITPSTGSLNLTRTHTSQSSKSNIVDSQPSSPYENASGIFHASQNSLAFTGHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 Scaffold_7 AUGUSTUS gene 860736 861125 0.7 + . g191 Scaffold_7 AUGUSTUS transcript 860736 861125 0.7 + . g191.t1 Scaffold_7 AUGUSTUS start_codon 860736 860738 . + 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_7 AUGUSTUS CDS 860736 861125 0.7 + 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_7 AUGUSTUS stop_codon 861123 861125 . + 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MPASHGNETTFKDEIREIPLITSTFHYSPDPEDERDNAVGPRPSSNGVSTPSSSSKNPFNPSHPLFQPGPPNFADQGN # LEGDSFLRTLEWRRRAVAYADGTGQRPSLMEAVEVYFSSNSITTDSSPGSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 Scaffold_7 AUGUSTUS gene 864664 865911 0.49 + . g192 Scaffold_7 AUGUSTUS transcript 864664 865911 0.49 + . g192.t1 Scaffold_7 AUGUSTUS start_codon 864664 864666 . + 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_7 AUGUSTUS CDS 864664 864862 0.53 + 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_7 AUGUSTUS CDS 865388 865911 0.6 + 2 transcript_id "g192.t1"; gene_id "g192"; Scaffold_7 AUGUSTUS stop_codon 865909 865911 . + 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MNTTNLSNLDIDLQGTLSWDNSNLTYWLNNSLPVGYQNQTSAWLFGGEDIRWDGHGHGTLNGTGKCVAWFTFNALLSD # GAFETIQNVTARNISITNMPFGAYVKTWTGISTGYPPNGGGGGLGFISNITFTDFTLHNATGIFLITQCTSYNGITGNCDTSKFNLRNIKVEKWKGFA # SSAVVGSMQCSAASPCTGIEIEDVENGIVDPVNGTRPVNYLCDSVVDPVGFNCTGPPWAESNRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 Scaffold_7 AUGUSTUS gene 869111 869587 0.9 + . g193 Scaffold_7 AUGUSTUS transcript 869111 869587 0.9 + . g193.t1 Scaffold_7 AUGUSTUS start_codon 869111 869113 . + 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_7 AUGUSTUS CDS 869111 869587 0.9 + 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_7 AUGUSTUS stop_codon 869585 869587 . + 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MSFSQVGGHPNSIQLTEDGSLLIKPALPLEHEFYTLMAQARAMDSMGLAGGEGDGVGNEGALNERTLHGLKNLKRLSR # FVPEFYGTLREESIDVETLNADSKDIGDGGIGAMMFKDTSNAMVDAVALNKSSRQHLVLSNLLHSFTKPNVLDLKLGTVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 Scaffold_7 AUGUSTUS gene 870248 870736 0.37 + . g194 Scaffold_7 AUGUSTUS transcript 870248 870736 0.37 + . g194.t1 Scaffold_7 AUGUSTUS start_codon 870248 870250 . + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_7 AUGUSTUS CDS 870248 870736 0.37 + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_7 AUGUSTUS stop_codon 870734 870736 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MVGGSLLVVWEGDEQRAREGVEWMKEREIKITERIRQEADVEGNEDDDSEYIDSDDDDEGDTSSDEDNENVSAHEPSP # DGAGALTDETNIASKSKSKPSSKSHRRKPSAPYALSLIDFAHTRFVPGQGPDVGVLLGLDTFAKLIEGRILEVEDIEVGRQGSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 Scaffold_7 AUGUSTUS gene 872698 874199 0.97 - . g195 Scaffold_7 AUGUSTUS transcript 872698 874199 0.97 - . g195.t1 Scaffold_7 AUGUSTUS stop_codon 872698 872700 . - 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_7 AUGUSTUS CDS 872698 873506 1 - 2 transcript_id "g195.t1"; gene_id "g195"; Scaffold_7 AUGUSTUS CDS 873614 874199 0.97 - 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_7 AUGUSTUS start_codon 874197 874199 . - 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MYERSPLSYSNLAWSQNREAYQAHHHPRLLHHLQSSLHLYSVKIVSDFDLEPNPFEQSFAPRSANHSNVRGERAAKDK # TGRNGKSDKKVQIEDDLGPPSNESILTIKSGSSADREADDHQQRPQSRTASVPNSNVSNNGSISPRPMLPPVAAISSPADQSSSFGHPWAATGFNSSL # RSGPLSPAMLTGPQDLMPLRLTPALNGLSGDGSYTTRRGPVFVPASPGTAAFLALMHNSGMNNLNGVNGVGPGGTITPNTLNAITGVLNNSQGQIQGQ # GQPGQGQQQQNSYTNPPTVPSHLHHSHTHSNNENTNPHNNSYLDSANNATSTAANGLFLLSQAHQELTKREEEQARANSAQTNANGNSNGATGKRGSK # RKNSEAINGNAGTITNRSSKRAKPSGGRRKQASPEFEEFDPEDDGDDDDDDEVMREMQQQQTTTGGRGRNKKPETEEEKRKNFLERNRQGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 Scaffold_7 AUGUSTUS gene 875502 877186 0.37 - . g196 Scaffold_7 AUGUSTUS transcript 875502 877186 0.37 - . g196.t1 Scaffold_7 AUGUSTUS stop_codon 875502 875504 . - 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_7 AUGUSTUS CDS 875502 876363 0.99 - 1 transcript_id "g196.t1"; gene_id "g196"; Scaffold_7 AUGUSTUS CDS 876444 877186 0.37 - 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_7 AUGUSTUS start_codon 877184 877186 . - 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MEMVTTENVEEKEIIEVEVEEAEVETELLVVEAMDVDQNTSPMKVDSVGPEIHGIPGDSDDNNNDEEKRTMDDIERNY # KEHIAHLEAQLAAASSSTSTSAAASTSSSAFIADGSASMFSASTSSSTSLSISASAPGTESMSMSSSAHISGTSDILRNSQTSLTAAAAGLLDSTDDA # ESVARMSLAERRRWGRSMSILQEGIVRSKLFEIICWLKLTVYAWCRNDLATALSLYRHAALFVPDNTRLSERIIDVEWAVRNGKSYVPTPKRQHPREG # EELKLKSKSSRSSKSHRSSHSISRHEEMSKENSSSNSNTNSESPRKSSSADTRLESERTSQLSLTGSKRKRSVSREPADHSDSEYVFIPPLSSSTSHG # HGFGKDLGNIDEEVEAETETAEAEADEFGVTRVAKVLRRSPRKKQLPQQVSTITTLGTMKSPSTVSDKRKMLGMSLNGKTGVGGVDISGSVYRTPSGG # IGGTTTPKRGHVNGSERKTRKVSDLVYSGLGGLGFSGRGFGRDEDGVGDVDGEIHGKQKRARLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 Scaffold_7 AUGUSTUS gene 878378 879019 0.87 - . g197 Scaffold_7 AUGUSTUS transcript 878378 879019 0.87 - . g197.t1 Scaffold_7 AUGUSTUS stop_codon 878378 878380 . - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_7 AUGUSTUS CDS 878378 879019 0.87 - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_7 AUGUSTUS start_codon 879017 879019 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MSTQPVQIVARIRPPLLNEHTDDAISVVPIPADHTLSAARPIPFTSWVSVSSTGTKTGTTQVQNSQTAFHTAFGPDTT # QLELFDTAVAPHLAPLLKGHTLTILAYGPTSSGKTHTMEGSPAEPGIIPRSVRVLFEMSEEGKENGMISKFEVHMSYLELYKDDAFDLLVSQRTHEKL # PIRTNAKGETFVVGLTRVPIKSFDDWKNVFRCDCFLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 Scaffold_7 AUGUSTUS gene 889873 890685 0.5 + . g198 Scaffold_7 AUGUSTUS transcript 889873 890685 0.5 + . g198.t1 Scaffold_7 AUGUSTUS start_codon 889873 889875 . + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_7 AUGUSTUS CDS 889873 890685 0.5 + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_7 AUGUSTUS stop_codon 890683 890685 . + 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MLDEQDEVTADQQELQKFLALQQDEASVAAKRKRTRSPLPVAGPSTKKVRLEVPRKRSRRRAPGIEVDTEPPRRVLLV # VPPSRSSVTSTIAPVPPPALSSPMEVSIRDVPVQGSSGLVQLATIAEAHSGLARRPASPPVPQVPIKGGESDLLSSNMPPLPRSTLVPRVLTAHPYRA # ENQRLAAQVRLLESQLADSRRENSSLTTALRDTSHALEARQREVEQLRSSSQEFIRNKVEYRHIIDQFLALDRALHGSPDQVSCRVTFPLLPLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 Scaffold_7 AUGUSTUS gene 890721 891560 0.86 + . g199 Scaffold_7 AUGUSTUS transcript 890721 891560 0.86 + . g199.t1 Scaffold_7 AUGUSTUS start_codon 890721 890723 . + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_7 AUGUSTUS CDS 890721 891560 0.86 + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_7 AUGUSTUS stop_codon 891558 891560 . + 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MVEEELRIAKKDRDAAAEQLSTSSRKIAELTTTLLYQQGIVDESNALATRQRVRLEELQEEVHRSCGCAAFVEQMIQE # YPDKGFYEVVLPPLSELEGELVNIRADLHRVATLAHRLYRSNPATVLHHHDRYIGAIIEAVVAFLRRGLDSDDPDVAAHNFRLALDYMQSARGIHGDL # YMRSISSIQWFFHNAVDQDEGLYRLVLEHSRFDNDGPFLTASQHAGFVAPPPDSLEPPLHCRMLALSTALPHREGAGRWDDIVPAIPSDDQLTIDWEC # KTWVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 Scaffold_7 AUGUSTUS gene 894625 895623 0.91 + . g200 Scaffold_7 AUGUSTUS transcript 894625 895623 0.91 + . g200.t1 Scaffold_7 AUGUSTUS start_codon 894625 894627 . + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_7 AUGUSTUS CDS 894625 895623 0.91 + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_7 AUGUSTUS stop_codon 895621 895623 . + 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MSTPSTAVGSTSRVVAPPMPIPPSPSPPPSATGENDLDELTSTIEDPPLGHLTLFKSVFGVGVSLARYILDDPLWPIL # AAAGLPCSFCVRSKKSESCSVVPHLARCSNCDDKKPCILGRLARFRYFARKCSRDLSFARRFLEVHGDPGQRTRFSLLPEQWKIIAEKIESSTSSTRA # LLELSPLDDQDRLEEDHLALQDFIRRQPKLSTATEPVPSNPPSSPVPAKASLVPKKRKRAARVDEVSSSKRTRSGEQDLGVGTAPDYRRVVLVLPPQA # RGRPEVVEPLTPGPGSSPHEASLLPSPVVPVPSPPRVDTSYGVRPAQPGSFGQFVPRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 Scaffold_7 AUGUSTUS gene 896258 897202 0.49 + . g201 Scaffold_7 AUGUSTUS transcript 896258 897202 0.49 + . g201.t1 Scaffold_7 AUGUSTUS start_codon 896258 896260 . + 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_7 AUGUSTUS CDS 896258 897202 0.49 + 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_7 AUGUSTUS stop_codon 897200 897202 . + 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MRLRDRMEKLEESVRRYRNRAHSAEGLIRQYPEDEGLYEIDLPSLSSMQDRLNESEALVRRLATFAHRLYVADPANLL # HYHNTYVGGLIEAVVALLSRGLTHPPEQMRPVVELALDYLSQGRLTHGELHLSSTSSLLYYYSNAADRVDGLYQEMFSHSRFSSDDAFLTAAQHAGYV # DAPPGSLEPPLHRRMFSFGHPIPFPQTPLSDHIPAVPSMDSIMLDWERMIANYVSEVLGYPVPSFVAPPAEEVPNPGVSVEATAPPIPEDPPVSGTNA # PIRSGTPCSCLGPRRLPPPILLPPSLLQPRLLTFLGRPLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 Scaffold_7 AUGUSTUS gene 898961 900493 0.04 - . g202 Scaffold_7 AUGUSTUS transcript 898961 900493 0.04 - . g202.t1 Scaffold_7 AUGUSTUS stop_codon 898961 898963 . - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_7 AUGUSTUS CDS 898961 899797 1 - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_7 AUGUSTUS CDS 900356 900493 0.1 - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_7 AUGUSTUS start_codon 900491 900493 . - 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCEVHRQLLGNHQGVHEAPPKRFSVELDTQCSSA # FELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSD # HNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDT # TIIEALKRIARNEEESFVWEDGLIKRGGRIYVPDVGTYEGRSYSRTTTIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 Scaffold_7 AUGUSTUS gene 914302 915735 0.35 - . g203 Scaffold_7 AUGUSTUS transcript 914302 915735 0.35 - . g203.t1 Scaffold_7 AUGUSTUS stop_codon 914302 914304 . - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_7 AUGUSTUS CDS 914302 914899 0.95 - 1 transcript_id "g203.t1"; gene_id "g203"; Scaffold_7 AUGUSTUS CDS 915013 915168 0.61 - 1 transcript_id "g203.t1"; gene_id "g203"; Scaffold_7 AUGUSTUS CDS 915446 915735 0.57 - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_7 AUGUSTUS start_codon 915733 915735 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MPPSAWVKPDVQVTKQEAEGEVASGLTHGRDDVHRMLLEFETVETEDTESRLNSSIIGSYNSTLDATTVKPDLNVPHG # ASVAGNDAKTISQTLLLHRKRCGVDSIFLESLSRSANWSAEGGKSKSNFWKTADDRFIIKTLVNAWNVADLKATVLAKLIGFYTIEIRNLETGTVQSK # ADLLVMENLFYDQKIDKTFDLKGIQGRKVKSGNNVTVQTSKTLFDGEWIEGTLCPGSASSLLNLDQHFGLGQQQTLTLVRPHSKAVLREAIRSDAEFL # SKSNIMDYSYALHHTLLRVALTDCLRLLLGIDTEHKQIACGLVDTIGPYLLQIHTTSYSYRDRKLYICENIRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 Scaffold_7 AUGUSTUS gene 916082 918683 0.02 - . g204 Scaffold_7 AUGUSTUS transcript 916082 918683 0.02 - . g204.t1 Scaffold_7 AUGUSTUS stop_codon 916082 916084 . - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_7 AUGUSTUS CDS 916082 917011 0.37 - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_7 AUGUSTUS CDS 917905 918102 0.17 - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_7 AUGUSTUS CDS 918216 918683 0.49 - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_7 AUGUSTUS start_codon 918681 918683 . - 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MFSFLSSSAPEAEPQKGPTSTPFSDTLARIEAQRNVLSSSTGVVFDPPMLLVRLAEKEKAHREKEICLTGDERVALNS # LLGWGTVESEANQLDLDKDKRNESWIKKGKGMTGICGFVNQQEISILVSSHVPLAGACVPQEIGPEASMSASTSSALSPHWTVYRYYVNSDSGTLNKD # HDKDDDNNAPPEDSPRLCVNDRDQCLGEVIKSWIDEADVPCDRLRAEEKFSAEDQIAVRKALPRLPSTDDAYDSFDDDDFREPEEYPTPKLKIAGLPE # SYTPTVVAATSDYFNKSKNPSSVSSDPFTLSASSSTAPLCQIPPQPHSSSDDISRTASPSPAPSNPRPPLNHGSSSSSSQLSTTPTTSSASSVHSADA # EGLNRDPMQLLSNLRQTFHRIEQTLYTQLAKTPASSLNEVRRAFLSAAKGAERRLTAWQKKHLGEKKGKKKNKVKDGERSDELNPSEKLRATEPEWWD # PTCHVAPGGNIIIREDDWGSIIAFTLRYETISFSTNTNLEISQHTGLSPRTGVNVRCAPRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 Scaffold_7 AUGUSTUS gene 919239 919841 0.67 - . g205 Scaffold_7 AUGUSTUS transcript 919239 919841 0.67 - . g205.t1 Scaffold_7 AUGUSTUS stop_codon 919239 919241 . - 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_7 AUGUSTUS CDS 919239 919841 0.67 - 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_7 AUGUSTUS start_codon 919839 919841 . - 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MVDHKPLPELPSTSKTPNLARLSIQAQKHRERFIRFVLSELNDAWIDNNLEEWTRVLEDALDDLASSMSQGRWLTGIK # KYKALKEKQSKKKRKLDKKVDLTANSTGPRKSTGADGIFDNGSKKSEIQISSSNSERLERLRQIVAEPDVPSRTPKSRHLLLCLAPLGSRVALPDEDS # GFNLVPSTLGCFVPKQCFRIARRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 Scaffold_7 AUGUSTUS gene 921289 921447 0.63 + . g206 Scaffold_7 AUGUSTUS transcript 921289 921447 0.63 + . g206.t1 Scaffold_7 AUGUSTUS start_codon 921289 921291 . + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_7 AUGUSTUS CDS 921289 921447 0.63 + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_7 AUGUSTUS stop_codon 921445 921447 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MSTDRAEDRSSAREAVSQLNEVIARLPPQILQSPIEQVDDYSMDEGDSLEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 Scaffold_7 AUGUSTUS gene 925628 926563 0.8 + . g207 Scaffold_7 AUGUSTUS transcript 925628 926563 0.8 + . g207.t1 Scaffold_7 AUGUSTUS start_codon 925628 925630 . + 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_7 AUGUSTUS CDS 925628 926563 0.8 + 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_7 AUGUSTUS stop_codon 926561 926563 . + 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MNIYFRYGSVTRKVHWNAQNLENWIRYNCSAMNYHNWDSLRIADMRRKIDHAVALISSIGSNIMAQPDDPPLASQFDH # KSFSKFGNTRTSANVKGLMHATKTIHSKSTSNVVMPSTGGVPWAGPASDALAARSSDPELELGNSSPRTSQEREGLIYDLGPKAPSRLIQSPSTEDRK # RNARTGKSTDWIREHEEHMQRRSKYMLRSDEPDDSDDTDASSDIVETVEKSHGRAPVIPMDRRSKSVPSLSTDQPVVSHQWGSAAASFSDHSWRTQEP # HSMSSFETSALPPCPPPIPDRRTRPPVTTFTHGLSPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 Scaffold_7 AUGUSTUS gene 929827 930660 0.96 + . g208 Scaffold_7 AUGUSTUS transcript 929827 930660 0.96 + . g208.t1 Scaffold_7 AUGUSTUS start_codon 929827 929829 . + 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_7 AUGUSTUS CDS 929827 930660 0.96 + 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_7 AUGUSTUS stop_codon 930658 930660 . + 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MTRPPQYGPFPSGGDTDFLNLYPRAEQGGTVVSEPYSPVTQPYYSSPQHPAYASPIPSGLLGPGVPGHSGSRQPQESL # SPVSAIAGPSTSHYMRLNSPSPPRSYNLEQANLAASQASTSTRRYRDPSRTLPPLIFPPPYLRNTDAEIHSTRLPPANNPMPPPLHHTRSPQFAFSPP # PAPTNLERVHTAIPPPFALEPQPQWNDPIYTSMPRLGPTSRSHRGSEREPSISPTRTRTIEPLRAPSEHNPSRDGRYDPVRSTVVPYNPPTSPDASHH # EEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 Scaffold_7 AUGUSTUS gene 931078 932097 0.66 - . g209 Scaffold_7 AUGUSTUS transcript 931078 932097 0.66 - . g209.t1 Scaffold_7 AUGUSTUS stop_codon 931078 931080 . - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_7 AUGUSTUS CDS 931078 932097 0.66 - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_7 AUGUSTUS start_codon 932095 932097 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MPPEPTPAVEQTIVPSTSSTTSAPKRPPRFVDLHDSIQVHLRSERSERTRKAPPLRIKGQASLSSLSSEAHGVSSLSI # KGQGTPSLSSQSNPPSLLSRLSDTYLGEDTNPVNSNPVTTALSSPSMSIDSRHASKPRMCDQNEGPLTREVPEKPRTNPFSPERTSTINVLSGLQDTQ # SRGRDNRTMTNNMKNSVFLPKFDTNEGSSRASAFLTRGFRSTSNDLGGPNDNPHVDPGFTYEPRINDEALGSNPRPSSLPVDGSHTTVSTYSMRLFHK # LEEEKRRLQDNISATLSNSEDSGDVVVGKHSVVATDPQAIEANLRARAQLKMRLASEKRASELPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 Scaffold_7 AUGUSTUS gene 937856 938466 0.44 + . g210 Scaffold_7 AUGUSTUS transcript 937856 938466 0.44 + . g210.t1 Scaffold_7 AUGUSTUS start_codon 937856 937858 . + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_7 AUGUSTUS CDS 937856 938102 0.44 + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_7 AUGUSTUS CDS 938159 938466 0.91 + 2 transcript_id "g210.t1"; gene_id "g210"; Scaffold_7 AUGUSTUS stop_codon 938464 938466 . + 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MDFSLVRNAMYDCTEYYQCKSVAFAKLPTISELLSSPSEQACTTDSCICTTTNADEMESCVNCLVSIDPTADMIEEGN # EILLSLEVECDTVSGFPSLSVSASTTISDDTSSVTALEGSSVSSKSTVTQKSTATGTSTTTSSADSESTSDSGIKGLNGAVSYKGSMATVVFGALGCI # VGAGLLGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 Scaffold_7 AUGUSTUS gene 939451 940050 0.89 + . g211 Scaffold_7 AUGUSTUS transcript 939451 940050 0.89 + . g211.t1 Scaffold_7 AUGUSTUS start_codon 939451 939453 . + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_7 AUGUSTUS CDS 939451 940050 0.89 + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_7 AUGUSTUS stop_codon 940048 940050 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MEQWPGWYIAELNLQAQSITSFLSPDSSPPPTPQLESPGFDSDSDSNRSYELYNDDSRLTLKVDPDTCTDYGSDSPVF # RAFVVRDRDDYGKECRRSSGSFSMNENKGIAFHDPKTPIALKFALREDLLDDVAQEAEIYEGALCSLQGDIVPQCYGFFTGIGSEGQRIACLVLEYWG # ESLQVPFRKLPIDVRYVVLHHTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 Scaffold_7 AUGUSTUS gene 951526 952226 0.47 - . g212 Scaffold_7 AUGUSTUS transcript 951526 952226 0.47 - . g212.t1 Scaffold_7 AUGUSTUS stop_codon 951526 951528 . - 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_7 AUGUSTUS CDS 951526 951659 0.66 - 2 transcript_id "g212.t1"; gene_id "g212"; Scaffold_7 AUGUSTUS CDS 951787 952122 0.82 - 2 transcript_id "g212.t1"; gene_id "g212"; Scaffold_7 AUGUSTUS CDS 952208 952226 0.67 - 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_7 AUGUSTUS start_codon 952224 952226 . - 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MHMNYFPPQYSIRAALYNAGHGVWKPFLDITPEDVKIITETNVEGSFAFAHEVLSDFKKNEIDPANGKRGILIFTGAT # ASIRGNTTTSAFAAGKFALRALSQSLAKEFGKQNIHVAHVCISTPLSRSRRNNPEWEQNEDVRLSPEAIASVRSLTVPLKQFLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 Scaffold_7 AUGUSTUS gene 954421 955165 0.23 + . g213 Scaffold_7 AUGUSTUS transcript 954421 955165 0.23 + . g213.t1 Scaffold_7 AUGUSTUS start_codon 954421 954423 . + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_7 AUGUSTUS CDS 954421 954614 0.29 + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_7 AUGUSTUS CDS 954685 955165 0.41 + 1 transcript_id "g213.t1"; gene_id "g213"; Scaffold_7 AUGUSTUS stop_codon 955163 955165 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MVQRLSGGDTSLLAEMHATTSGLKILCTTSSVQDVENARRSMGGHGYSAFSGVGRLYADVIPSVTYEGENFVLDQQVV # RAALKAFHSLFGTEGKGRPSPSTVGGLTASSYYLRLLSSPTKEPPFLEDGDGSKSSWNDFETLILLLEWRAALLVHEMAQTAHDPDATLFQRVSRGTT # EAFVGRRVGEMINDFRKNSELQESDVAVLSRLYLLVWSRVLVWSVIAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 Scaffold_7 AUGUSTUS gene 959754 960245 0.92 - . g214 Scaffold_7 AUGUSTUS transcript 959754 960245 0.92 - . g214.t1 Scaffold_7 AUGUSTUS stop_codon 959754 959756 . - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_7 AUGUSTUS CDS 959754 960245 0.92 - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_7 AUGUSTUS start_codon 960243 960245 . - 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MRRSEDKSFKGSVFVEFTEPAGAEALLKAEPKPKWDGEDLLIMSKEAYCEMKIKEKGLTGRNAERKRDTMNKRNFNAF # TIPISQGGLMKYKAVEDGKPKREIWLEFMGKKLLIERDEDGNGRVKEEEVPFLKGSTLKFEGVGENFSWNDIKVYNISTLHLRDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 Scaffold_7 AUGUSTUS gene 962331 963232 0.56 - . g215 Scaffold_7 AUGUSTUS transcript 962331 963232 0.56 - . g215.t1 Scaffold_7 AUGUSTUS stop_codon 962331 962333 . - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_7 AUGUSTUS CDS 962331 963127 1 - 2 transcript_id "g215.t1"; gene_id "g215"; Scaffold_7 AUGUSTUS CDS 963205 963232 0.56 - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_7 AUGUSTUS start_codon 963230 963232 . - 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MSLLHNTLFFRAYPQQTNSPTATVASSSTVTAVLSTIDLGGFNLGGETIPGFEQEFTTISVVGISSRTGSDGKSATTY # SREIIISDAILTTATDGSLIPNTAVPGNVITEIGEYYTSKIHEEGLSIHVETFVENVSGYYVTDAETITTGSTYEIQGNYETCSFAGPGAVSAGCSDS # DYLVEMPTDGGSTTTVYHSGQFSDPVSATTMTLPVQVVASPQALSSGSNSETTVKPQASGSGSDSGNTNDGVSLGIGGKYSMTRVCLLSFLAFLAGRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 Scaffold_7 AUGUSTUS gene 977404 977907 0.48 - . g216 Scaffold_7 AUGUSTUS transcript 977404 977907 0.48 - . g216.t1 Scaffold_7 AUGUSTUS stop_codon 977404 977406 . - 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_7 AUGUSTUS CDS 977404 977907 0.48 - 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_7 AUGUSTUS start_codon 977905 977907 . - 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MQVIPVASEIVSRHNGGSSSSSALLPLIKYSFATGGPASSVINQEGNTLAAKAVDVALYRTFGILGSPTNSFTGTKEQ # GETSNEDRLEFTVPAAPAQVHSSTLEQWNKWRWTPNCPCTGKVWYNGMNVVQVDWTDQRRRNSRKVSVNYLSESLTESVDAMRAKYPST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 Scaffold_7 AUGUSTUS gene 985919 986254 0.66 + . g217 Scaffold_7 AUGUSTUS transcript 985919 986254 0.66 + . g217.t1 Scaffold_7 AUGUSTUS start_codon 985919 985921 . + 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_7 AUGUSTUS CDS 985919 986254 0.66 + 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_7 AUGUSTUS stop_codon 986252 986254 . + 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MDHTSLAESYAHAHPPTDKRAIGFDPALQYVSTTGQHAFVPPGPGDFRGPCPGLNAMANQLRLRVVPLIATNGLMLGS # GYIPHNGIATIDQLVNGSYTGTLFSILDVSYLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 Scaffold_7 AUGUSTUS gene 1000195 1000632 0.57 + . g218 Scaffold_7 AUGUSTUS transcript 1000195 1000632 0.57 + . g218.t1 Scaffold_7 AUGUSTUS start_codon 1000195 1000197 . + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_7 AUGUSTUS CDS 1000195 1000632 0.57 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_7 AUGUSTUS stop_codon 1000630 1000632 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MTSTAFTRHLFPVIPFSRLLDPTRHQDLCLHASVRSVHSSYVVLDKSFPERGVPTPELRFDYLVYALGSRLPAPLDLW # GSSPESGRASHKDAVVFKPYAGTKQEGISWLKTHQEVIKSSDSILVVGGGALGIRESFVYPVSHSVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 Scaffold_7 AUGUSTUS gene 1000823 1001522 0.71 + . g219 Scaffold_7 AUGUSTUS transcript 1000823 1001522 0.71 + . g219.t1 Scaffold_7 AUGUSTUS start_codon 1000823 1000825 . + 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_7 AUGUSTUS CDS 1000823 1000975 0.94 + 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_7 AUGUSTUS CDS 1001139 1001522 0.75 + 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_7 AUGUSTUS stop_codon 1001520 1001522 . + 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MDTLLASNIQVILGERLDMQSILFDDAINLNKLGQRVARTLQGREVAADLILGVVLSTSPPTLSNFTSESSTPSPSWS # ASTSTSSTSSLLSPEQELENALAQVALVEKNVGIEEPLSGLSISEEDDDVLDSNLDGEDGAELSTPYPNIFVAGDAADAFGAIPAGHTAYYQVILDLA # FL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 Scaffold_7 AUGUSTUS gene 1002237 1002740 0.9 - . g220 Scaffold_7 AUGUSTUS transcript 1002237 1002740 0.9 - . g220.t1 Scaffold_7 AUGUSTUS stop_codon 1002237 1002239 . - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_7 AUGUSTUS CDS 1002237 1002740 0.9 - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_7 AUGUSTUS start_codon 1002738 1002740 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MLNFDPVHNLARRRWKKLLPIAVYIKDKEPSSNDWALVFDNEWVSKAWKPDDEEANQPLRGYSAPYYEDRYPAKNLIT # LPRLFLRTDGTDPGPLLEKFWDVKVEEDEASFVKNVLEFCQNENLLQGNLDDFRELYAKRVAASKQNNQERKKSRLFRKERKGKPDTVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 Scaffold_7 AUGUSTUS gene 1006574 1006972 1 + . g221 Scaffold_7 AUGUSTUS transcript 1006574 1006972 1 + . g221.t1 Scaffold_7 AUGUSTUS start_codon 1006574 1006576 . + 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_7 AUGUSTUS CDS 1006574 1006972 1 + 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_7 AUGUSTUS stop_codon 1006970 1006972 . + 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MAISLTASYLERIQQDSGVSFHQAQVALARQWLGSQATSATDSGPVKVTIKSPEVTKEGVVITEKTPVKEEAVAVPET # EEEAKQIIRRFERAAEAVRGDEDVSDNVVQHMLSDKTGLEQEKWLGSEQEEFDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 Scaffold_7 AUGUSTUS gene 1013359 1013586 0.62 + . g222 Scaffold_7 AUGUSTUS transcript 1013359 1013586 0.62 + . g222.t1 Scaffold_7 AUGUSTUS start_codon 1013359 1013361 . + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_7 AUGUSTUS CDS 1013359 1013586 0.62 + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_7 AUGUSTUS stop_codon 1013584 1013586 . + 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MHFTFTTDPDDKSSGWTSLKLGHICSSWRNVAIATQDSQDVWSYIRIPNYVPEDEWENWDWEDKAEDILPLIKLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 Scaffold_7 AUGUSTUS gene 1020926 1021351 0.89 - . g223 Scaffold_7 AUGUSTUS transcript 1020926 1021351 0.89 - . g223.t1 Scaffold_7 AUGUSTUS stop_codon 1020926 1020928 . - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_7 AUGUSTUS CDS 1020926 1021351 0.89 - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_7 AUGUSTUS start_codon 1021349 1021351 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MFPITSTLPSLPMTLDDQLPAVPNFDQRMVLWDRYLQVYLEALLNGTPLEPVRRILDDPLHDKSHPPAVDTSLPHGGV # EPTDVASDGSYVKNLSTSCGGPVPGSPDENIATASSSSVSIVDGPIEEKTVDLSSDNGSLFTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 Scaffold_7 AUGUSTUS gene 1022449 1023678 0.61 - . g224 Scaffold_7 AUGUSTUS transcript 1022449 1023678 0.61 - . g224.t1 Scaffold_7 AUGUSTUS stop_codon 1022449 1022451 . - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_7 AUGUSTUS CDS 1022449 1023678 0.61 - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_7 AUGUSTUS start_codon 1023676 1023678 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MQDPIILLLLFKLYEYSGIQRETDYATKSDEPSSSILSSFHKVFVNGVPLADYVKEDPHWNLLLDIATPCMECEHKRI # ECTVPAKYPRCEPCGSSNCSISRLARHRAFARQHGKDLAFSRKFLDEHGATKKDSYTIPLNYWRTYDSLLRKRNHPPEISAEFRIFEQNEDLTTEETS # PDPHINESSAQLLSKPSKEKKKVPKRLTEEATPKDTKKGKGWAEETTAKNTKKGKKRSAEESVPPDTNKAKRRLTEESLSKDDETGKGRSAEEALPKD # NKKGKGRAVNESIRKDHDTAKRRLVETPPIPARLRAQTKSLSPSDLLDLTPRARSISPLHDRPLKRPRLDPNLNSRETAHDPPSKDVYSSLYRPMVTP # IKKLGSTSAETESRPVKIPSSSTMNMVCATLVAHLSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 Scaffold_7 AUGUSTUS gene 1048759 1049301 0.41 - . g225 Scaffold_7 AUGUSTUS transcript 1048759 1049301 0.41 - . g225.t1 Scaffold_7 AUGUSTUS stop_codon 1048759 1048761 . - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_7 AUGUSTUS CDS 1048759 1049301 0.41 - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_7 AUGUSTUS start_codon 1049299 1049301 . - 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MARSPVPGGREDHARYSFKKLTAINKQDPHPISEASEWADHLPDVKPSQTSSPSPYPPNPTDPSPEANAEISEQNGQN # AMQDLQSSHSPIASAPQPPPHFPSPGEAFPPLPHPTPAAPATLHIDNLTTSALTQGLAGDSGDMKDLNEGRDIGIEVEGVQEIDATGDTAELDKGACS # MNNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 Scaffold_7 AUGUSTUS gene 1053520 1054215 0.89 + . g226 Scaffold_7 AUGUSTUS transcript 1053520 1054215 0.89 + . g226.t1 Scaffold_7 AUGUSTUS start_codon 1053520 1053522 . + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_7 AUGUSTUS CDS 1053520 1054215 0.89 + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_7 AUGUSTUS stop_codon 1054213 1054215 . + 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MSQAPSATQAPTGAPTAPAPTAPAPTPLSNDWSRDPDCFLVCRHTCPHPRANQPGGTLRWAFSFVRNVSTRGNEHTKS # GKHPNCSQACPEFGLSRRGIEGLRDATIAEKYRATIMYSQAFHSSEVKNKAMLQWYERVQEGNVFHGAWLGLFNSAPTFPKFADSAFSDGALGPPSTA # AWAQFPRQYEDIPTQFNQNIRHFDLQAAKAGLPAFGPGTQISTPHLFFLLPVRPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 Scaffold_7 AUGUSTUS gene 1056789 1057175 0.7 + . g227 Scaffold_7 AUGUSTUS transcript 1056789 1057175 0.7 + . g227.t1 Scaffold_7 AUGUSTUS start_codon 1056789 1056791 . + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_7 AUGUSTUS CDS 1056789 1056804 0.71 + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_7 AUGUSTUS CDS 1056901 1057175 0.73 + 2 transcript_id "g227.t1"; gene_id "g227"; Scaffold_7 AUGUSTUS stop_codon 1057173 1057175 . + 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MILNAYFNFAFDFKVELDFDFDFAFDFKVELDFLDFDFDFDFDFDFDFAFDFKVELDFDFDFDFKVELDFDFDFDFKV # ELDFDFDFDFDFKVECGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 Scaffold_7 AUGUSTUS gene 1064032 1065048 0.47 + . g228 Scaffold_7 AUGUSTUS transcript 1064032 1065048 0.47 + . g228.t1 Scaffold_7 AUGUSTUS start_codon 1064032 1064034 . + 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_7 AUGUSTUS CDS 1064032 1065048 0.47 + 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_7 AUGUSTUS stop_codon 1065046 1065048 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MSQLERGEQKRAGSNEDNVNEKTDSNIEIELAHGLSTLPNSIDETTKTTVSALSEADNNPFFIPNLTFTPSEESKVIR # ILDTRLFPWVLLTTFVLNMDRTNLSNAISDNLPKDLGFTTNTVNLGTAIYSVLFSLACLGGAVVCKIVHPARCEFNFSPGCGKFNANLSFLGIPFCMF # CWGLVTMSHALIKDKGGYLTGKAFISLTIPLNLNLSPLMPVRCSEFPLPSLVLSLLLTYLPSIRVVIAVTEGGVIPATLIYLGSFYRSTELATRLAWF # WGIQTIASAVSGLMASGLLQLQGVSGLEGWKWLFLVDGIITVVVAVLSWYVSGFLDSSFGMNQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 Scaffold_7 AUGUSTUS gene 1066734 1067834 0.71 + . g229 Scaffold_7 AUGUSTUS transcript 1066734 1067834 0.71 + . g229.t1 Scaffold_7 AUGUSTUS start_codon 1066734 1066736 . + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_7 AUGUSTUS CDS 1066734 1067239 0.71 + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_7 AUGUSTUS CDS 1067306 1067834 1 + 1 transcript_id "g229.t1"; gene_id "g229"; Scaffold_7 AUGUSTUS stop_codon 1067832 1067834 . + 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MPVSRSTTTTPATQTPQPSQVSIGKKPMTYNQTQQAQQQAAQGQPGQPGQPGQPRSARAASKAPMNPNQNQSYSNNHH # PSGGNSNSSSTNSKGRPPATSANGTKNTSAHNSKIWSTSSVEERERIKEFWLGLGEEERRNLVKIEKDTVLRKMKEQQKHSCSCAVCGRKRNAIEEEL # EVLYDAYYEELEQYANYQQRYVSSGGTIPPPPGPGPFPGSVELDKNGAVVGHPGHPQHVAPHNHRPNNANAKAVRGGKAQAQPQRTNIPVNGRGKPGK # HPPPESEFDDADDDPNVDPDADLDDDEYEEEDDDGEDYEEEDEEDEEEDPDPDPDDEELSPNPNLPAHPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 Scaffold_7 AUGUSTUS gene 1068433 1068885 0.41 + . g230 Scaffold_7 AUGUSTUS transcript 1068433 1068885 0.41 + . g230.t1 Scaffold_7 AUGUSTUS start_codon 1068433 1068435 . + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_7 AUGUSTUS CDS 1068433 1068885 0.41 + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_7 AUGUSTUS stop_codon 1068883 1068885 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MEQLAERRMQREEEAVGDLEDDSEDEEDEDDEDGGEDEEGLGSEDDDEDLDRRRRRRRQRDVEDEGSDDEEDEEDEEE # EEDEEDEEDEEEEVSAVPSVGGVIYDRSHSLAPLAGFEEAVLDFCAHAMPPMLFHPLRSLTAFNFTFFTHRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 Scaffold_7 AUGUSTUS gene 1070586 1071230 0.29 + . g231 Scaffold_7 AUGUSTUS transcript 1070586 1071230 0.29 + . g231.t1 Scaffold_7 AUGUSTUS start_codon 1070586 1070588 . + 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_7 AUGUSTUS CDS 1070586 1071230 0.29 + 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_7 AUGUSTUS stop_codon 1071228 1071230 . + 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MSLNHPELSGPGPITRPMGSIAPIGSGAPVTPIAPIARPSAIINTSSTSTSESAIAGPSNSLPSSGSGSPVRNSPHPR # RTSSPKGVLGSSALAADDDEVVPVNKGRRPGNVNVGQGWGPTSPSRAGAIGGGAIDRGLWGPPAPVNVGMNIHNPLVSPIGGFVNAPRSAGLWGSGLV # PPSAPEWHQPYPNSFIGQAQAQVHTGASNTTPPPQSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 Scaffold_7 AUGUSTUS gene 1075485 1077557 0.95 - . g232 Scaffold_7 AUGUSTUS transcript 1075485 1077557 0.95 - . g232.t1 Scaffold_7 AUGUSTUS stop_codon 1075485 1075487 . - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_7 AUGUSTUS CDS 1075485 1077557 0.95 - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_7 AUGUSTUS start_codon 1077555 1077557 . - 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MSGRGNNANVSNALAASQHTFGAQGQYNSTPGVTASHFNGSSSAITSAPGLNDMGYLTHPPSQLQQHTYASFPLPHPP # QTPYQQQYNPLAPPPGSIPASGPLQPLPPEAQPAWPGSRIVGASTTGVIEAPSSVGGRRSESPTGTRSDDDDPRSDLARPSDPATVGGEDVHEGNELG # MRMDIDDPLRNNENASDNDEELDEGRPSSSSGGRLTRIGRRRSGSTRESPSKDKDREEKRKSKDSPKLRSKPSSVSNINSSSTRRELKRARTDSYQQP # QYHQPIAPAPWAPAPHPPFSTSTSSSISTSNNVSSAPAASGSNSSIIGGSGVPTTVIDPSLNGASIGGLPPGVRIPPPPGAIIAPGAPNNVTGGSRSS # TPVPLGVNSSIASVSRIAPPPGATIESSSTSLTTAGKASGSSNATNASGSTGITQIDTNIVDPPVQRSGSPGGPSASSSYHHQQLPFEQSHAQPPMSG # PPPPAYSVQVQPPQLAPLHQGNSSQYPSHISHPSQQQTAPHQHPLPLPLPHSHSLPGPTPYSPYRQPPIPSHPQYGYSAPPHATYNAVPPPPPPMAPP # TPQGYAGYPAWGVNSGQHQQHQQIIPQEQYQQPMSMQQLQYQQPGYGYPLPPHTQVRPYDYGQPQPQTQHMYTTYVPPYGYYDAAQQQPGAPPQQLQQ # NPFHAGAYGTVGTPSECYYRRTYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 Scaffold_7 AUGUSTUS gene 1090030 1090356 0.96 - . g233 Scaffold_7 AUGUSTUS transcript 1090030 1090356 0.96 - . g233.t1 Scaffold_7 AUGUSTUS stop_codon 1090030 1090032 . - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_7 AUGUSTUS CDS 1090030 1090356 0.96 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_7 AUGUSTUS start_codon 1090354 1090356 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MSANHTQTTTTTSTAGPSMSRPIPPAPANPANHEDNEEEILRRVQEWVRRVRARKAAEAAKRKAKEEAARAAEVRKKA # AQKWALRAQQQEEEAVGHRGDSKESEGYLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 Scaffold_7 AUGUSTUS gene 1098484 1099467 0.92 + . g234 Scaffold_7 AUGUSTUS transcript 1098484 1099467 0.92 + . g234.t1 Scaffold_7 AUGUSTUS start_codon 1098484 1098486 . + 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_7 AUGUSTUS CDS 1098484 1099467 0.92 + 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_7 AUGUSTUS stop_codon 1099465 1099467 . + 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MVDTDNAKSKREFKKLSKNMGDRLDREKGRNISELSAPDFKHSHSTDLIRQKAVERERSREEAAQEDAAAVANGTGVG # GVGGPGTRTIKRMQFTFSVNEDQHSASSSIGFQPGNGTGSYHNSDSGSAGYTAQPMHVDKPDLKPSAEFSVGKRARGAGFGAGTASVKHSTNAASSVS # STSTDAATVAAKPNDHAHEQMDVSGDAQLTLTQRGRKTSSTSSSNASRNNTFTNTRDAGTLPTTIRFPPLFSSDFGPAALLYPSPTLTTHMNYGEDLG # LTYPHSYDSNDRNDLHSNSNPNLKSTMVVAILIIPIAHLTFLDQRLSFRLMSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 Scaffold_7 AUGUSTUS gene 1099678 1101058 0.62 + . g235 Scaffold_7 AUGUSTUS transcript 1099678 1101058 0.62 + . g235.t1 Scaffold_7 AUGUSTUS start_codon 1099678 1099680 . + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_7 AUGUSTUS CDS 1099678 1100640 0.93 + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_7 AUGUSTUS CDS 1100723 1101058 0.62 + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_7 AUGUSTUS stop_codon 1101056 1101058 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MLLKSTTTASSSTPPLFSTTSLVPPSKNNNANDFYGEDESQDVEMFDHSSSAYDHLNHLYDDNPNNEHISSFDYDLNS # AEPIQIPITTVSGNSLHALFGDSPGGRSDGRLLTPFEETLSFSGQHGHLSRHNSHTSSSSHHTHLSNHEDDAESSVDVDVESDNSDSESDSSESVELM # SSTTMTTSSSAQRSTEFVYSGAGSIGGVKKKLSGIKLTLNPNKSKSLSQRRSTTPRPSSSTGGGGRVAAGGLSVSSKPSASSRPYNRPTPRANARATP # RPSARQTPRAGVRNTHNSNNTTPRSSAAASRAASSRPALTVRTSSSGRSGSGSGSVGFGFLDSAPVSAFKVEDEGQGQNSHVGNNVTNSTFSSTTSTP # PASITTAGATPAPPPPLSSTPRGPRLRPRRPLRPPLVHLPVRKLNAPTAEQHIHRYGEEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 Scaffold_7 AUGUSTUS gene 1101720 1102665 0.34 + . g236 Scaffold_7 AUGUSTUS transcript 1101720 1102665 0.34 + . g236.t1 Scaffold_7 AUGUSTUS start_codon 1101720 1101722 . + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_7 AUGUSTUS CDS 1101720 1101843 0.34 + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_7 AUGUSTUS CDS 1101935 1102665 1 + 2 transcript_id "g236.t1"; gene_id "g236"; Scaffold_7 AUGUSTUS stop_codon 1102663 1102665 . + 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MKSDVIRKRSRHDAHAPHAAHSAAIPANRRGSLSGGGYGYGALGRDNESPSPVREPSPVNSVHSVTSATSSTHSTHSV # HSPTFVPDSSTAADVPELSGMGYGQSELMGVFGSPRNHNHNQKSTTTTNTTIEVSRGRARARGRAGSLNALTALDAFGNAKTDGSNSSKNHRSSHSED # GHLDHMEHSDNDSINNSNNSNSFNSSNSGHTDDRNNANSDHQHNGEDNADHEHTDDPNADYQNTFTLPFPGPYHPDHLSQYSSYYDTVGGLNGFGGFW # YEWNKWDEQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 Scaffold_7 AUGUSTUS gene 1102996 1103970 0.89 + . g237 Scaffold_7 AUGUSTUS transcript 1102996 1103970 0.89 + . g237.t1 Scaffold_7 AUGUSTUS start_codon 1102996 1102998 . + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_7 AUGUSTUS CDS 1102996 1103970 0.89 + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_7 AUGUSTUS stop_codon 1103968 1103970 . + 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MSSDSASEPPSSAISSLSSSYSSAFEIENGGYSSSASHSHSHRSSISSLSSLSSMSSMNDFSFSGNAYTGNKGIHNNG # SRGSTTNGGYNENNNSENPGSSGNGNGNSTQKRLLASADVVAGASIPCPQLQNGQNYNGHGSHSGRSHSGHSGHSGHNGHSSHSQNGLNQHTPMSSFT # NAFNNYNAFSSNHHAFHPPMLLPSTVTSTEDSPMDYLHPPMMLADDVDEATLFSTYLHPPMSLPEDSGSLSSGIRANRETTGSGNVNSEGNANGNRSS # NDLGANDASAKGVSVSDMNSKAVKVEGSDLDSGKTNANNNRYYGMDMRIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 Scaffold_7 AUGUSTUS gene 1105504 1106983 0.49 + . g238 Scaffold_7 AUGUSTUS transcript 1105504 1106983 0.49 + . g238.t1 Scaffold_7 AUGUSTUS start_codon 1105504 1105506 . + 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_7 AUGUSTUS CDS 1105504 1105984 0.49 + 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_7 AUGUSTUS CDS 1106043 1106983 0.54 + 2 transcript_id "g238.t1"; gene_id "g238"; Scaffold_7 AUGUSTUS stop_codon 1106981 1106983 . + 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MPVHTNKPGYFGKGSVEIGPAAGPGEGPIRRIAISSESLITQPFEGIKTVYDVLEYAARTHGTRRALGWRDIVDIHEE # EKEVKKVVGGKEVTEKKKWKYFQLSDYKYINFIELKDAVSEIARGLVEIGVTSDDVFNIFSQTRSVEQTFYALCLPLINLLQSYDTLGESGLTHSLNE # PECVGLFTNAELLPTLYKVLANTPSIKFVVYDGEPSENLVGDINAVRESIQVFSIDEIRELGKSKPTEPLRARLPKPETMACIMYTSGSTGPPKGVCI # THANLVASIGAVYKLLGHHLTYDDTYLAYLPLAHVLEYIVELIMLFVGMTSGYGRVKTLTDASVRRCKGDLAAFQPSIMVGVPAVWETIRKGIVAKVN # AGGTVRKSVFNGAMSLKKNGVPVLSQVADSVVLKNVRAATGGRLRITLSGGAALSHETQKFLDTALVMILQGNAHVTLSLRPHSFTHWRSFVSVPKRV # RDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 Scaffold_7 AUGUSTUS gene 1113507 1115291 0.42 - . g239 Scaffold_7 AUGUSTUS transcript 1113507 1115291 0.42 - . g239.t1 Scaffold_7 AUGUSTUS stop_codon 1113507 1113509 . - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_7 AUGUSTUS CDS 1113507 1115291 0.42 - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_7 AUGUSTUS start_codon 1115289 1115291 . - 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVH # HVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHD # HPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPC # TSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVI # NSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLG # DRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSW # EPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 Scaffold_7 AUGUSTUS gene 1115787 1117220 0.89 - . g240 Scaffold_7 AUGUSTUS transcript 1115787 1117220 0.89 - . g240.t1 Scaffold_7 AUGUSTUS stop_codon 1115787 1115789 . - 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_7 AUGUSTUS CDS 1115787 1117220 0.89 - 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_7 AUGUSTUS start_codon 1117218 1117220 . - 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 Scaffold_7 AUGUSTUS gene 1117271 1118437 0.88 - . g241 Scaffold_7 AUGUSTUS transcript 1117271 1118437 0.88 - . g241.t1 Scaffold_7 AUGUSTUS stop_codon 1117271 1117273 . - 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_7 AUGUSTUS CDS 1117271 1118437 0.88 - 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_7 AUGUSTUS start_codon 1118435 1118437 . - 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 Scaffold_7 AUGUSTUS gene 1126194 1127928 0.43 + . g242 Scaffold_7 AUGUSTUS transcript 1126194 1127928 0.43 + . g242.t1 Scaffold_7 AUGUSTUS start_codon 1126194 1126196 . + 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_7 AUGUSTUS CDS 1126194 1126245 0.43 + 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_7 AUGUSTUS CDS 1126778 1127928 0.96 + 2 transcript_id "g242.t1"; gene_id "g242"; Scaffold_7 AUGUSTUS stop_codon 1127926 1127928 . + 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MFTRSPDVPLSTSHTYLTSTTPTTQYRTVPHSSLTSLRLRDLPGPPRNPLKGHHLVAPTTIRSFSSSVAVLVAPFELQ # PAPSTLQHKPPYTKTYPKTYFDPGLTEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSKVAARAAGRSSTAPTVPPLPHT # IPAEYAEFADVFDEIAADALPEQRPYSLKIDLEEGALLPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHSTPVLFIPKKDGKLRLCVDFCGLN # RITKKDHYPLPLISDLLDAPKRAKIYTKLDLAHTYHLVRIAEGDEWKITFRARYGSYEWKVMPFGLTNAPAAFQCFVNNIFSDMLDVCVIVYLDKHSD # LLQYAGGTLRTRQGSSSAVTETPALHQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 Scaffold_7 AUGUSTUS gene 1135832 1137699 0.36 - . g243 Scaffold_7 AUGUSTUS transcript 1135832 1137699 0.36 - . g243.t1 Scaffold_7 AUGUSTUS stop_codon 1135832 1135834 . - 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_7 AUGUSTUS CDS 1135832 1137548 0.48 - 1 transcript_id "g243.t1"; gene_id "g243"; Scaffold_7 AUGUSTUS CDS 1137662 1137699 0.38 - 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_7 AUGUSTUS start_codon 1137697 1137699 . - 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MTFPLENGGGILSDKTQITLFRNKSAYPVYLTIGNLPKEIRRKPSQQGQILLAYLPTSRLEHIKNKAARRRTIANLFH # ACMKDLSAPLTEAGLEGVIMKSGDGIQRRCHPILAAYVGDYPEQILVTTAYSGDCPCCETEKEDLGIYPCARPSRDIGAVLEAVHTTTPDLWVKKCLE # CNIKPVQHPFWEDLPYANIFASITPDILHQLYQGVMKHLISWVTSVCGADEIDARVRCLPPNHTMRIFHKGISTLSRVSGTEHKQICSFIIGVITDIP # HLSAHQSNSLLAATRALLDFLYLSRYPIHTMESLSQLDEALASFHAHREVFVELGVRKDFNIPKLHFLCHYSRAITYYGTTDNYNTETTERLHIDFAK # NAYRASNRKDEYVQMTRWLERREKIMYHTNYISWRLAEASLPSNHNTTSIPNTITSHIHQRYDFPGAQRTLVDMMCSFTQKVTHFPTVKHVLLSRLED # ICANGYCAVQFTHALKCFVVQFRYPDIPPNQIDDWAQFVVLPFTSLPVWHKIKYVNTELFGKKTLDSFSAHPSVSKPSGQLVKSSRFDTVLVKLKVGD # NWAKGTNSSYHFIVYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 Scaffold_7 AUGUSTUS gene 1137974 1138753 0.59 - . g244 Scaffold_7 AUGUSTUS transcript 1137974 1138753 0.59 - . g244.t1 Scaffold_7 AUGUSTUS stop_codon 1137974 1137976 . - 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_7 AUGUSTUS CDS 1137974 1138753 0.59 - 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_7 AUGUSTUS start_codon 1138751 1138753 . - 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MSKSAGYSCRACQRTWKRNSDLTQHYMKTTNTICRKEADTVIAKLRTSRSAPRRSLLQRHRLPFYPSVNNKSAGPEDK # SEAEHDDESESATPFVGDFFGQDYAFEDFPGLADEDDDDDNEEEEAVITAESPWEPERPQRTCFSDTDTVDDSPTNIPQPANPLLHQLPSHRNDIYVQ # RFGGQAGAPLPTLQPSHFRNSRDGFEQYQASIADSDINMWAPFTSKVDWEMARWAKMRGPGSTAFSDLLAIDGVRCFPRSIHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 Scaffold_7 AUGUSTUS gene 1138907 1139762 0.53 + . g245 Scaffold_7 AUGUSTUS transcript 1138907 1139762 0.53 + . g245.t1 Scaffold_7 AUGUSTUS start_codon 1138907 1138909 . + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_7 AUGUSTUS CDS 1138907 1139422 0.53 + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_7 AUGUSTUS CDS 1139523 1139762 0.75 + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_7 AUGUSTUS stop_codon 1139760 1139762 . + 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MSSRRARCQSGGNKPIDTVVASTTINENPRETRSRKRKLTGSKPGKPCLNQWKHSQIHCDSLDNRELETEQPAKRLRG # SKKDTILASVSTPQFSRRQRNKNKNVLAPTPLDSAIQPMQATQEMPTPTPKPQRNARTKLSSTLRGNLALTGADTPKSRGRVAAQTPNQIRSKPQNYL # VLIHSCLGDLLFNQPHIRQEIKEAQEDDDSDQDSDLNGDIGDIDREVERQNDSEAAKHFNEEVPIHVLIFNGFSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 Scaffold_7 AUGUSTUS gene 1139871 1140575 0.81 + . g246 Scaffold_7 AUGUSTUS transcript 1139871 1140575 0.81 + . g246.t1 Scaffold_7 AUGUSTUS start_codon 1139871 1139873 . + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_7 AUGUSTUS CDS 1139871 1140575 0.81 + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_7 AUGUSTUS stop_codon 1140573 1140575 . + 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MRAWLMTEVDKLKLEKTLRKALSSSEDDVPKPAPVTKVRNLYYSDLPTHCSLTVKKVQRMAAKLAVEVRIFHPLVSSL # KIFQLPVVSTNDVDMPTPTSTLPQFRSAEPAWLPHTNLILKPSTDATWSYRLDLKAQNAQVRSVVKAARSRATLELVTNGEECGLQTSGLNAITLGAL # IQCADELGFDEDLDLSHRLEEGDHTTYARPLIKYVSNNTHRYPSLLIPNFAGCTAGYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 Scaffold_7 AUGUSTUS gene 1140851 1141507 0.81 + . g247 Scaffold_7 AUGUSTUS transcript 1140851 1141507 0.81 + . g247.t1 Scaffold_7 AUGUSTUS start_codon 1140851 1140853 . + 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_7 AUGUSTUS CDS 1140851 1141507 0.81 + 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_7 AUGUSTUS stop_codon 1141505 1141507 . + 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MSRKASIFVSSLPHKPLELELPKAMVAMASCVVRALFVYDNVLVLILLEIHSILQDHAKFTEENFPPTGLHSQWSTFM # AILTNLETASKVNYHKLMHKLYLQSSYVFSSCSYSNSLILFSRTVAPTEHGLSQDQILQRINLTAFAANGGDNDSSSSSSESDPVHGSSNDGERTISL # SGDGMANNSLNGEGSANSTGSVSGQDDEFNEDKAGKETEVHA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 Scaffold_7 AUGUSTUS gene 1150303 1150614 0.5 + . g248 Scaffold_7 AUGUSTUS transcript 1150303 1150614 0.5 + . g248.t1 Scaffold_7 AUGUSTUS start_codon 1150303 1150305 . + 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_7 AUGUSTUS CDS 1150303 1150614 0.5 + 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_7 AUGUSTUS stop_codon 1150612 1150614 . + 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI # GNIPPPYLSLHPHPCQGYSDTAKKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 Scaffold_7 AUGUSTUS gene 1152605 1154707 0.39 + . g249 Scaffold_7 AUGUSTUS transcript 1152605 1154707 0.39 + . g249.t1 Scaffold_7 AUGUSTUS start_codon 1152605 1152607 . + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_7 AUGUSTUS CDS 1152605 1152927 0.39 + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_7 AUGUSTUS CDS 1153396 1154707 0.63 + 1 transcript_id "g249.t1"; gene_id "g249"; Scaffold_7 AUGUSTUS stop_codon 1154705 1154707 . + 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTP # MRRHKWKTPYEILYNKVPRIDHLRVFGCGATKLPTEQQVERPKRDIQRRAPQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRL # CREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVK # GFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYMK # TLGFKRLSSDAGIFIRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGKFMSHWECRDLGEAKEFLRMRINRHGKKIYIDQCAYLDKVLKRCGMENAK # MADTPLPAGFQPEPTKGQSNSALRSKFKWLLVPFSTLCWVHVPTSPLLLPSLHNMQLTHLKSTLTRHSIFAATS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 Scaffold_7 AUGUSTUS gene 1167596 1168024 0.47 - . g250 Scaffold_7 AUGUSTUS transcript 1167596 1168024 0.47 - . g250.t1 Scaffold_7 AUGUSTUS stop_codon 1167596 1167598 . - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_7 AUGUSTUS CDS 1167596 1168024 0.47 - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_7 AUGUSTUS start_codon 1168022 1168024 . - 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MDRSSKFSLETETLPLDDHSTHRVSLISSSNDKNSFRILASILFASIHQTYVLSHMTFPKLISLRSSVATWIICEISA # RPDEQMALRAELDDLAPFEASTGRRQITHSALQNAARLDSFIREVLRTKGDTLSTIRLTTVMST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 Scaffold_7 AUGUSTUS gene 1170673 1171170 0.31 + . g251 Scaffold_7 AUGUSTUS transcript 1170673 1171170 0.31 + . g251.t1 Scaffold_7 AUGUSTUS start_codon 1170673 1170675 . + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_7 AUGUSTUS CDS 1170673 1171170 0.31 + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_7 AUGUSTUS stop_codon 1171168 1171170 . + 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MQYNWLYTALPEPTSQSLAIWVSNTLTVRSCIIDCEKFVLEMNNQTLPYIHSDGHQQPSHFYLLLGEDNVHAVFMHGP # HTIMDGFRVLRGFNLILDWIAQPPQDENKVLAWGTEWQYLAAGPITATGGPRMDWDTIGIDLMEKTKKVWMNPIVGASLFTIQDMPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 Scaffold_7 AUGUSTUS gene 1172140 1173087 0.19 + . g252 Scaffold_7 AUGUSTUS transcript 1172140 1173087 0.19 + . g252.t1 Scaffold_7 AUGUSTUS start_codon 1172140 1172142 . + 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_7 AUGUSTUS CDS 1172140 1172673 0.19 + 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_7 AUGUSTUS CDS 1172776 1173087 0.88 + 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_7 AUGUSTUS stop_codon 1173085 1173087 . + 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MEPRRSGYGQLTPTTHHDTYPYIDPSQYNMTGRVIFISGATKGIGRAAALSFAKAGVSGIVIAGRSVDLLHTLEAEII # MTCKHYKRPAVKVLRAMIDICDSLTIESAMAKTREVFGHIDILVNSAATVDQPVPISASNSGDWSFTLDTNVTGTYHLIKAALLLMNQDSNAPPQMII # NLISKLALLRMTEMFQTDLEDTPVCVVGLHPGFVLTDATKELSEDIQAYLIDSPMLAADTMVWLARDRRPWLNGRYISCNWDMGELQKMKEEIVAQDK # MKFKMLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 Scaffold_7 AUGUSTUS gene 1177336 1177755 0.73 - . g253 Scaffold_7 AUGUSTUS transcript 1177336 1177755 0.73 - . g253.t1 Scaffold_7 AUGUSTUS stop_codon 1177336 1177338 . - 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_7 AUGUSTUS CDS 1177336 1177755 0.73 - 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_7 AUGUSTUS start_codon 1177753 1177755 . - 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MTCFILSVLVRIPFWAISAAIPALRPRKAWSYRRTLIFHTINGFMSTFFQVGFMYSIGEDPEAVAATSTASEVGFAWV # EPLEETEVVGEVAEAAKVNNVKTVKTAGYWYPPSMQPNGRHPAADEQVVLHIHSKLSYSLM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 Scaffold_7 AUGUSTUS gene 1180950 1181447 0.22 - . g254 Scaffold_7 AUGUSTUS transcript 1180950 1181447 0.22 - . g254.t1 Scaffold_7 AUGUSTUS stop_codon 1180950 1180952 . - 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_7 AUGUSTUS CDS 1180950 1181447 0.22 - 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_7 AUGUSTUS start_codon 1181445 1181447 . - 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MQYNWLYTALPEPTSQSLAIWVSNTLTVRSCIIDCEKFVLEMNNQTLPYIHSDGHQQPSHFYLLLGEDNVHAVFMHGP # HTIMDGFRVLRGFNLILDWIAQPPQDENKVLAWGTEWQYLAAGPITATGGPRMDWDTIGIDLMEKTKKVWMNPIVGASLFTIQDMPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 Scaffold_7 AUGUSTUS gene 1185229 1185582 0.33 - . g255 Scaffold_7 AUGUSTUS transcript 1185229 1185582 0.33 - . g255.t1 Scaffold_7 AUGUSTUS stop_codon 1185229 1185231 . - 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_7 AUGUSTUS CDS 1185229 1185582 0.33 - 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_7 AUGUSTUS start_codon 1185580 1185582 . - 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MLRTFLSSVNSWATACPSSSSRKSRNCELLLLNLSGAHVEPGAGMYAGPFMAAQGGGVDMNGMWVGMIGGGDSDKDNR # DDIEKGVVTREVNLLVSALFGVSATGCLTSASLSDLSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 Scaffold_7 AUGUSTUS gene 1200953 1201726 0.5 - . g256 Scaffold_7 AUGUSTUS transcript 1200953 1201726 0.5 - . g256.t1 Scaffold_7 AUGUSTUS stop_codon 1200953 1200955 . - 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_7 AUGUSTUS CDS 1200953 1201726 0.5 - 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_7 AUGUSTUS start_codon 1201724 1201726 . - 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MLNDFQSNLAWKLALVLKNIAPFSFLSSYNEERIPVIAQMIFATSQLYTHTVADKVVTNSSEVAKEDSEDSTKSGWLR # WRNTALEMYGINYRFSSIVLDERDDSPPDNQKALAHAYSGYEGSGTLNAGDRAPEAPGILREGQVTSLMSLFQHHLHTVLIFSNDYKEVQAVANVVQE # ISIIPNQAFIITKNSEHRLDNEEMSVLHDSEGHAHAAYLVNEPKDFVVVIIRPDSFIGGIVKEPEGVSRYFHNICSIGNRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 Scaffold_7 AUGUSTUS gene 1214755 1215513 0.45 - . g257 Scaffold_7 AUGUSTUS transcript 1214755 1215513 0.45 - . g257.t1 Scaffold_7 AUGUSTUS stop_codon 1214755 1214757 . - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_7 AUGUSTUS CDS 1214755 1215513 0.45 - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_7 AUGUSTUS start_codon 1215511 1215513 . - 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MLNDFQSNLAWKLALVLKNIAPFSFLSSYNEERIPVIAQMIFATSQLYTHTVADKVVTNSSEVAKEDSEDSTKSGWLR # WRNTALEMYGINYRFSSIVLDERDDSAPDNQKALAHAYSGYEGSGTLNAGDRAPEAPGILREGQVTSLMSLFQHHLHTVLIFSNDYKEVQAVANVMQE # ISIIPNQAFIITKNSEHRLDNEEMSVLHDSEGHAHAAYLVNEPKDFVVVIIRPDSFIGGIVKEPEGVSRYFHNIHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 Scaffold_7 AUGUSTUS gene 1222398 1225974 0.24 + . g258 Scaffold_7 AUGUSTUS transcript 1222398 1225974 0.24 + . g258.t1 Scaffold_7 AUGUSTUS start_codon 1222398 1222400 . + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_7 AUGUSTUS CDS 1222398 1223658 0.29 + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_7 AUGUSTUS CDS 1223805 1224195 0.49 + 2 transcript_id "g258.t1"; gene_id "g258"; Scaffold_7 AUGUSTUS CDS 1224378 1225974 0.78 + 1 transcript_id "g258.t1"; gene_id "g258"; Scaffold_7 AUGUSTUS stop_codon 1225972 1225974 . + 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPPNATSLHLHKKTRMAIKRARDIGVRATAEVIRTLEPAGHI # SELDSDDELDPPTKRTRAMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVA # KTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTV # LINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRR # MGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNPLPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWS # SPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTPYEILYNKVPRIDHLRVFGCGAASSLYATTRSQPDPKDP # IPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRA # PQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLK # ACQEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGV # LHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYMKTLGFKRLSSDAGIFIRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGKF # MSHWECRDLGEAKEFLRMRINRHGKKIYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPEPTIGQSNSALRSKFKWLLVPFSTLCWVHVPTSPLLLP # SLHNMQLTHLKSTLTRHSIFAATS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 Scaffold_7 AUGUSTUS gene 1255922 1257734 0.48 + . g259 Scaffold_7 AUGUSTUS transcript 1255922 1257734 0.48 + . g259.t1 Scaffold_7 AUGUSTUS start_codon 1255922 1255924 . + 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_7 AUGUSTUS CDS 1255922 1256962 0.48 + 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_7 AUGUSTUS CDS 1257153 1257734 0.57 + 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_7 AUGUSTUS stop_codon 1257732 1257734 . + 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MCNNTSSPLSQPCNRRLLHDSPQAHSKSKKSSKFPVRSYLHQDLKQWLAWMHNRKDLEPYLERPYSPLSPSEDKGVSD # IWESDFLRNFRGPDGDQRFLSPDNTNENRLVFTLNEDGFNPYGNQIAGKKVSVGGIYMVCLNLPPSLRYKPENIFLVGIIPGPKEPSGHQINYLLRPL # VDELEQLWKEGIHISRTRLHPRGRSIRAALIAVVCDMPAARLLGGFAHYAKDSDSCSMCETHDRNNLDPDSFVPRTDVKHRKLAAAWLSADSEEERHA # LYQENGVRWSELLRLEYLDLVQNTVIDPMHGFYLRIFQRHCRDIWGMDVDLVDCDGFWEIELPTEEERTTAIHRQWPTPPESFGSSDQNPPTSGPVAT # ETALQDCSPLPDATSTSVSHLSSRTGHNLPPVVSDAPLDALGKARLAYRQQKPKSYLSKKFSVDTLLLLAKELEIGPILTPKGRISRDRQQMSNALIK # KVRHISVTSQITLTEAFNQRDVPNTGLEQLSWTNHDLGATSSATTEVWWKTSHDITSPDHINVRQHELKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 Scaffold_7 AUGUSTUS gene 1258891 1259457 0.95 + . g260 Scaffold_7 AUGUSTUS transcript 1258891 1259457 0.95 + . g260.t1 Scaffold_7 AUGUSTUS start_codon 1258891 1258893 . + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_7 AUGUSTUS CDS 1258891 1259457 0.95 + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_7 AUGUSTUS stop_codon 1259455 1259457 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MDALAFDNYSIFAHDATPTSQRLNRIVYSLLQTWINNSHFPGSAPVLVHVHAIVKQRGVTFSPRDHSEANARVVFQTN # GAEEWSAGSIKSIFTAKWTSSNQGVVKTFAEINSYLPLADSDAVHDHFRAFGFAAGRLFYDRLDENTFLIPLDCIASHFGYTPWSTSCIHCDVMHALP # LNKASDFSLTLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 Scaffold_7 AUGUSTUS gene 1263671 1265346 0.29 + . g261 Scaffold_7 AUGUSTUS transcript 1263671 1265346 0.29 + . g261.t1 Scaffold_7 AUGUSTUS start_codon 1263671 1263673 . + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_7 AUGUSTUS CDS 1263671 1263977 0.29 + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_7 AUGUSTUS CDS 1264097 1265346 0.57 + 2 transcript_id "g261.t1"; gene_id "g261"; Scaffold_7 AUGUSTUS stop_codon 1265344 1265346 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MQKFENEIPPFTTEISDEDFNSENLAVIIDLSQPGFGKCEIKLQRDIYDEVDDEGREVLSKGLAAVFCGLVPVFGSKH # NLFLFKDREIHLEDGEIVGLEELFPSMRRDPSIYLPGDVFTEIFEIVRDSPTYGWPQQVLVLASVCRGWREVAVGTPTLWRYIVAPAYDIRFIALSLE # RSQQCPLVIEYHTKRPDHSVLYLLAKHSERWEHLSLCIPPSSYPLLSTIKGKVPLLKRLALQATTEDDPQPHQQLSGFEIAPALQYLNLRWFYPDLRQ # DSSTPWVRLTYLCCQSIELSRLHSLLANTPTLSTLHVSDVSHDWPYEQSKNEVLTQLKVLSIVDCDLWVIYSLLSRFSNLAELSILIFSDPGQANTGM # TVILPHLYRLKIQINGIFPGLVNFLVFEALKLSELEFSGCHSLEDSDDEHEDRVEESAATGRSLLQFLWNFIQSSRCSLTSLVLHFEVDFPACEMAPL # LKLYRHWNIWTFRLFIWNVFLFVLCSQLLRSFPNYKLYTCTSHQKHIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 Scaffold_7 AUGUSTUS gene 1268713 1271535 0.4 - . g262 Scaffold_7 AUGUSTUS transcript 1268713 1271535 0.4 - . g262.t1 Scaffold_7 AUGUSTUS stop_codon 1268713 1268715 . - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_7 AUGUSTUS CDS 1268713 1269382 0.59 - 1 transcript_id "g262.t1"; gene_id "g262"; Scaffold_7 AUGUSTUS CDS 1269470 1269510 0.65 - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_7 AUGUSTUS CDS 1269627 1269958 0.79 - 2 transcript_id "g262.t1"; gene_id "g262"; Scaffold_7 AUGUSTUS CDS 1270014 1270127 0.98 - 2 transcript_id "g262.t1"; gene_id "g262"; Scaffold_7 AUGUSTUS CDS 1270494 1271535 0.98 - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_7 AUGUSTUS start_codon 1271533 1271535 . - 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MQTSSFDGRYEDEDDGHRIEDPLDQNSGSTQFHAGNPGSDSSVYTHTPRSTSSPPHMLSSAEDETQTSHFYCRTEGED # DRHRFEGSLNQHSEYPQSHVGDPFDESGNTPGSDSSPCAHLPRSASSSPRPYISSNTEDEMQTSPIYRRTEGEDNRHRLEDSLNQHSEYAQFHAGDPF # DISRDNPGSDFSPYAHLSQSAPPHPHMSSSAEDEMHTSDFGSRDEGEDESHRIEDSLNQDSGYGYAQSHADGLFDELGDDPRTIVFDDVCIEPVSASS # PHLPVVITAEDEMQMPNVDGRNGGEDDHRTEDSLNLGHTQFNAGAIHVDSLNPTHFSDGVPICHDITVDPSGYVYTQFHAGDRNELSIDSPDPTHFFD # EVPISHDSNVTGYGSSSDINTVSSNGAEFSYIHGTPAAFDLDFQNAHYPDSSYMQSDFQTAYENSSSFPVPVTINAINTFEPDKDMSNRYRLDHNESR # NFAIQSNVVAASDHEVTIDLETGMSIDIRSSDPESSRGRRVSSNLPSQFLDADNDTSCEGSKVNEQFRPIQTRQEPVDDFAGFSNHNIPGINSTDTCS # NEADRARIGNQSSSLNSNLALGNNHSSSFEMASASEYNTNGISAFDDTGFDADDEGVKDGDGDWEMQYEDVRFDSNVGTAGNGKGFQISSDYESSRAS # QMEVPPTPIYRNTEQETCDDHRQGSQNLVDQTIWESHRYKAVCSCLNLTKLIVILTISKVYHLHRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 Scaffold_7 AUGUSTUS gene 1275440 1275832 0.59 - . g263 Scaffold_7 AUGUSTUS transcript 1275440 1275832 0.59 - . g263.t1 Scaffold_7 AUGUSTUS stop_codon 1275440 1275442 . - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_7 AUGUSTUS CDS 1275440 1275832 0.59 - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_7 AUGUSTUS start_codon 1275830 1275832 . - 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MLTYQYALTLKNATENSLSTSDLEGEFLALSNLQVQTDCFRLRNFSLTLDSWTPEHTSSGRNLQTVRGTNTWKPLSLC # WTAWIFKIAVESKKAAGPGSIDAANKKKHSLNEIVSDSPGLNLRNLRAMPLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 Scaffold_7 AUGUSTUS gene 1276166 1277332 0.93 - . g264 Scaffold_7 AUGUSTUS transcript 1276166 1277332 0.93 - . g264.t1 Scaffold_7 AUGUSTUS stop_codon 1276166 1276168 . - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_7 AUGUSTUS CDS 1276166 1277332 0.93 - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_7 AUGUSTUS start_codon 1277330 1277332 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MEQPLPLLLVARLQQLQSSLSNHRPIAGRVTQKSPAIPAAGWSHTAIANAPKTGPYSTAIVSQISDPGDGNTTPCSFD # SSTNEKPGTYDMRVSSGGFINNFPSSSNSNAGPATSDRVSAHQLTRPNSTSSLSGHGQKRRTIDTAENVVVTSSATQTKRMKTATITQGPYNPTPTHE # TASHEQYKHYPSSGPSNGALLPGTNSAPNRGSASEQRSSRPSFSSNHAHMPFSGTTPASNHDPEQRNRPSSSSQSSILFSSSHAHTPFKGPAPGPNHD # PEQLNHPSSGLSSIPFSASYAQTPFRGPTPAPSYGPEPAHRPSSSGQPSVPFSSNHATPAPNRESASDQHNQPSSSGQLSSSHVRTQLPSQAPSLGPG # NKTSSSSACAPSSAVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 Scaffold_7 AUGUSTUS gene 1298922 1301627 0.76 - . g265 Scaffold_7 AUGUSTUS transcript 1298922 1301627 0.76 - . g265.t1 Scaffold_7 AUGUSTUS stop_codon 1298922 1298924 . - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_7 AUGUSTUS CDS 1298922 1301627 0.76 - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_7 AUGUSTUS start_codon 1301625 1301627 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MNAFSGDTIGNSQPQNANKFSNVHRKGNDPKFSQQQHGNNSHQQQKGQNGNDDNKKKRKRGSGKNKKAKKNANAAQAD # ADSMDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPPNATSLHLHKKTRMAIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPPTKRTR # AMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDLLSRLYN # YRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIA # PVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAE # GVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVKNLYET # NVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTPYEILYN # KVPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHRSTRLPDRNPDPKDPIPPPG # DDDVPIFHQPTTPQMRQDPEQDVALPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGS # SSAEQERPEPEQVPGPSTEHPTPKMENNPLSLPVTKLIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 Scaffold_7 AUGUSTUS gene 1301654 1302232 0.34 - . g266 Scaffold_7 AUGUSTUS transcript 1301654 1302232 0.34 - . g266.t1 Scaffold_7 AUGUSTUS stop_codon 1301654 1301656 . - 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_7 AUGUSTUS CDS 1301654 1302232 0.34 - 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_7 AUGUSTUS start_codon 1302230 1302232 . - 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI # GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILYLSSHHVTL # SLSKPCLSLKLQSSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 Scaffold_7 AUGUSTUS gene 1338170 1338892 0.91 + . g267 Scaffold_7 AUGUSTUS transcript 1338170 1338892 0.91 + . g267.t1 Scaffold_7 AUGUSTUS start_codon 1338170 1338172 . + 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_7 AUGUSTUS CDS 1338170 1338892 0.91 + 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_7 AUGUSTUS stop_codon 1338890 1338892 . + 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MPFSLTNAPAAFQHFVNDIFSDMLDVCVIIYLDNILIYSDMPEEHREHIKEVLWRLQKHWLYANPDKCEFNMDTVEYL # GYILSPDGLTMSKEKAQTILEWPVPRKVQDIQSFLGFANFYHRFIYNYSDIVVPMTWLTWKGAPWIWDNNCPEAFENLKTAFTSAPILAHWEPNCIII # VETNASDYAIAAILSIQTVDGEIHPLVFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 Scaffold_7 AUGUSTUS gene 1340587 1341066 0.98 + . g268 Scaffold_7 AUGUSTUS transcript 1340587 1341066 0.98 + . g268.t1 Scaffold_7 AUGUSTUS start_codon 1340587 1340589 . + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_7 AUGUSTUS CDS 1340587 1341066 0.98 + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_7 AUGUSTUS stop_codon 1341064 1341066 . + 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MELHYTSGYHPEANGQTKRVNQTFEQYIRIYCSYQQDDWSHLLPIAEFAYNNTPNASTGITPFFANKGYHPNITVQPK # VDMKSDLARDFVVHLDELHIFLQEEILLAQSCYKEQADRKRISHPEFPIGSKVFVLAKHIQSTCPTEKLSEKYLGPFKVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 Scaffold_7 AUGUSTUS gene 1343153 1343631 0.92 - . g269 Scaffold_7 AUGUSTUS transcript 1343153 1343631 0.92 - . g269.t1 Scaffold_7 AUGUSTUS stop_codon 1343153 1343155 . - 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_7 AUGUSTUS CDS 1343153 1343573 0.92 - 1 transcript_id "g269.t1"; gene_id "g269"; Scaffold_7 AUGUSTUS CDS 1343624 1343631 0.97 - 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_7 AUGUSTUS start_codon 1343629 1343631 . - 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MKGSRNTERRNGGPRHGLDTTVLSTAGPLRSRPTPPPPADPAVHEEEEGLEDEDEDNIIRRAQERVKKKAAEAARKAA # EERAARVAEAREKEAQEQALRAQQQEKEAVGCGGNSMESKGDFSQQGVGFSEEARSRSQENSEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 Scaffold_7 AUGUSTUS gene 1347859 1348728 0.54 - . g270 Scaffold_7 AUGUSTUS transcript 1347859 1348728 0.54 - . g270.t1 Scaffold_7 AUGUSTUS stop_codon 1347859 1347861 . - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_7 AUGUSTUS CDS 1347859 1348728 0.54 - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_7 AUGUSTUS start_codon 1348726 1348728 . - 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MITEPVTNPGGQFPTSLEFTQPHIALRCGPAVKPYLPDDLGSHPTDPSFTSILVDTPVTFTNISGAIPLSTSTANINL # SDSSLEVKVLVNGKILTSSSVPLNASKHALPFSLSTLTPQKDAFSLTCIGTLSTGEQLLASSLLTYLPERPPGIGGVTKMDMRSGGLLAKPPTGEDGP # YQMFSRLVLYTQYGSYLASNLSIPGILKEQGCVRLSVWRLIQLIIVFIQVTCGMYRKFKFSVTTYLDTAQVHPVPDFDNITVLDQVLDKMQEVGLWLM # YDMRKCVLRIPVSWA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 Scaffold_7 AUGUSTUS gene 1356532 1361037 1 + . g271 Scaffold_7 AUGUSTUS transcript 1356532 1361037 1 + . g271.t1 Scaffold_7 AUGUSTUS start_codon 1356532 1356534 . + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_7 AUGUSTUS CDS 1356532 1361037 1 + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_7 AUGUSTUS stop_codon 1361035 1361037 . + 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MSTTQVNVPIFPEESKLTGKDSWSRFKAAVELTAQLRGYTGYLDGTIVKPASSLYSTAAGSVYPAVTATPAYSTTPYP # EEWYMRDRFVAATINLNTIDATGLGIDLTKSSANIWKDLTEKFERKDEQLIYLADHALRTEKFDPDSCTMEDHEKKMKNLKKKLTDVGGTLTDPQFRI # IILSSVPIDWKPETRNVPGKGSDEAFIHLHTVYIERKSESNELEQSNKVRALIAKEVLAAIPVQAPMAATTGTRTERLICSNPFCPSKIGHTLKKCWG # KGGGSEGKAPAWWYKKYNQEAPTAANSASPIETFTLSARTSHSTCTQTRPDSQRNRNSRPILNQTMSQGGREGLNGDVPVSFPKPISLDDCIISSSNK # SFPFPKPIRTYIDSGASEHCWVNRKDFVAYETVANQSGLTAVAGSNFSIEGVGMVEFLTRVGGQERIIQLTGVKHTPSFGHNLISLMTLDHKGLRGDW # GRRKINVTDKEGKVLLIGTGSEGTSGTAGGKMYEVEVLEKPNVLANSARSHEKAVDIHTWHRRLGHVGITRILRMSSKNLVDGLHITSRKVEGMCEPC # LYGKATRRPFDEKVVHESEVLERVHIDLWGQSRTKSRGGATWMILFTDGRSTVKVPDFLSNKLAATTLKSFHRYCLKAELETGKKVKCIRIDGGKELD # NGLMENYCAEKGIKIEKIPPYSSAANGMAERANRMVISGVHTLLDESGLGHSFWAEAAATYCYVDSFVPSSRFPDDIPIQIFTGKRQDISHLRPFGCD # AWATLPERRKDGKLSRQSVKGKLIGYMDRRGYRLWIPEWRVVLENRDVRFEEGQAKRTLPPRLNSGEVGKLFGDTEVGDNSGIIPDLRGIDVEESNGD # ELILNPHVPPVPIHGDFPLADLDNNEPQPGPPPAIPELQVPALPDLPLIPPPVHPVPLRRSARQKTPSTRYLESKDFETREKEAHEQGRDWATDTAFA # QVCADPWSFATSTEEMIPSGYKQAMKHSDLWKEPMQQEYNMLMEKQVWKLVELPPGANLMGGKWVFAIKRGPSGEILKRKARYVAQGFTQIFGLDYEK # TYGGVARMESVRIVLAIIACLGLSLFQVDFKSAFLNSPITHDVYMKQPEGFVQPGSENLVCKLQRSIYGTMQGSHDWQATLSKGFKEDGYTSSKADPC # IRSRRRGGEYTITSTYGDDVCGGASSELGRQEAIRDLGKRWESDEVGSGMLLGMSIKQDPHTRAITISQQGYFVRMLQHFGLEDIQPKKTPLPAGIQL # EQSPAILPVDEQLFMADKPFRELLGSLMWGSTCTRADIAFATGYLARFQSNPGRAHWDGLLWLAGYVRWSVHYCIVYRTPESEEVSRGRGLQPAGFSD # SDLANCLDTRRSTSGYVFFMAGAPVAWSSKRQGSVATSTVAAEYIALARASEQATWLSSFLAEVDLAQHGPVNISADNTGSVSLTENSKKLGLVKHID # TKHHHIREKVDEGKIAIELIRTGENVADILTKALNGPMVHKFVKKLGYCTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 Scaffold_7 AUGUSTUS gene 1372772 1373553 0.17 + . g272 Scaffold_7 AUGUSTUS transcript 1372772 1373553 0.17 + . g272.t1 Scaffold_7 AUGUSTUS start_codon 1372772 1372774 . + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_7 AUGUSTUS CDS 1372772 1372779 0.18 + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_7 AUGUSTUS CDS 1372854 1373553 0.33 + 1 transcript_id "g272.t1"; gene_id "g272"; Scaffold_7 AUGUSTUS stop_codon 1373551 1373553 . + 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MGSDTYQFTLVGNGVGFLVPSDNTESSRGRIFRLIRTNPNGDGYSEIPIYCQEYSKCKDSEFEASIESGLSKIPTLIP # RPTQESHDASIQPTQDFDLESLLASFSAVQPITDSQPEFDWSFLIQPGLDTGFNAFDSFIAPLSAPGAELDMVDTPAWNMRDLGNMENMDIDTALQQH # DWMTANDLDVLNSLEFNSSSFASESAFPTLPIVFQASTPGAMAECATTGFVHGEDLQTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 Scaffold_7 AUGUSTUS gene 1375830 1376306 0.74 + . g273 Scaffold_7 AUGUSTUS transcript 1375830 1376306 0.74 + . g273.t1 Scaffold_7 AUGUSTUS start_codon 1375830 1375832 . + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_7 AUGUSTUS CDS 1375830 1376306 0.74 + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_7 AUGUSTUS stop_codon 1376304 1376306 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MKMQDGSKESAICFGTQYFLTAIKDPENPNQFKGSSVQKKPNISIKQYTVATADFGYKTTEQFKSAIEYLGGHSASSS # LLWMHETLTKMVEGKYIREIPKAWTTALEQQGFNENANWLGNTGAGSSNGEAVRNPGGKQAGNGGGGQEVEGSRESTTQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 Scaffold_7 AUGUSTUS gene 1377012 1377791 1 - . g274 Scaffold_7 AUGUSTUS transcript 1377012 1377791 1 - . g274.t1 Scaffold_7 AUGUSTUS stop_codon 1377012 1377014 . - 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_7 AUGUSTUS CDS 1377012 1377791 1 - 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_7 AUGUSTUS start_codon 1377789 1377791 . - 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MLPDLEQAISLDPSNQSVKTELSAIKDLLWKKAASEIVHPMRRRVPIKIIESASDETQKATVSVKDSRSKISSSSTHP # SEKVITNHASPSHSIPTDPLAAPKSLEATATITLVPPSPQDSSKPKSSFQEAKRARNEKEGNISRVGGGIFRASGKNTIFTQSTTGGDGGNKNEQDAN # PKDPKDTEGSPAPAWGADVHLGTATTTLFEFTRGWSRLSGSSVEEKFRYIMVGAFRKFSTLHFPSSLTLLDTCRQLPPLPSQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 Scaffold_7 AUGUSTUS gene 1381384 1382037 0.61 + . g275 Scaffold_7 AUGUSTUS transcript 1381384 1382037 0.61 + . g275.t1 Scaffold_7 AUGUSTUS start_codon 1381384 1381386 . + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_7 AUGUSTUS CDS 1381384 1381474 0.61 + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_7 AUGUSTUS CDS 1381592 1382037 0.63 + 2 transcript_id "g275.t1"; gene_id "g275"; Scaffold_7 AUGUSTUS stop_codon 1382035 1382037 . + 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MSLPTVFAYSENGQIIVGEEDYQDMFGDPGVPAIGESASPFLKNPNDSFTLFTTSPSGEQQIHENMLCYEYTDLSHLA # SSHHPSAGALTPGGGIDDSASASSQVQIRKSVTSFYSTSGTLNSPYHPPTHTSREIQESSSILYELGLPRPDLDDLSSSPSSTSPTSSTSPSTPVFDD # YA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 Scaffold_7 AUGUSTUS gene 1385567 1386241 0.96 - . g276 Scaffold_7 AUGUSTUS transcript 1385567 1386241 0.96 - . g276.t1 Scaffold_7 AUGUSTUS stop_codon 1385567 1385569 . - 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_7 AUGUSTUS CDS 1385567 1386241 0.96 - 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_7 AUGUSTUS start_codon 1386239 1386241 . - 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MVRNYDIFQSSSTPGPNAPLGNLCGTSTLPQYSAQAALSQWSAAGFPASKMLLGLPLYGYVSNSTKTALTGSLVDPSP # NEDRKNGPNGTSTNVARPGNHARHQRTIPAKKPAEGQAGSGKVNGNVEKGKKKGATNGNAGTGKETKDSSNQAGTEATANLQSWYGQQIPFGSIVASG # ALTKNADGTYGGGGGFTEGNSWCSDYTDYSLTRYLPGWDNCSDTPVCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 Scaffold_7 AUGUSTUS gene 1389314 1390201 0.88 + . g277 Scaffold_7 AUGUSTUS transcript 1389314 1390201 0.88 + . g277.t1 Scaffold_7 AUGUSTUS start_codon 1389314 1389316 . + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_7 AUGUSTUS CDS 1389314 1390201 0.88 + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_7 AUGUSTUS stop_codon 1390199 1390201 . + 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MYSHERKRSSSGSPLEDYLFSYQNALINSHPLTNNFQSSNANPELASSDASKYTTATHNGKCPLFDYYACLTPPAVSQ # DRLPDFQSLSRKYLRMLANESDDSRSLNAIRTAPLAEPQGENYGGDPQSLEYDSLSTHFEQIYLYSTNTVNSPVASEFLTQECFTDYLSSPLDVSPIE # SSPSSSLFGSPIMKTIDSNDESGWVNTDDNIRNVQPQHINNGSSESASNDTVPTSSDQVQEPVSGKSSRSQTSHNSASPPTSASGSESRNLYPTKRLP # GFRSDNIMINTSACKVPSSFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 Scaffold_7 AUGUSTUS gene 1390276 1390653 0.61 + . g278 Scaffold_7 AUGUSTUS transcript 1390276 1390653 0.61 + . g278.t1 Scaffold_7 AUGUSTUS start_codon 1390276 1390278 . + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_7 AUGUSTUS CDS 1390276 1390653 0.61 + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_7 AUGUSTUS stop_codon 1390651 1390653 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MIPTESSSPPAENKNQKRSHSLAFDDDGNNEGFNDEEQDSLPSSELSLSPNATESEKLALKRRRCTLAARRSRRRKLE # YQLMLERTVGNLEKQRDKWKTRCTILQEILKRHNADFKFEEEEEEEC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 Scaffold_7 AUGUSTUS gene 1393909 1394244 0.83 - . g279 Scaffold_7 AUGUSTUS transcript 1393909 1394244 0.83 - . g279.t1 Scaffold_7 AUGUSTUS stop_codon 1393909 1393911 . - 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_7 AUGUSTUS CDS 1393909 1394244 0.83 - 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_7 AUGUSTUS start_codon 1394242 1394244 . - 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MLQIMEIIETGNLQRIAYERTEDVKVISLFTKIYGVGSSFNPNFILSEPHTPSQVSRLPPCGMLGVVERLRICGNGVG # DVALNEGQKIGIEFYDGICTEVQKLCARLNERL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 Scaffold_7 AUGUSTUS gene 1394822 1396353 0.44 - . g280 Scaffold_7 AUGUSTUS transcript 1394822 1396353 0.44 - . g280.t1 Scaffold_7 AUGUSTUS stop_codon 1394822 1394824 . - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_7 AUGUSTUS CDS 1394822 1395469 0.92 - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_7 AUGUSTUS CDS 1395646 1396353 0.44 - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_7 AUGUSTUS start_codon 1396351 1396353 . - 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MQKLNGPYVLLLNEHSLSSDDALDFSFPGDVTPNRHHSDSSNQSFHRAPDSVARVKVEPTIIIDGPLATRSSRHTRLP # SKSFSDNSSDASTAPSSPIEEARSLSLVPATNGKAPEKEKSMLEIILEAKHSTHRRAVKKLVPLAQLQTKPKHQSNSVDETSIIDNYSSSEGATSPDI # ACSSSIVKVGSNSAELTKGSISKSRLTAAPKLAAKLSATTKAKGKGKTTVPSTKLTPYEFSPQILRHGGSVVPRYQPDHITHIVVDKNLGQNSLLKAT # GLEKLTDVPDHIPILTWQWVVDMMDMNPFLNNSKVLKIRQVSSLFEYGAYPNRLPPVSISATSKYFEQKRAPQEGDEDRDFSRISCVVLPIAMLAMIL # VPQSRYFREFSANDIKPEVGSSRHEPLESKHVRNTMVKLASTRLPLDFQFQKPVNQEIVDPLVEFYLQRKTNVQVSQLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 Scaffold_7 AUGUSTUS gene 1397384 1399879 0.6 + . g281 Scaffold_7 AUGUSTUS transcript 1397384 1399879 0.6 + . g281.t1 Scaffold_7 AUGUSTUS start_codon 1397384 1397386 . + 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_7 AUGUSTUS CDS 1397384 1397583 0.66 + 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_7 AUGUSTUS CDS 1399186 1399879 0.97 + 1 transcript_id "g281.t1"; gene_id "g281"; Scaffold_7 AUGUSTUS stop_codon 1399877 1399879 . + 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MPSEDDEPDDIQPHGEELQNTDLEELRDSEFPGYFSERDGRLYQADTVTSPYPLPVDTPENQVQHQILLIPYYRQYFV # DVLASFVTSGRFTRHEYAEYVAPVVESEIEESKFNPGFQAIEAAHAVAFHNGLGSSLLASPHNSITHVDIRSFAQSAFTRDNIAVLGTGIDQATLASL # VEQSLSKISATSQISSSASSYFGGETRLPAHGGPQTVFVGFGSAGAPTPEIATLSAYLSPTPSVKWSKGSSPIAATIPEGTTVEVVHLSYSDASLFGL # LVQGPSGSAVKEAGKAAVQALKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 Scaffold_7 AUGUSTUS gene 1402141 1402452 0.41 + . g282 Scaffold_7 AUGUSTUS transcript 1402141 1402452 0.41 + . g282.t1 Scaffold_7 AUGUSTUS start_codon 1402141 1402143 . + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_7 AUGUSTUS CDS 1402141 1402452 0.41 + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_7 AUGUSTUS stop_codon 1402450 1402452 . + 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MSANQIGGFFNRLEASRKYLFGSMGVLGQANDSLISGALIARGQDIAPVITVAPDWESYSYSKIDLSDPAQKEFFEAA # LAWDLKIDGKEWVDGKNVGVLIILI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 Scaffold_7 AUGUSTUS gene 1406131 1406607 0.41 - . g283 Scaffold_7 AUGUSTUS transcript 1406131 1406607 0.41 - . g283.t1 Scaffold_7 AUGUSTUS stop_codon 1406131 1406133 . - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_7 AUGUSTUS CDS 1406131 1406607 0.41 - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_7 AUGUSTUS start_codon 1406605 1406607 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MKNSFFKSITLEMVINETHYHSPNVLDLWWSTFTGAGSCSVTQLTRSMARSVTEYVDAVVISVEYRLAPENPFPAAVE # DGVEAVLWIISHAEELGVDPYRIAMSGFSAGGSLTFGVPMRLGEEMRSRRQLSAVNNDGRKLRVHTLTRNIALSSLPHGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 Scaffold_7 AUGUSTUS gene 1414933 1415946 0.47 + . g284 Scaffold_7 AUGUSTUS transcript 1414933 1415946 0.47 + . g284.t1 Scaffold_7 AUGUSTUS start_codon 1414933 1414935 . + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_7 AUGUSTUS CDS 1414933 1415946 0.47 + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_7 AUGUSTUS stop_codon 1415944 1415946 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MCDLRVFVQTFIFVRPPPAKSNHPLNLQVQLVPPNSQTPGVTGSSTSTPRQSLDDAELAPPPSLLTHNQAGADTVGEP # LARTSTTQSSRSEVSTYSSSGYTSTASFSSVGSTASGRRLIIPLYNLQAHNVMTNTIVDAGTDAKIARFTRKGLEMIDLAVMEVVEVWPTPSGAATST # NTNNGVSTTGARGSVDEGRTLQNRPSTIGTVPLRSRPTTPDPERLTPGSSVVSVSSAGLSATDEHHLPQNPTAVPIRVAPQKRNIFGKLFKKKDTSSS # PEKTPTLPPKSIIPPSPTSLIKTPVQTPTHSVIPPSPTNSSRHGRNLSSSMTKLWQAWCFGLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 Scaffold_7 AUGUSTUS gene 1416026 1417297 0.92 + . g285 Scaffold_7 AUGUSTUS transcript 1416026 1417297 0.92 + . g285.t1 Scaffold_7 AUGUSTUS start_codon 1416026 1416028 . + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_7 AUGUSTUS CDS 1416026 1417297 0.92 + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_7 AUGUSTUS stop_codon 1417295 1417297 . + 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MHLDPNDVQPRDFAYDNNDFGPKSQAATAALSTTSSRISTASKMSNNNTLEPPSMFVAATGGSSTSNAVILPATLGIQ # PTLSSPGGPIALSAFVNFTSSGYPPPKSMGFGRGPALYVWVIRKWIKTPEGTSGAGLFGGMKDAIGSMGANNNGSSMQSGRGMQMRIAGLSEIEVRVE # WKRGKKSKSKKKVKDSAQDGDAEGSTSRGASHSRRQSIITNETSPMGSVSSLPAATSESSEARKKRHRLSTASKASTNEDPDTTLTSFRLGRGRAKAQ # ITDEDDDGNDSDPEDSETPWTCTLKARHLGVAGLPRSSPSPSTSTPIKVKIATLSPMPHHPKVVAMLKVPYPLPDLEVQTMSIRKRPIGLPGAPLNQR # SDPGSPAMGLVFRAEEIKDVVCSTGIWVVVREGFGGVGKVSRKGDGWRIRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 Scaffold_7 AUGUSTUS gene 1422167 1423715 0.29 - . g286 Scaffold_7 AUGUSTUS transcript 1422167 1423715 0.29 - . g286.t1 Scaffold_7 AUGUSTUS stop_codon 1422167 1422169 . - 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_7 AUGUSTUS CDS 1422167 1423542 0.76 - 2 transcript_id "g286.t1"; gene_id "g286"; Scaffold_7 AUGUSTUS CDS 1423607 1423715 0.33 - 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_7 AUGUSTUS start_codon 1423713 1423715 . - 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MFTNAHQFSIRGGTYNNVARDQINLYESPQTVSGNSALDILSEFIKDVGAVHDSAQRYPPPKCHPETRKGIQTAILEW # IHSQQNGRPVFWIHGPAGVGKSAVAQTIAELAEIRGSLGASFFFSRSHGERGRAEYLFPTIAYQLAVRIGEFNKVVTQTLRKDPGVLRSSLDIQFEEL # FLNTCGSAMKLGGKWMHQPRVIIIDGLDECTETVFQKHIILLIASVLKDKLPFRFLIFSRPEPQIREAFQAHVPQSLLRQTSLDKDSWDARQDMKRFL # ESGFSNIRTQARTSHIHFPPLWPGREVIDELIEKACGQFVYATTVLKFVGEEHSHPMEQLSIVLGLKTAARGNSPFKELDVLYHHILFSYPDHNKVTM # ILGALIHLSSLSGLRRWNNHPCGPAIEVIEALLGLHTGEVLLVLRGMHSVLNIDGTHIRILHASFRDYLCHKSRSGQFYIRDSTFVAHLFLSFSGVKI # IVTEPRRMSVLVNDLSHIVTTCHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 Scaffold_7 AUGUSTUS gene 1433859 1434819 0.71 - . g287 Scaffold_7 AUGUSTUS transcript 1433859 1434819 0.71 - . g287.t1 Scaffold_7 AUGUSTUS stop_codon 1433859 1433861 . - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_7 AUGUSTUS CDS 1433859 1434485 0.97 - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_7 AUGUSTUS CDS 1434550 1434819 0.71 - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_7 AUGUSTUS start_codon 1434817 1434819 . - 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPPAVRETTPTSAASESPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRS # PISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKE # WFVPDILDPDLDSLPAWTSSFKPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 Scaffold_7 AUGUSTUS gene 1440793 1441170 0.81 - . g288 Scaffold_7 AUGUSTUS transcript 1440793 1441170 0.81 - . g288.t1 Scaffold_7 AUGUSTUS stop_codon 1440793 1440795 . - 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_7 AUGUSTUS CDS 1440793 1441170 0.81 - 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_7 AUGUSTUS start_codon 1441168 1441170 . - 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MAEQGWVSTKLHDITVGPDPSYSEAQQPKTYVQTAREFTASIASLVCSNNADFFGQDLACFLAFAQADKIPKDVREDN # LPRLSKLKAKYDPEGLEQGYSYCHNRLLNGENDTVAEQAQVGFWSGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 Scaffold_7 AUGUSTUS gene 1445080 1445751 0.5 + . g289 Scaffold_7 AUGUSTUS transcript 1445080 1445751 0.5 + . g289.t1 Scaffold_7 AUGUSTUS start_codon 1445080 1445082 . + 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_7 AUGUSTUS CDS 1445080 1445751 0.5 + 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_7 AUGUSTUS stop_codon 1445749 1445751 . + 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MTFRKKPIGLPSINVTLTKRRMILYYHDKLGKSFNWIANNAPDFRNTATNYTPISRNYKIAQEHGCYYTPPRPGHPSV # FTQDDIAKAISSIDEGRAVDGSDLQAQLFPTIPQRTVRCMLSHNGLKGFVRRQKVTLNMCNFMERYAFARTWHEWSTPEGWACYWVIFSDESKFVLGG # SDGLRWCRRRKGQNPLTEQNVSQREWRGLGHGLGMHDPEWGGQTSSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 Scaffold_7 AUGUSTUS gene 1447549 1451348 0.77 - . g290 Scaffold_7 AUGUSTUS transcript 1447549 1451348 0.77 - . g290.t1 Scaffold_7 AUGUSTUS stop_codon 1447549 1447551 . - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_7 AUGUSTUS CDS 1447549 1449017 1 - 2 transcript_id "g290.t1"; gene_id "g290"; Scaffold_7 AUGUSTUS CDS 1449134 1451348 0.77 - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_7 AUGUSTUS start_codon 1451346 1451348 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MHCHEPSKVNEHLDKLLEIRDSLEARKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSTIRAEA # SGHTRGQSGKKESANYAGGNSNRGRGGFNRNRGNFRGQSRGRGNGNRGGGQSRPNSNNSTCYNCGGKGHFANKCSSPKRQQANEAQESSQKKEKNQPS # GSGSNNWRSKNKEVGSSATIEEVPESSWAAVEVTTTTSQEIFNFSEIASNYETAFVASHSSGAILFDSGCSSHMTPLQDKLRNTRSVPTRIIQAANAE # TFTSNTAGNLQIDLPINEDGISKSLTLQNTLLCPNTPNTLVSLGKLDDAGYVMVIKDGTLKIINRQGETIGIVPKTNGLYQIPSAEYAYAGKATRMVS # LYEAHCIAGHQNYAYVKHMFKSNQVHGIKLDPKQMEEPECRTCMLAKAARSPISKIRTSPRAEKFGDVFHMDVWGPASVQTLNHYVYALTVIDEATSW # LEEPLMKGKDEAFAQYVILQTGLQTQYGVTVKKLHSDRGGEFLSGEFTAYLERLGTKRSLTVHDTPEHNGIAERSHRTLLNGVRSLMISSGLPKWLWG # FMMGYTVYVWNRTPKKANGMISPWEKRFGTIPDISNFHIFGSTVYVKREKEPGKLDPQAQEGRWVGIEPESNGYFIYWPDRHTVSTERNVQFSDRQIQ # PVEGEDQDLGNLETSITESEQPIIPVPEEIAEPINPDIITGKRVRKPTKKIQDIINGLGEPNRELRHLTASLARTYDIVIPPDDANILTSKWVFRTKR # DEQGKVTGHRARLVVRGFNQIPDVDYFPDETFASVTKLAAARAILSTGAEQNMFIHQMDVKSAYLYGKLDDNEQIYMKAPPGVDIEVKAGQVLKLKLA # LYGLKQAGRRWYMRFREIMTSVGLTRSNFDHAVFYRTDPFCIIFIHVDDMTMLTKTMAVMDTLKKKIRDQIEVVDSGEIHWLGIEIRRSLHTRSIHLS # QRAYIDAILSRYGFADVKPLSIPFDPHIHLTKDQMPTTVEDITYMRDKPYREAVGALQYLSVATRPDITYAVGILAKFLQNPGITHWNAVKRVYAYLK # YTRDLWLTFGGTQAEIEGYTDADGMSQEDRHAISGYVFMLNGGAVSWSSKRQDTISLSTTEAEYIALTHAAKEAIWFRNLLSELFGPITKPIILNADN # QSAIALAKDDRFHARTKHIDIRYHFIRYVIEEGKIRLVYCPTEDMTADIFTKALPSLKAKHFAASMGLTKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 Scaffold_7 AUGUSTUS gene 1451507 1452174 0.97 - . g291 Scaffold_7 AUGUSTUS transcript 1451507 1452174 0.97 - . g291.t1 Scaffold_7 AUGUSTUS stop_codon 1451507 1451509 . - 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_7 AUGUSTUS CDS 1451507 1451963 0.98 - 1 transcript_id "g291.t1"; gene_id "g291"; Scaffold_7 AUGUSTUS CDS 1452065 1452174 0.97 - 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_7 AUGUSTUS start_codon 1452172 1452174 . - 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDVKDRLIDRKQEDLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPE # YPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDNMSKVFKAFDKVSTLKSDGSNWDTWKNRVELATRSIGFSNHLTSNPK # DDTEAWEAKKRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 Scaffold_7 AUGUSTUS gene 1454533 1454919 0.85 - . g292 Scaffold_7 AUGUSTUS transcript 1454533 1454919 0.85 - . g292.t1 Scaffold_7 AUGUSTUS stop_codon 1454533 1454535 . - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_7 AUGUSTUS CDS 1454533 1454919 0.85 - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_7 AUGUSTUS start_codon 1454917 1454919 . - 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MPKNVSIERRKAKKEHTTQPISQELTPKQRKNRNSRIHCDIVEQIISGENIDCECAVSSSCRHDDDSDVFFDIESSGI # DEPPKSVILGGESRIQRSWQKFFHNFTEDERGGLEEELTDVDSLRAKGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 Scaffold_7 AUGUSTUS gene 1459957 1461258 0.52 + . g293 Scaffold_7 AUGUSTUS transcript 1459957 1461258 0.52 + . g293.t1 Scaffold_7 AUGUSTUS start_codon 1459957 1459959 . + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_7 AUGUSTUS CDS 1459957 1460379 0.52 + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_7 AUGUSTUS CDS 1460473 1461258 0.64 + 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_7 AUGUSTUS stop_codon 1461256 1461258 . + 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MNKPQWPSPAYPGLVGNVLPRFLAFSEAPFPESPNHPHQPFPTLAETYQYLRSFAEPYIEQGNIQLNTEVMRIEELPD # KQGWKVRVRDWSMCDDNDGMPLETEEIWDAVAVCAGYYDKPNWPDTEGLNQVRKRGLGAPRKMKAIIIGNANSSNDIASQLAPVAQTPVYRSMRRPAA # PWFPSLADSRIKNVSAIKKYILQPAEETDDGMMLEKVTVILQDGSEIKDIDVVILGTGYCPHPEFVHVLPIPADGTANASEINNKTVTSTVPIMSYTT # PVLPQFRRIPFLHRHILYAYNPSLAFIGAILAMTPFIVADVASTWLTLAWLGEVSYPDSVVERMAFDRERIAQVVKLLEVPDTVPENEGAGDSKESSP # DPPSSFVTYGFLGPGDTENGGKGGESRVCQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 Scaffold_7 AUGUSTUS gene 1463576 1464055 0.64 - . g294 Scaffold_7 AUGUSTUS transcript 1463576 1464055 0.64 - . g294.t1 Scaffold_7 AUGUSTUS stop_codon 1463576 1463578 . - 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_7 AUGUSTUS CDS 1463576 1464055 0.64 - 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_7 AUGUSTUS start_codon 1464053 1464055 . - 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MSIAYAIEKQLAISAVRRACLLTSSVFNKLVKNETLVKGDKSPVTGIVIRSFFSSFSFMYMTFAVADYSAQAVISSML # HHAYPNDPIVGEEDASDLRAESGISLRNRIVELANEALTAELGIGDDADWGIGPGSEQNADELLDAIDRGRYEGGRTGSTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 Scaffold_7 AUGUSTUS gene 1464598 1466206 0.66 - . g295 Scaffold_7 AUGUSTUS transcript 1464598 1466206 0.66 - . g295.t1 Scaffold_7 AUGUSTUS stop_codon 1464598 1464600 . - 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_7 AUGUSTUS CDS 1464598 1465181 0.71 - 2 transcript_id "g295.t1"; gene_id "g295"; Scaffold_7 AUGUSTUS CDS 1465241 1465358 0.9 - 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_7 AUGUSTUS CDS 1465421 1466206 0.83 - 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_7 AUGUSTUS start_codon 1466204 1466206 . - 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MDDLEDEKRMREEDEEKLNEGDGESEEDDDEEEEERNPSTDHGNVQVENERIHVEAQVHQNVEAQIQESQVQEVQIFR # DEQVPEDVLSLEQAQVSEDVPSQVQVLEDGQVQLQVQISDVESPVDVHKDDQLLVQIRDDEDKDRDDQDDDEVEQVLDLEERLLIAESEGNEIEIDSE # DDDDGEDEDEDEDNDDDQSPRSSFQARLEHLRKKASSQTGATSAKSKGKAKAKATLYDDSDSDDEDDWDRNRTWAEEDDDFSAHIQDILDGNKDNLVG # RDKKSKKQVFQAVYNGDFEDVDMWKPAPKDKHKDIPPDLIDLWKKDRAKKAIRKQERKLARLAAAADPLTEKQGGKKGRKAMLAAAKLDPTIVVLPNR # VIDMTTLVQQIRRFIDNIGGPSSMSLPPANKQTRKDIHELAAAFNLKSLSKGDGDARYTTLTKTTMSGIRVNQKVVAKIVRRRGGLADNAEFVGGADI # SKKHAERGKAGKSMPKHREGDEVAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 Scaffold_7 AUGUSTUS gene 1466253 1467800 0.81 - . g296 Scaffold_7 AUGUSTUS transcript 1466253 1467800 0.81 - . g296.t1 Scaffold_7 AUGUSTUS stop_codon 1466253 1466255 . - 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_7 AUGUSTUS CDS 1466253 1467800 0.81 - 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_7 AUGUSTUS start_codon 1467798 1467800 . - 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MDGFASGAAAAVGKGDVEEIVEMEEGSTRPTDVFEEAELLLQEETASSVKESLDTVTTEPDGSNQFPRNVEMLASTSL # SISTGDADPELAQVSSSIQSIAIQDEPRPRKDEDMQSQEPTQQENPTFFVDVSPSSSNPIQTPIITNRVDGLGLGAPSISDDDGDIVVYVAPHPRQGR # STAPTPTPGFRPEIRITSILTGLPIGTAPPAVGPAPTLDSITFTSFGSGVESLSADRSGLPRLSIAHANDPSHIDRDQTNNSNHTRPPVFTSNSPTPA # KIKSRQRGQWAAKQGQRGGGAFSYSRHHSSSSFASRGADVSEAQLTNWRQNSQEQQRNWNPYANNANTNLYSNGNPYVNANTTPYANTNLYSPANPYA # NTNPYSPANPYANTNLYSPSHTYANANPYMNWSPSTYWGYEEDNTQSPKVDSTGLLGVLASAQARVQTRSGDELSPEGGEGKDEGDNGAGPSEAEGSK # EQDEPKKRKVVVLNNPKVSGIRGCFVRRRRRNGNRFRSWILTWKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 Scaffold_7 AUGUSTUS gene 1473988 1474398 0.69 + . g297 Scaffold_7 AUGUSTUS transcript 1473988 1474398 0.69 + . g297.t1 Scaffold_7 AUGUSTUS start_codon 1473988 1473990 . + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_7 AUGUSTUS CDS 1473988 1474148 0.74 + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_7 AUGUSTUS CDS 1474243 1474287 0.75 + 1 transcript_id "g297.t1"; gene_id "g297"; Scaffold_7 AUGUSTUS CDS 1474344 1474398 0.7 + 1 transcript_id "g297.t1"; gene_id "g297"; Scaffold_7 AUGUSTUS stop_codon 1474396 1474398 . + 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MAPSVTTSPSNGHVSVNVAGLKATNGKNGNTKSGARHASSAEVIQMEHQFGAHNYHPLPVVFERAQGAKVWDPEGREY # IDMLSAYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 Scaffold_7 AUGUSTUS gene 1486624 1487772 0.91 - . g298 Scaffold_7 AUGUSTUS transcript 1486624 1487772 0.91 - . g298.t1 Scaffold_7 AUGUSTUS stop_codon 1486624 1486626 . - 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_7 AUGUSTUS CDS 1486624 1487772 0.91 - 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_7 AUGUSTUS start_codon 1487770 1487772 . - 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MYSVGKQECHIPVAFSLIPKFFCLKGYAGYYGLSLISGSYGVLFVSLAAHAAQFAFLVFFENPHIERLYGQRKAIAKR # TPLVSSLKSTNKPIPSTSGTEISEVEESDTELTTPSATEGETATDTDLETETETEIEEKENHVGILLKTNSKLRSPVRNGSGRISPKSPRARKSSNHR # QQGSAANSLSTSCTGDLTSKTRKSVSQHDLLNKYFRRDMVIFRNLDVLRFVSTFKFVVFVPHAYFPSYSAPDALLIILVAYVALFTLLPSSVFASHSS # LVAVHFIHALSWCLFHVFGLGFLLRAQSESKFLVKHYMKNYHYTFGNEEGAKGAIVEAFANFKAIYNASLCMTYGMCDFGDSALSTCSLIFDFAVSFI # GLVWRTYSIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 Scaffold_7 AUGUSTUS gene 1494591 1494839 0.91 - . g299 Scaffold_7 AUGUSTUS transcript 1494591 1494839 0.91 - . g299.t1 Scaffold_7 AUGUSTUS stop_codon 1494591 1494593 . - 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_7 AUGUSTUS CDS 1494591 1494839 0.91 - 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_7 AUGUSTUS start_codon 1494837 1494839 . - 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MPDEQAFESYLFSFDEALNMINPEERPVVIYAQHLYQQHFRIAAEFEKRRAKDQDLEGTERVAVDSEKRYAGGSSSKL # DSDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 Scaffold_7 AUGUSTUS gene 1502415 1502956 0.44 + . g300 Scaffold_7 AUGUSTUS transcript 1502415 1502956 0.44 + . g300.t1 Scaffold_7 AUGUSTUS start_codon 1502415 1502417 . + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_7 AUGUSTUS CDS 1502415 1502500 0.44 + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_7 AUGUSTUS CDS 1502560 1502956 0.87 + 1 transcript_id "g300.t1"; gene_id "g300"; Scaffold_7 AUGUSTUS stop_codon 1502954 1502956 . + 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MPAINRVQSRKQALPGVMRIVPEGSYGAWPGDDQFDCAAGYNCPSPTVILDSFNPFGNVFVDIGSGGPVPFTWSANVN # ATWLAMSATNGSISSDSPEQRVFLSIPDWAQVPFNALAQVNFIAVAPNQSDLVVPVMVQTQNTEQQVPSNFTGVVLLPFISR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 Scaffold_7 AUGUSTUS gene 1505381 1505647 0.54 + . g301 Scaffold_7 AUGUSTUS transcript 1505381 1505647 0.54 + . g301.t1 Scaffold_7 AUGUSTUS start_codon 1505381 1505383 . + 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_7 AUGUSTUS CDS 1505381 1505647 0.54 + 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_7 AUGUSTUS stop_codon 1505645 1505647 . + 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MHDNTLAIEQTLTASGEHDAALSVGKDTERSRDLQFVSSSPRHFDENNMSDHVNAERSVRKEQTDSNVGCSNPSTVFR # RTKVKEDKDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 Scaffold_7 AUGUSTUS gene 1511575 1511823 0.5 + . g302 Scaffold_7 AUGUSTUS transcript 1511575 1511823 0.5 + . g302.t1 Scaffold_7 AUGUSTUS start_codon 1511575 1511577 . + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_7 AUGUSTUS CDS 1511575 1511823 0.5 + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_7 AUGUSTUS stop_codon 1511821 1511823 . + 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MDFIFAAMETAQAFWSLLIPHGLKGGALSHISSTDSDDDVDMNGAEGWRPEYTDWWFEFLNEKGGKGVSKDTWSMVCF # NNIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 Scaffold_7 AUGUSTUS gene 1512786 1513922 0.66 - . g303 Scaffold_7 AUGUSTUS transcript 1512786 1513922 0.66 - . g303.t1 Scaffold_7 AUGUSTUS stop_codon 1512786 1512788 . - 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_7 AUGUSTUS CDS 1512786 1513922 0.66 - 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_7 AUGUSTUS start_codon 1513920 1513922 . - 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MVNQYRDLQSHDASRVVGAFNLSSHIYSDCCRKLSTYKLSSPLPLMIEKILFLLVSSAYDGTRRPSQSSQRRKRQRRR # MRSDQSLHKSPPISASSEVPLNTAQPSRQSPHSPAVSYSEGNNRTAFRSSGTSSIFNSSSSEDDEISDLTRFDPVHMLPRSTLSSTSTPSTQNDRELN # NFAERFRALVSQISHEADEALRFAQADDTGELEPALLPGNTYTDLPRHAYDEFVGGEYPPDDHVRILNGFVRRMPTIESLGSRELTSLASSRDQLHSL # SRPPTRSVTEFTGSEPPSRANSLSLTAAIGGHGLTSTEMGELLDKIDKENSSMGTGSGAQSASRSTFSYYTAPSIGRTSDSPVPLTPSSEQSPSSPTS # GHSSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 Scaffold_7 AUGUSTUS gene 1539681 1541839 0.18 - . g304 Scaffold_7 AUGUSTUS transcript 1539681 1541839 0.18 - . g304.t1 Scaffold_7 AUGUSTUS stop_codon 1539681 1539683 . - 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_7 AUGUSTUS CDS 1539681 1539879 0.64 - 1 transcript_id "g304.t1"; gene_id "g304"; Scaffold_7 AUGUSTUS CDS 1539954 1541839 0.18 - 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_7 AUGUSTUS start_codon 1541837 1541839 . - 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MTQYLTKVQGMPKEVEDRLLKRIKRFLWDEKQHVRINKDTVEAPIENGGRQVLDLLARNEAITVTWLQTYLDMSPDRA # TWAYVADALIAHHTPKTYDNIDEYSKINIFLQSWNTDVRKLPKDLQDMIKVAKKHNLRLDGLAFSRDTIRQMPLWLHSECKEIKSKHNNPLSKCLREN # HKVRLVGDAETFAKHSQMVRHQDRRNCACASCTQIRRATECRHPNRCYRKARELLLMLPQKWNPMHKIPADYEPPELEQPLIEDGQTFDWRVTSRGGI # TDAFRIFTEGEKCNTLPDTERTVTNTHRPIEAFTDGSCMHNGTDDASAGAGVFFPNGEYSDCTIRLPNNIQQSNQTAEIIAIKEAVEITDTESNLIIH # SDSKTMLQGLTTNLQKWEDTGFMGRSNCREIQATVARLRRRKVTTTLHWVKGHAGLEGNEKADSLAMEGRLKEEADDIDLEIDPDIRISGAKLKCISQ # SLAQKFIRQKKMKTKAYQNALNRRATACGVGRAKACAKETFGFTPTTEAIWKSTRHKDLGKKIRAFLWMLLHSGYKIGEYWEKIPGFESRATCTHCNT # SESMEHILIDCQAPGQKEVWELTKRLWEKTGVTWKGIEFGNILSCGLADFKDAKGKRKPEVWKKHHNITNNKPMDLDSREQTQPRLPAYLKEILQWED # IEGDDQKNLGQWSWTKTNSSKHSKTPGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 Scaffold_7 AUGUSTUS gene 1542158 1542700 0.56 - . g305 Scaffold_7 AUGUSTUS transcript 1542158 1542700 0.56 - . g305.t1 Scaffold_7 AUGUSTUS stop_codon 1542158 1542160 . - 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_7 AUGUSTUS CDS 1542158 1542700 0.56 - 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_7 AUGUSTUS start_codon 1542698 1542700 . - 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MTKALTIKLAKAALKLSNPAGRICSGRHIYNQIWLSKLIIDLAETTEQDGTIIALDQEKAYDKIKHDYLWQTLKAYGI # PDEFVNTVKALYSDAPTTILVNGNKSTNSFKVTRGVRQGDPLSCLLFDIAIEPLGEMLRKSNLRGFDIPGKTERLIATFFADDTTVYLSKGRRLRQSS # DNPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 Scaffold_7 AUGUSTUS gene 1543061 1543804 0.7 - . g306 Scaffold_7 AUGUSTUS transcript 1543061 1543804 0.7 - . g306.t1 Scaffold_7 AUGUSTUS stop_codon 1543061 1543063 . - 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_7 AUGUSTUS CDS 1543061 1543804 0.7 - 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_7 AUGUSTUS start_codon 1543802 1543804 . - 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MPYSYEWKIESPGVATDHDMISVRYTCETAPIIGQGRWVLPKYLMYDITIKKFLDEDGKQLESEMDRVDGNTDWNPTD # NHQTLWSNFKKRFTKLARERAKIVIPRLAKQIADLEAKIDTISNDIQITEEERSLSTAALKDALATLEERRYKTVRTTARTKFTIQSETISRYWSNLN # KDRTKRDLIQRLEIQTQHDEPVNHSPDIQGEPTYETNSLRMADMMKEYHESLQKDLQHRMRMYADKLPMKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 Scaffold_7 AUGUSTUS gene 1543849 1544397 0.78 - . g307 Scaffold_7 AUGUSTUS transcript 1543849 1544397 0.78 - . g307.t1 Scaffold_7 AUGUSTUS stop_codon 1543849 1543851 . - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_7 AUGUSTUS CDS 1543849 1544397 0.78 - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_7 AUGUSTUS start_codon 1544395 1544397 . - 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MLDRRIGILVIGEAHMNADRRDDIDRKYGKDIKLYYSKLPDTPNAAGVAIILNKNITNTEGVQTHEIVPGHAMLLEYY # WHNTERLSVLAIYAPNTDTPSNTNFWVKVREFFAHHPRIRKPDFMIGDCNMVEEPLDRLPARSDNTLTVDALDELKNAIQVEDGWRNTYPTTLQYTYR # QNGLVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 Scaffold_7 AUGUSTUS gene 1551111 1553777 0.06 + . g308 Scaffold_7 AUGUSTUS transcript 1551111 1553777 0.06 + . g308.t1 Scaffold_7 AUGUSTUS start_codon 1551111 1551113 . + 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_7 AUGUSTUS CDS 1551111 1551349 0.42 + 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_7 AUGUSTUS CDS 1551436 1551674 0.2 + 1 transcript_id "g308.t1"; gene_id "g308"; Scaffold_7 AUGUSTUS CDS 1551986 1552335 0.79 + 2 transcript_id "g308.t1"; gene_id "g308"; Scaffold_7 AUGUSTUS CDS 1552456 1552794 0.99 + 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_7 AUGUSTUS CDS 1553031 1553777 0.77 + 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_7 AUGUSTUS stop_codon 1553775 1553777 . + 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTCTLVTDNL # SNHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGPGGPGAGAKEWFVPDILDPDLDSL # PAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEFFVL # TIPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETP # EATIEVVEEDSEKSAALNSIPTTKISPVNLRLFDGSLSSKPITDMANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRN # TSHLDSPQTSVPSAVNTVDAKVAVPLPEPSPSVSPTILETPPGDSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAV # FNRACKDAGMEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYASLQTSSTRLLQIHFLNTDLTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 Scaffold_7 AUGUSTUS gene 1561365 1561964 0.79 + . g309 Scaffold_7 AUGUSTUS transcript 1561365 1561964 0.79 + . g309.t1 Scaffold_7 AUGUSTUS start_codon 1561365 1561367 . + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_7 AUGUSTUS CDS 1561365 1561964 0.79 + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_7 AUGUSTUS stop_codon 1561962 1561964 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MSLPSTRLESPPSNDTENRKLSRYQTKNPRTCDLRSGERQESFFPVTESELDEWFREERRLRRAETIKLQEELERRQE # ERRAAWEDEEAQREQEWKAWLRKQRAEPGLRKWFFWRNRLKEPNPPKRLSVDSLGGSSAPPSREVPAKHEPADPHNIDPVITDAPAQLMACPAMEGAL # ENVQVQSGMVGRSSEDKKIDALP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 Scaffold_7 AUGUSTUS gene 1563873 1565405 0.83 + . g310 Scaffold_7 AUGUSTUS transcript 1563873 1565405 0.83 + . g310.t1 Scaffold_7 AUGUSTUS start_codon 1563873 1563875 . + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_7 AUGUSTUS CDS 1563873 1565405 0.83 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_7 AUGUSTUS stop_codon 1565403 1565405 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MWEGQDRVVGDGSEWSVSEDWEAVTGLVNDVFGVSVGDRVLQDGDATDWKALSDRFVHEPVFTEVVEALRVLESPASD # KVKQKAKHKAARYMVENNRLWKVGGNAGIRERARVECVTQKEAIVLAKAQHGEAGHWGRDAVKLALMDRIWSPKLDESIMEAIVSCPECKNFGSTHLH # ALLNPITRRHPFELLVGDYLSMSKGKGGYKTIGLYLDTYSQRVWAFKFKVAGSGTTTSGSLTSLFNGYLPPETFMTDNGTHFANKEVEALCARWGTKQ # HFTPAYSPWVNGLVEGSNKILLHVLKRLCAPKLGEDSAEFTAMTWDTLPDQWPEHLDEAVRIINNRILPSVKFSPNELLLGAVVNTRRTPVAEAASVL # PRESVAVQAAYVDQQQLDGYNAFVNHAVKRKRVFDRRVLKKEGREVVFKKGDLVQVYRSDLDYTFKTIKKIIPKWSRPYRVVERDVNSYTLETVDGQL # IEGKQFAARRLREFKPRLGTKLAAAQQLIIRRREENEGSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 Scaffold_7 AUGUSTUS gene 1566096 1566779 0.95 + . g311 Scaffold_7 AUGUSTUS transcript 1566096 1566779 0.95 + . g311.t1 Scaffold_7 AUGUSTUS start_codon 1566096 1566098 . + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_7 AUGUSTUS CDS 1566096 1566779 0.95 + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_7 AUGUSTUS stop_codon 1566777 1566779 . + 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MSTNQVNVPIFPEESKLTGKDSWSRFKAAVELTAQLRGYTGYLDGTIVKPPSSLYSSAAGSVYPSVTATPAYSPTPYP # EEWYMRDRFVAATINLNTVDATGLGIDLAKSAANIWKDFDRKFERKDEQLIYLADHALRTEKFDPDSCTMEDHEKKMKNLKKKLTDVGGTLTDAQFGL # LSWHLFPLTGSPRLGMSQGKVVTKHSSTSIQSTANVNPRVTRSSNRIRSGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 Scaffold_7 AUGUSTUS gene 1568466 1569203 0.92 + . g312 Scaffold_7 AUGUSTUS transcript 1568466 1569203 0.92 + . g312.t1 Scaffold_7 AUGUSTUS start_codon 1568466 1568468 . + 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_7 AUGUSTUS CDS 1568466 1569203 0.92 + 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_7 AUGUSTUS stop_codon 1569201 1569203 . + 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MDRRGYRLWIPEWRVVLENRDVRFEEGPAKRTVSRQLENEHEIGDTDVGNKSGITEDLRLDVEELDVDDTMAEHQDPA # AAVPPFPIHRDDAPEILPADENEPSNSPPPVIPDLPDLPLPSPPAYPQPLRRSARLKIPSTRYLESKEFESREQEANNQGKDWATETAFARICADPWS # FATSTKVDNIPSGYKQAMKDPDLWREPMEVEYKMLMEKQVWTLVELPPGANLMGGKWVFAIKRGIGRNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 Scaffold_7 AUGUSTUS gene 1569285 1570594 0.58 + . g313 Scaffold_7 AUGUSTUS transcript 1569285 1570594 0.58 + . g313.t1 Scaffold_7 AUGUSTUS start_codon 1569285 1569287 . + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_7 AUGUSTUS CDS 1569285 1569912 0.61 + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_7 AUGUSTUS CDS 1569978 1570594 0.92 + 2 transcript_id "g313.t1"; gene_id "g313"; Scaffold_7 AUGUSTUS stop_codon 1570592 1570594 . + 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MESVRIVLAIIACLGLSLFQVDFKSAFLNSPITHDVYMKQPEGFIQPGRENLVCKLQRSIYGTMQGSHDWQATLSSGF # KEDGYTSSRADPCIRSRRRGGEYVITSTYGDDVCGGASSEPERQEAIRELGKRWESNEVGSGMLLGMSISQDPSTRAITISQQGYFTRMLEHFGLQDV # QRRKTPLPVGVQLEQSPEPLPHDEQVFMADKPFPYLARFQSNPGRAHWEGLIWLSGYIRWSVHYCIVYRKPEVGEVSSGKGIQPAGFSDSDLANCLDT # RRSTSGYVFFMAGAPVAWSSKRQGSVATSTVAAEYIALARASEQATWLASFLVEVDLAQDGPVIISADNTGSVSLTENSKKLGLVKHIDTKHHHIREK # VDEGKIAINLIRSGENVADILTKALSGPMVHKFVKMLGYCTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 Scaffold_7 AUGUSTUS gene 1571127 1571747 0.48 - . g314 Scaffold_7 AUGUSTUS transcript 1571127 1571747 0.48 - . g314.t1 Scaffold_7 AUGUSTUS stop_codon 1571127 1571129 . - 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_7 AUGUSTUS CDS 1571127 1571747 0.48 - 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_7 AUGUSTUS start_codon 1571745 1571747 . - 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MFESGFGMDDFLVHKSKLRITQCVESLVQYLPGDKERDRLEARSWQHLGNLFDELPRLDTSLIVDVNRSLYKPTLLNY # ISAPEPLIFRIIYGPALFANRNSQHAAKKKGVHSSNSLLKFISGSTKYRPTNSPSKSNYHPYSDGTNNFTLLISSQPEFGRHTSDKHNRRKASTRSVV # VRAVSVASDYTLVDVDDDATVIGDDERWKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 Scaffold_7 AUGUSTUS gene 1590905 1591306 0.32 - . g315 Scaffold_7 AUGUSTUS transcript 1590905 1591306 0.32 - . g315.t1 Scaffold_7 AUGUSTUS stop_codon 1590905 1590907 . - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_7 AUGUSTUS CDS 1590905 1591306 0.32 - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_7 AUGUSTUS start_codon 1591304 1591306 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MVQNHDKPVPTFISSKDQRMRPAGVYEMRSREARSPNCSAGGTRELEALATLIVASTTSGDSSSTGGARSTPSGRDFE # SSDDTGSDNMASLCVGILEDPDIAETAASAGSVSNIASGDDCANVGGAHQNLVRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 Scaffold_7 AUGUSTUS gene 1592656 1593165 0.9 - . g316 Scaffold_7 AUGUSTUS transcript 1592656 1593165 0.9 - . g316.t1 Scaffold_7 AUGUSTUS stop_codon 1592656 1592658 . - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_7 AUGUSTUS CDS 1592656 1593165 0.9 - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_7 AUGUSTUS start_codon 1593163 1593165 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MKTALCSKSDSGSYCALSATSTSSSAAASASGASAATLASQAQQYISTSSGTVNSTTFSTTNLAFMFLQSTLTSAQCT # TCTRNIMTSYINFESNAPYAPGIASSSLLSQQTSVYNAITSVCGSNFLSGVVQAAGGISTGSSDNGSLRSSALDIRTIAAVIVGMTMAFML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 Scaffold_7 AUGUSTUS gene 1603721 1604053 1 + . g317 Scaffold_7 AUGUSTUS transcript 1603721 1604053 1 + . g317.t1 Scaffold_7 AUGUSTUS start_codon 1603721 1603723 . + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_7 AUGUSTUS CDS 1603721 1604053 1 + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_7 AUGUSTUS stop_codon 1604051 1604053 . + 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MRVSSASSELDETSDGSDVSCPLCSWVLKVTAGSPALEEVVFVDEDDGDDEYETDDEQSDFDSEVEDGQADVQAQAIK # RNMWMMLGGINLGESIIEEEEEDLDHFHQIDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 Scaffold_7 AUGUSTUS gene 1607060 1607566 0.6 + . g318 Scaffold_7 AUGUSTUS transcript 1607060 1607566 0.6 + . g318.t1 Scaffold_7 AUGUSTUS start_codon 1607060 1607062 . + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_7 AUGUSTUS CDS 1607060 1607566 0.6 + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_7 AUGUSTUS stop_codon 1607564 1607566 . + 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MAAASLPSPDYIGSSDESSEDINSSSRPRLKFKEKHRLLKLRLGPLRRIQTDLERRFGATALEPQSTSITTAAPFGSE # ESQSSRQSSKEFSINSSNGWKSAFEKIRAMRAAARADGDAHALRRLQETDDEIAEVIAGCRDDVKAIWEDPTVREMLSRGKTRVEDSAGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 Scaffold_7 AUGUSTUS gene 1616094 1617754 0.58 + . g319 Scaffold_7 AUGUSTUS transcript 1616094 1617754 0.58 + . g319.t1 Scaffold_7 AUGUSTUS start_codon 1616094 1616096 . + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_7 AUGUSTUS CDS 1616094 1616791 0.58 + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_7 AUGUSTUS CDS 1616878 1617754 0.88 + 1 transcript_id "g319.t1"; gene_id "g319"; Scaffold_7 AUGUSTUS stop_codon 1617752 1617754 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MLIHDLEAAALVDLNGTDKPSAPTQMIPAIAGFHTFKCYCYEFGTKFDSVKACHWLKFTASCDVECLETNLARAWCWR # FHKTFNVDLDMDSSKTLSWLRWAIDRGHRKCVLEGNSILQDLMPGSEVRAFHGKELLDSYRLLSTSGGGVGMPFFVPGKLRRLYHMDDFAALEQDIQA # ELTFRGVQSVDEIYVNSRGDGLLHMAAALGQLGTLKYLVETHHPNINKANSSREETPLERPLWWLSSFKEDEIPRIAARLVVAGASLTFPQSPSEFST # FALSRGQLRSKYVWADYDNFLLLPASPLSRAVMMESLSAVRALLTLGAHPLEGYRDPKLKPNTGLSVCPMVVAAALTHSDILKIFLDHIDLRTARPIR # LFSEIEMLEMALDSKVTIGDPFSVDRRVARLGPAYQESLTSTLRMLHDREICFQQEDDEATKQLVAKGSADMLYRLASVGQIDILRILLQLGHSARGY # AEVFPIVAAVQANNVPIFQLLVDYGADPTALYDFPTPGENELFFKFSLNGLIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 Scaffold_7 AUGUSTUS gene 1619659 1620009 0.66 + . g320 Scaffold_7 AUGUSTUS transcript 1619659 1620009 0.66 + . g320.t1 Scaffold_7 AUGUSTUS start_codon 1619659 1619661 . + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_7 AUGUSTUS CDS 1619659 1620009 0.66 + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_7 AUGUSTUS stop_codon 1620007 1620009 . + 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MAPLIPESLFNFVSNVPNNPTTDSPPVHAFTVVARILNDPQFKIPGTQFFETYYQLLDKHAMALVEYANEWTVDAQKL # ASDSKEIDRKIEELQWTNTILYAVSGYRKDKEFNADFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 Scaffold_7 AUGUSTUS gene 1622571 1623527 0.93 - . g321 Scaffold_7 AUGUSTUS transcript 1622571 1623527 0.93 - . g321.t1 Scaffold_7 AUGUSTUS stop_codon 1622571 1622573 . - 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_7 AUGUSTUS CDS 1622571 1623527 0.93 - 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_7 AUGUSTUS start_codon 1623525 1623527 . - 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MDEAAMEAAGTEVPPFLDDDDEPKPYGASAYGGGYGPSGGYGAQGDWSSSGAGGGGYSDTASHGTYAQPPMSHESYPM # HDFGPSHNPGVGVGGVYDPTGAFVGGAAAAGVQHAMSDNSRSNGSSTAIGDSPYPAFLQHDAYENSGGGVGPGGYPTMGRSGGFNNDVIAGGAAGMAG # IGRRSSMNATALNRMKSQNSTGALSAPSSGSSHPAQPESYASHFTPGYAGPSQQDSMNRSTSAGSGPIPEASEPGFIAAGANFSSAVHDAAFGQQNQQ # TALPNPFTARLESDENADGGAEDPYGGYGSEEEEEQPRKVLKVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 Scaffold_7 AUGUSTUS gene 1623864 1624414 0.56 - . g322 Scaffold_7 AUGUSTUS transcript 1623864 1624414 0.56 - . g322.t1 Scaffold_7 AUGUSTUS stop_codon 1623864 1623866 . - 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_7 AUGUSTUS CDS 1623864 1624290 0.99 - 1 transcript_id "g322.t1"; gene_id "g322"; Scaffold_7 AUGUSTUS CDS 1624407 1624414 0.66 - 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_7 AUGUSTUS start_codon 1624412 1624414 . - 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MSVNTGTTTDTTTSTSLTSATSTSTSTTSTSTTSTTSSTSTTSTSTTSTSTSSSTTSSTTSATSTSTSTPPTTSSTSS # QTSNSLTGSTVGNPSTSATPTPTSITSLTTGADGQTSTVIVVTSVGSSTAPSSSSSADASTTGSKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 Scaffold_7 AUGUSTUS gene 1631675 1632139 0.99 + . g323 Scaffold_7 AUGUSTUS transcript 1631675 1632139 0.99 + . g323.t1 Scaffold_7 AUGUSTUS start_codon 1631675 1631677 . + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_7 AUGUSTUS CDS 1631675 1632139 0.99 + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_7 AUGUSTUS stop_codon 1632137 1632139 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MLLKYEHSTAQFYDHPIYVDDSPVRLADPTTTTQNEVGGDLRDYERTSQSLDLVYQGQPKMPNRKNDTGVQITSKFFV # TVIDARKRRNKDPSQDSNPTTSNPSTSLFAEKNVKSTSSRPTNQNRLTQAQLKELEAEKEKDVLRSYNRVKRSGMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 Scaffold_7 AUGUSTUS gene 1633098 1633436 0.96 + . g324 Scaffold_7 AUGUSTUS transcript 1633098 1633436 0.96 + . g324.t1 Scaffold_7 AUGUSTUS start_codon 1633098 1633100 . + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_7 AUGUSTUS CDS 1633098 1633436 0.96 + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_7 AUGUSTUS stop_codon 1633434 1633436 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MKLSDVAVKDPELLKWNVALKRWAPINPSTLSSGGRKNWDKDRDKDKDNDKDGADDLGEEDSDVGGVGTAENDTVSSN # DRPTLPIKDNPLTVAIYGQMCIAAKSYQSAICTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 Scaffold_7 AUGUSTUS gene 1636317 1636736 0.47 - . g325 Scaffold_7 AUGUSTUS transcript 1636317 1636736 0.47 - . g325.t1 Scaffold_7 AUGUSTUS stop_codon 1636317 1636319 . - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_7 AUGUSTUS CDS 1636317 1636736 0.47 - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_7 AUGUSTUS start_codon 1636734 1636736 . - 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MPVVAPPSPSDQDLRAAVVSLKSIHPTLGIAKIHALLLETHPDWIVSEKRTKKALQSEGLTLQSSQSTAQSVERSVAT # SDSLAQTKGSKASKASGSGVNNIFPSSKLIPNLDISKYSTKIEVKHFNKKKGKGLVAKEKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 Scaffold_7 AUGUSTUS gene 1637827 1638543 1 + . g326 Scaffold_7 AUGUSTUS transcript 1637827 1638543 1 + . g326.t1 Scaffold_7 AUGUSTUS start_codon 1637827 1637829 . + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_7 AUGUSTUS CDS 1637827 1638543 1 + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_7 AUGUSTUS stop_codon 1638541 1638543 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MASTSPTFSTSPPLSPSPPSLPPISSSDDYESLADSLTIPLSSMDSSTHSPPLPPPLPLPPAYTTDTQETFDKDDVEL # DLDPGLPALPPGLGGFGTSAGATEQLPEQSGTPLRILVPIPTVSSAADSISFAFPDPTATMDGELSILSKPLPQESEADVVIARRCFSTRILFSSITM # SLYTDLFSISADSTYVETSSAPWAMELKRRYDTLYGVNVIVRSPYAITAFVGQHGQKRYRIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 Scaffold_7 AUGUSTUS gene 1639176 1644552 0.33 + . g327 Scaffold_7 AUGUSTUS transcript 1639176 1644552 0.33 + . g327.t1 Scaffold_7 AUGUSTUS start_codon 1639176 1639178 . + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_7 AUGUSTUS CDS 1639176 1640818 0.43 + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_7 AUGUSTUS CDS 1641399 1641565 0.78 + 1 transcript_id "g327.t1"; gene_id "g327"; Scaffold_7 AUGUSTUS CDS 1641836 1644552 0.9 + 2 transcript_id "g327.t1"; gene_id "g327"; Scaffold_7 AUGUSTUS stop_codon 1644550 1644552 . + 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MPHVVGIDPANPPLIPSSSLFPNPTHITTPPTKLPERKGDSFGEIMGWRNHLIPSHMTGTSSGFSTSAPSTGYVAHST # HNLFFEPRVGNMHAIDPAHAKSVSTTAINDSGLPLSSATGSGFVPRPFGPGVHFETPAILRSNHSHRSTHHEGKPMNGSFRASTRSRSGSGSESGSGY # ESGSTSERDLESDPEDPESETESDYGRFLKVQNSPWAHRRLKEMQSFESGLTATPLPPVTPTLAGTSVASASNTPRTNSSTTTRLEVDLGDDINLNLG # EIVNIVDMALSENTGQKVIGRQRSAIKLVDRDREREKMVKARILETIEAEAADTPNFTSASASVSSSQSDAASYPLSEDGFSQETVSPSSPLHDQYPN # SSPQTHSSNLEPSDDTTHSLIDDIHKVPGSGVNDIESRSQPDFSTPQTPQTPRVQMYSPSGLPPRLAKFATYSTEIFDVLQTSRGLPRLDLLDLRVSD # QEDDVDITISNDSTDDDSNRRSSSRSSSRRTPLPETVPVKLSLSQDGSAAPKDDPRFVIWGRLRRRKQVDSQAVMHRRELRLYVANHLNDLAKELGDL # GREAELAGTEMGKEGREMKEMEMGMSRGAIVDGVVKESNRTGKENLFGENFAEATRKLSAASALTILDTDDSDVDLDFIDEPSSTSSPYSGVYGKTPV # NNVHLGGASTLNLSTAISPPGPGSIPLSSFSILQRTDHAPGPEFSSGPMYSSSMNANATTIPHNALSRVLVKTLGRLGRWKRVLNSGGVAHGVSMHRS # MTTGGLGKPHIGGGFSRMATACADVSAFDVELTVDSSDLLSSSGGVESYLRLVEGQSSQVPRNYLHTPSAALKLAKASSESPIATPSATSATTPSPVT # PTLLNSGSKTPNRHSFTDSLNEAHLPSSALPRSAPDDHIMSLPASDQSSEPPEAPQNRDSIAETESDYGAVTNVHELRDSLIPSPRANEESFNDVSQG # RESRATRRSSRTSSTGSFGEPLSASRASARFPAFTSPWQFDVVSLDDLSDNSSDEHDNANRSRDAPGDLPGLRRPPRRLPLRREFEFLERPETVSSMG # IISRSSIVSASSASGQSTASHTSSSSAAGGLGAGIQQWQMNALKDSLMDDEEPGDVDEALKRLEGQINPQKRLEKASKVNGWVKTIRERLAAGDYSDE # EPMYSDDDDDDAEVEPHEGSEDSFSRSAQGTESTSATMLASTDIPPPDADSVTATTPVVEQIDQVASPARSTDSKPAVEDAVPLEIRQSRLSSELPSV # TPERISKFVDPSIGPKVAHRSFVLLFKAEDLAQHFAMIDRELFMTIKFEELLLEDWMYCEEVDTLDWAQFLKDRARWKAEARLPEKTSALGAVRARFN # LMVNFTVSEIVLTNQAERLYVFSKFLRIAWVCFSLRSFYHISILIDFPFVQKSYQRNSFNTLVAIMTGLQSSWVTRAMRRSMNKLSIWDKRMLADLKL # FTSREDNFRHIRCAVDAINDAKPFEATSLASSVVSAVADSVNDQPTPSACIPFVGKLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 Scaffold_7 AUGUSTUS gene 1645683 1646434 0.38 + . g328 Scaffold_7 AUGUSTUS transcript 1645683 1646434 0.38 + . g328.t1 Scaffold_7 AUGUSTUS start_codon 1645683 1645685 . + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_7 AUGUSTUS CDS 1645683 1645698 0.54 + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_7 AUGUSTUS CDS 1645872 1646227 0.82 + 2 transcript_id "g328.t1"; gene_id "g328"; Scaffold_7 AUGUSTUS CDS 1646282 1646434 0.95 + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_7 AUGUSTUS stop_codon 1646432 1646434 . + 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MILLTHLEWKLIYVSCPENAALDQEIDSCLVGPVPPGVNSFEFQSPAPDHKLIPEQDLLGVAALILTGSYAEQEFVRV # GYYQNTEYEGGEEERLSMEGKKVAVERLVRDITKKPRVTRFQIKWYGRSPPQSTGALGAATSAAVPSADSYGDDDNEKDQMDVDTPTKSNGNIPIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 Scaffold_7 AUGUSTUS gene 1646879 1647271 0.83 - . g329 Scaffold_7 AUGUSTUS transcript 1646879 1647271 0.83 - . g329.t1 Scaffold_7 AUGUSTUS stop_codon 1646879 1646881 . - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_7 AUGUSTUS CDS 1646879 1647271 0.83 - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_7 AUGUSTUS start_codon 1647269 1647271 . - 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MASLETRSVAVVFEFADQHAAEAVPSRFRLPFTSSKAIKDKTAELSAQSTVKNLLQTLGFEGQLKPDSIFGGTSHQAE # GRIDFVAPNVPGFNGPCQGWATPSGNGELHGDKGGKTEVISVENGVKKVKGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 Scaffold_7 AUGUSTUS gene 1652422 1652918 0.6 + . g330 Scaffold_7 AUGUSTUS transcript 1652422 1652918 0.6 + . g330.t1 Scaffold_7 AUGUSTUS start_codon 1652422 1652424 . + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_7 AUGUSTUS CDS 1652422 1652442 0.74 + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_7 AUGUSTUS CDS 1652574 1652918 0.6 + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_7 AUGUSTUS stop_codon 1652916 1652918 . + 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MPEPASEEIGELRKQVDDASSRSSDAYAELDSANARALRQRDRLEELEEMVCSYRDRAHVAEGLIRQYPEDEGLYEVE # LPSLSEVQRKLDASEALVRRLATFAHRLYRADPANCSITITGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 Scaffold_7 AUGUSTUS gene 1656276 1657892 0.71 - . g331 Scaffold_7 AUGUSTUS transcript 1656276 1657892 0.71 - . g331.t1 Scaffold_7 AUGUSTUS stop_codon 1656276 1656278 . - 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_7 AUGUSTUS CDS 1656276 1657892 0.71 - 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_7 AUGUSTUS start_codon 1657890 1657892 . - 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVL # GHYNPDLPVVLECHASDLAIAGILSQLDPETGEIHPIALHAQSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSQHQIQVYSDHNNLQYFSTTKQLT # AQQARLAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPEHLNATILMNEDLLVNRVREAPKDTMMIKALKRIARNEE # ESLVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKCTKKLVNQLFFWKGLSKDVNYYIRSCHPCLRAKASHSKPYGNLHPLPIGQQPWS # SISLDHITQLPATAGPEKYDTILVVVCRLTKQAIYVPCHTTDKAEDFANLFITHIFSKHGMPSDITSDRGSRFVSQFWRELCRVLGIESRLSTAYHPQ # TDGQTKRVNQSVEAYLRIYCTYDQDDWDVLLPIAEFVYNNTPNTTIGVSPFFANKGYHPKLSITLERV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 Scaffold_7 AUGUSTUS gene 1658314 1659237 0.64 - . g332 Scaffold_7 AUGUSTUS transcript 1658314 1659237 0.64 - . g332.t1 Scaffold_7 AUGUSTUS stop_codon 1658314 1658316 . - 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_7 AUGUSTUS CDS 1658314 1659237 0.64 - 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_7 AUGUSTUS start_codon 1659235 1659237 . - 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MEQEVEKIQAGRSAMEKVTPQPAKDSEEAYQKWKSRDTNQSSSWSGAKQKVQWRKKRREHGPYPDLPTLDIESLNIPK # IPSRSGLTPKGSIRHNNFQRKQLIAGTHMVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSDPESAATKDLESG # NPSRNKGGSSRSSTKKQKHQETEELKKSIPVPIPGYLDVFLPGEARMLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSIKEYIDEMLGKGFIRSS # SSPAGAPVLFAKKKDGTLTLRRLLSSEQDYEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 Scaffold_7 AUGUSTUS gene 1665110 1665478 0.81 + . g333 Scaffold_7 AUGUSTUS transcript 1665110 1665478 0.81 + . g333.t1 Scaffold_7 AUGUSTUS start_codon 1665110 1665112 . + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_7 AUGUSTUS CDS 1665110 1665478 0.81 + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_7 AUGUSTUS stop_codon 1665476 1665478 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKSFPPRRKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 Scaffold_7 AUGUSTUS gene 1665958 1666680 0.8 + . g334 Scaffold_7 AUGUSTUS transcript 1665958 1666680 0.8 + . g334.t1 Scaffold_7 AUGUSTUS start_codon 1665958 1665960 . + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_7 AUGUSTUS CDS 1665958 1666680 0.8 + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_7 AUGUSTUS stop_codon 1666678 1666680 . + 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLILHRRLCLLLSTRCCKGRCS # ATGTSPSVSPTILETPPGDSPRSLAALGLTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAAD # RSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEALRRLSAVFILCLKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 Scaffold_7 AUGUSTUS gene 1673845 1674285 0.85 + . g335 Scaffold_7 AUGUSTUS transcript 1673845 1674285 0.85 + . g335.t1 Scaffold_7 AUGUSTUS start_codon 1673845 1673847 . + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_7 AUGUSTUS CDS 1673845 1674285 0.85 + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_7 AUGUSTUS stop_codon 1674283 1674285 . + 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MLLSSATAKVVHQKVPTNSAKGLLTKLEAQIVINYCLEMARRGFPLAHEQLKKEVDSILRSRLGDAFPQSGVGKQWTY # RFVQRYRKELKMFWASTLDEKRGRGVNPYTNKQYFDLLEETLAGKRDHEFDEPNNHGSNDWVDVGGKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 Scaffold_7 AUGUSTUS gene 1676536 1677150 0.71 + . g336 Scaffold_7 AUGUSTUS transcript 1676536 1677150 0.71 + . g336.t1 Scaffold_7 AUGUSTUS start_codon 1676536 1676538 . + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_7 AUGUSTUS CDS 1676536 1677150 0.71 + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_7 AUGUSTUS stop_codon 1677148 1677150 . + 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWGTPHLLHFNAENPP # FGGNWEAFLKEFSQRFEPMDPGMEARARSRISGKVKDRQLRNSLRSSRISEIGLKCLILTCGNVSSLHYSRDPTTPHHRKHCPRNCSDSEGGNQTGHI # GGCLPARSHHDWPELWIPSHAYRSYYPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 Scaffold_7 AUGUSTUS gene 1677661 1678776 0.85 + . g337 Scaffold_7 AUGUSTUS transcript 1677661 1678776 0.85 + . g337.t1 Scaffold_7 AUGUSTUS start_codon 1677661 1677663 . + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_7 AUGUSTUS CDS 1677661 1678776 0.85 + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_7 AUGUSTUS stop_codon 1678774 1678776 . + 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYRSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 Scaffold_7 AUGUSTUS gene 1680106 1681371 0.74 + . g338 Scaffold_7 AUGUSTUS transcript 1680106 1681371 0.74 + . g338.t1 Scaffold_7 AUGUSTUS start_codon 1680106 1680108 . + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_7 AUGUSTUS CDS 1680106 1681371 0.74 + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_7 AUGUSTUS stop_codon 1681369 1681371 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MPDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPN # SQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKY # IRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQF # KVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDS # RVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 Scaffold_7 AUGUSTUS gene 1688033 1692495 0.34 - . g339 Scaffold_7 AUGUSTUS transcript 1688033 1692495 0.34 - . g339.t1 Scaffold_7 AUGUSTUS stop_codon 1688033 1688035 . - 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_7 AUGUSTUS CDS 1688033 1689936 0.58 - 2 transcript_id "g339.t1"; gene_id "g339"; Scaffold_7 AUGUSTUS CDS 1690047 1692495 0.34 - 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_7 AUGUSTUS start_codon 1692493 1692495 . - 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MENGTVGMGIPTHGEFEVFDSGGSWKFLFGKPLLERFSAVHDYGKESLVLHGKQGSWREVFNGGLGAVVAPEPTPVLE # DRSQQGMPRPTAQAQVVLEESVGPAGGVIVKALTPLDREVDNLCCDKQNSVANTARQRQPEATILSKHHAPQIEEVPDEDFAQPRSNLSAPEHPLGWE # EDTDDEEWQMTEAELEGWYKELRRLHREESIKRQEELELRQQERRKIWEEEEERREADWVAWLRRQRAEPGLRKWFFWRNRLRDPSPPRRLRVDSLGE # VTHPSREVSADAGGTAAHHIDHMSAERQPHNATNPTTETTSGASRREGTGDNTENMPDGSRVDSVGGFDVPPSREVLSEDSGANPQHADRSRTVPICV # LQANEDYPSHSDVGLDFFPDALDQSEDVHLFTRNDGEKGAFRPERVREILRKVKIGPNLSAVQRSRVEQLLSDYADCFALSVGEVRPVKDAVHRLNIP # EGATFPKKVRQKSLTPPQREYLHAKVDELLEAGVIERCNPEEVKCVSPLTLAQKAHEGKGLTVEELMYKLNDECVAAGLPASFDLPTRPVQPSEPTER # TESIKPAKWRICQNFMAVNKLTEIAPMPQGNIRSKQQSLSGHNYICLFDCLFDFASGFYACEVERESRPYTAFYVEGKGYFWCAKLPFGLTGAPSTFA # NMTALHLDDLIADGTIELFVDDGGSADDDFDTMFTKLTRILDRVRSRDLSLSAAKSEFFMSEGIFAGGKVSKDGVTVDPAKLTAVVEWKQPEDALNLA # SFVGLTGHFRDLIRNYARIEGPLRNLLKSVHYHRITPNRHTGRPWNHSNSLTNGCKEGFAAVVAQRFEVVHPNGTTTYKTHPVGFASKRTSTSEQNYK # PFLLEFAALKFGLDKFSDMIWGFPVEIETDCQALRDVIANDKLNAAHSRWRDGVLAHHIVDVRHIPGKLNVVADGLSRMWEGHDRKVGDGSEWTVSED # WEAVTGLVNDVFGVRMAEGLMESGDVTDWEALLRRFEGEPVFREVLNALRVLEGPADEKEKQKAKHKAARYMVEDNRLWKVGGNDGIRERARVECVTR # KEAMELARVQHGDAGHWGRDSVKLALMDRIWSPKLDESVLEAITSCPECKNFGAAHIHALLNPITRRHPFELLVGDYLSMSKGKGGYKTVGLYLDTYS # QRVWAFKFKVAGSGATTTSSLTSLFNGYLPPETFMTDNGSHFANKEVETLCAKWGTKQHLTPAYSPWVNGLVEGTNKILLHVLKRLCAPKLGEDSEEF # QGMNWETLPEKWPEHLDEAVRIINNRILPSVKFSPNELLLGAVVNTRRTPVTDATSVLPQRQVEIQTAYVAQQQLDGYSAFVQHAVKRKRVFDRRVLK # KEGKEVVFRKGDLVQVYRSDLDYTFKTIKKIIPKWSRPYRVVERNVNSYTLQTTDGQLIEGKQFAARRLREFKPRAGTKLALEQQEVVRRREKSEVST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 Scaffold_7 AUGUSTUS gene 1695943 1697934 1 - . g340 Scaffold_7 AUGUSTUS transcript 1695943 1697934 1 - . g340.t1 Scaffold_7 AUGUSTUS stop_codon 1695943 1695945 . - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_7 AUGUSTUS CDS 1695943 1697934 1 - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_7 AUGUSTUS start_codon 1697932 1697934 . - 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MARSHPYNTILASLSSFTAHESTEVIDLVLTIMASRDIPSDRSLINILLRDQADRAGGHRKSYSSSSANTSADSGQTP # TSIVDDASEIGQIWNSISGHSEDTEIDRRERGKLRKKEQRQAFEKAFTLYGTLCQAHDAQQSQGVIPTVSVGTESVRNETESYKPSFRPDFFTFRTLW # DLLVRRPGWRFSSSPLPTSGATDARKANEDIIEDEYGFDLTIGSDEFDGDEFPSDEPSDVNDNASPPVAPVLPPRKLFHDMMRYHFSHLIKVSTSSLQ # KPKQRNNQSNPSNGDALDVKATAQSQFLLNTALLTFLNRSPSGGGADYAAAMVVLKCFGVHSYGSMGLALMETQEEIEGEGRAQTSVAEGGTTAAELT # SLPRIPQIPVPLRTYRIILRHLTQSVTSDLRLALRQGTGKGSYWARWVLSIGAGDFRQFRWLLSSAASRKMQADQVHDGGKKGNTDKTKRPTEKIIGR # ILKISSIPVSNATPLDPFSLQHSTELRAATTNPHHHSFHRDFYYFNKRDPLISGLSSTPSALSALSALYVPTYAQISRTAPLPALMYYHSDEPSRPHG # VKGVKNKQSLHNRLQSRSLNPAPLEIMIKRAWVASNYSNYTDYPDSPNHSEYLREDGKETEEQDGEYEGETRRLELLLRIFDTEVDKARREMICL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 Scaffold_7 AUGUSTUS gene 1701077 1701675 0.49 + . g341 Scaffold_7 AUGUSTUS transcript 1701077 1701675 0.49 + . g341.t1 Scaffold_7 AUGUSTUS start_codon 1701077 1701079 . + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_7 AUGUSTUS CDS 1701077 1701257 0.49 + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_7 AUGUSTUS CDS 1701296 1701675 0.72 + 2 transcript_id "g341.t1"; gene_id "g341"; Scaffold_7 AUGUSTUS stop_codon 1701673 1701675 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MAGTESTTVAGGALEDEEVYRAREKKELESLVHPDLKADVGSSTTGLYELVGELYIEFLSSIITHKGAAADSGHYMAF # VKKSVFHGPPPTLYTGPAADNANTTNPESAPTGTADPNAMDTDDTSAGTASDKGKQPTSDAYAYEDDEDWYKFDDDKVSVFPKEKLSTLDGGGEDSSA # YVLLYRSKDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 Scaffold_7 AUGUSTUS gene 1701804 1703144 0.65 - . g342 Scaffold_7 AUGUSTUS transcript 1701804 1703144 0.65 - . g342.t1 Scaffold_7 AUGUSTUS stop_codon 1701804 1701806 . - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_7 AUGUSTUS CDS 1701804 1703144 0.65 - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_7 AUGUSTUS start_codon 1703142 1703144 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MTHAHFALMGGFTLCPIDKNGDITAMKLLALPKGSRSGVNHLYNLPDDFDTATFIGQIDEEEIQDRSHSDGLTKVIAI # GQTGWFIIQLAARWVQDLPFTELEVMTVAFATINIMTYTFWFKKPLRVQYPIRVQATRDDLEKVKESDSDIKSSPIALPLSRPSSTHSLDNDRELEST # PDLDDVDRNISYNHASMPDEEQSEPFLSDLGAGETVPFMELNPISESAALSQPHDSNGNYAPKDRFQEAFVIGWDNVFSVDFRRTHLLHKIAFFIFFI # IFMPVRAVFSYFLGLSRAEDNSSEEVLYQDEQDVNEKIEELLKGNDLRFKIYKISLLIPCAVAALFGLIHWIGWISTFPTRTEEITWRISSIVVTFIP # VHVELAYKAYAQRHDILLTAPDFLKYVFGIIWYIAPLAYVMARWILIVQSFLTLRDLPCGALQNVEWTDYIPHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 Scaffold_7 AUGUSTUS gene 1705081 1705672 0.55 + . g343 Scaffold_7 AUGUSTUS transcript 1705081 1705672 0.55 + . g343.t1 Scaffold_7 AUGUSTUS start_codon 1705081 1705083 . + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_7 AUGUSTUS CDS 1705081 1705125 0.55 + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_7 AUGUSTUS CDS 1705217 1705672 0.93 + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_7 AUGUSTUS stop_codon 1705670 1705672 . + 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MGFISVVNAAPATIKVADSANSNIVSESHLESRTGEHHQAGEGVQHFPMIVVYITAIRAVVITTGHPPDKQLKFQDEV # VQSRLEARLKFYFKHTWKCDADINFVGNLEFIMVDVEGGFSFKYKKFPDYKKIRSGFVSESNPPSPLGSSYDSLNSDTHVTLQVPQRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 Scaffold_7 AUGUSTUS gene 1708998 1710321 0.11 - . g344 Scaffold_7 AUGUSTUS transcript 1708998 1710321 0.11 - . g344.t1 Scaffold_7 AUGUSTUS stop_codon 1708998 1709000 . - 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_7 AUGUSTUS CDS 1708998 1709377 0.89 - 2 transcript_id "g344.t1"; gene_id "g344"; Scaffold_7 AUGUSTUS CDS 1709433 1709644 0.74 - 1 transcript_id "g344.t1"; gene_id "g344"; Scaffold_7 AUGUSTUS CDS 1709760 1710188 0.24 - 1 transcript_id "g344.t1"; gene_id "g344"; Scaffold_7 AUGUSTUS CDS 1710302 1710321 0.32 - 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_7 AUGUSTUS start_codon 1710319 1710321 . - 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MRNTSPISDTWAPEIGFACFDLDNNPVPQSQCAFGTSGFDVNGSSTFVADPDTNFNIEYGDGEFLTGTVGFDTVTVGN # MVVTNQEIGIVTNAAWEGDGFNTGLMGLASPNLTSVFQGTNPDDDEFPQTQIPYNPVFYSAVQQGVVSNPCNSDLDQNLGFIAFGGIAPVDVTDSAVT # VPVQGYNAASFLPENGSSVTYFYYTVDVESMSFTGNKKVFGTTNNIILDTGTTLDYVRESFSPFSPAISWVTNLTSLSATQVADAFAAAFDPPAVKDE # DEGVYVVVCSATVPEFTVNIGGVEFTVDPADNLLPLGIQDDEGNDLCASGTFGEDFVSFLRIGIWYAHPLLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 Scaffold_7 AUGUSTUS gene 1726447 1727199 0.55 + . g345 Scaffold_7 AUGUSTUS transcript 1726447 1727199 0.55 + . g345.t1 Scaffold_7 AUGUSTUS start_codon 1726447 1726449 . + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_7 AUGUSTUS CDS 1726447 1727199 0.55 + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_7 AUGUSTUS stop_codon 1727197 1727199 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVKKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKVVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFREAPVLGHYNPDLPVV # LECDASDLAIAGILSQLNPETGEIHPIAFHARSMISAELNYDIYDKELLAMWIASNNGGRTAKVPTPDPSVLRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 Scaffold_7 AUGUSTUS gene 1735967 1737082 0.81 - . g346 Scaffold_7 AUGUSTUS transcript 1735967 1737082 0.81 - . g346.t1 Scaffold_7 AUGUSTUS stop_codon 1735967 1735969 . - 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_7 AUGUSTUS CDS 1735967 1737082 0.81 - 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_7 AUGUSTUS start_codon 1737080 1737082 . - 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 Scaffold_7 AUGUSTUS gene 1737133 1738299 0.91 - . g347 Scaffold_7 AUGUSTUS transcript 1737133 1738299 0.91 - . g347.t1 Scaffold_7 AUGUSTUS stop_codon 1737133 1737135 . - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_7 AUGUSTUS CDS 1737133 1738299 0.91 - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_7 AUGUSTUS start_codon 1738297 1738299 . - 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 Scaffold_7 AUGUSTUS gene 1739517 1740012 0.57 + . g348 Scaffold_7 AUGUSTUS transcript 1739517 1740012 0.57 + . g348.t1 Scaffold_7 AUGUSTUS start_codon 1739517 1739519 . + 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_7 AUGUSTUS CDS 1739517 1739657 0.57 + 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_7 AUGUSTUS CDS 1739713 1740012 0.99 + 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_7 AUGUSTUS stop_codon 1740010 1740012 . + 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MVQAIGGDTTVLGPAFDEEIEVALDQGLESLPDDGSSGEEDEDDITPHMLSQQAGITTQITHRLTQEAQALLPRLYGI # DNALADIHTLPYSTELLEFQQVVEKLSMRLSHLRTKSAYLPEVTPSLETVSENGDRVVCPSPRTNGCQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 Scaffold_7 AUGUSTUS gene 1754510 1754839 0.53 + . g349 Scaffold_7 AUGUSTUS transcript 1754510 1754839 0.53 + . g349.t1 Scaffold_7 AUGUSTUS start_codon 1754510 1754512 . + 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_7 AUGUSTUS CDS 1754510 1754839 0.53 + 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_7 AUGUSTUS stop_codon 1754837 1754839 . + 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MVNQTSYANHANSGISTIWCDLTEDEFRKRDFGPSEDHNRAISTYCLLKGGHVTVIQGPVRAYATRFDDMEARTLESE # RGDLKELEIVVRILSYLCGGDIFIDFKAIPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 Scaffold_7 AUGUSTUS gene 1756783 1757124 0.57 - . g350 Scaffold_7 AUGUSTUS transcript 1756783 1757124 0.57 - . g350.t1 Scaffold_7 AUGUSTUS stop_codon 1756783 1756785 . - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_7 AUGUSTUS CDS 1756783 1757124 0.57 - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_7 AUGUSTUS start_codon 1757122 1757124 . - 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MTNSAVVKSRFNSSSSDYDPVRKTGLLPRGGAATQSKHKFGGSTSYAPEATYVLSGHVINNSNTVDTAHVSEQMGREG # QARAQRAEMRKQEDELLKKLLKKERAQGLDGEQVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 Scaffold_7 AUGUSTUS gene 1757370 1758727 0.75 - . g351 Scaffold_7 AUGUSTUS transcript 1757370 1758727 0.75 - . g351.t1 Scaffold_7 AUGUSTUS stop_codon 1757370 1757372 . - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_7 AUGUSTUS CDS 1757370 1758081 0.75 - 1 transcript_id "g351.t1"; gene_id "g351"; Scaffold_7 AUGUSTUS CDS 1758135 1758727 1 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_7 AUGUSTUS start_codon 1758725 1758727 . - 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MESVANQALKEKQKKEALRKQIALLQSQLSDEEELAPVSPKQKSTTQGVLVPRTPSPSVLLRYCSIICRSSCCLLGKK # RKVEELPAPPPRNVLSAAVSIINHTRTSAEQGDCIIPAKPLPSKLVQRLSKLHSDEDDASSKSVRRTSSFADKPPEPGSSKRDENLAIIESLELGPTE # HKPPFDDPHFERVEPNSGIRLKSRILPHEDLQDHLRGRYYLSPSRLYSSISLTPDKSGYDVPVDGDWITIAVVAERGPIKYTNPPVGIAKEEEADEDG # APSAGQGKGKDNIVRKNKSKPSDAPNPRRRYVNVKLIDFGSRKSSSSESKGHILGDAFLTLLLFEAEAVDLITEEYGKKLAHPRKVYRGGSGGAFEAM # AKLKEGDVIALLNPRIMKPFTVHILLYDVLSTKSHSCLVFLEFVYIKPSSRPQYPRRYSDKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 Scaffold_7 AUGUSTUS gene 1766303 1767216 0.62 + . g352 Scaffold_7 AUGUSTUS transcript 1766303 1767216 0.62 + . g352.t1 Scaffold_7 AUGUSTUS start_codon 1766303 1766305 . + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_7 AUGUSTUS CDS 1766303 1766446 0.95 + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_7 AUGUSTUS CDS 1766503 1767216 0.63 + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_7 AUGUSTUS stop_codon 1767214 1767216 . + 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MDGNAGNSSNSNTNSDQLSRLLQSFMATPNAQALEFMSQNQFPPMLLQSFLLSQALSQNSTGQTSSFPAPSSNPTPSQ # AGMTLAQSSAPSTSTTVGPPLQTLQSSQSNQAQNIPSPFSEERPVPPLPPFNQNQTLPIASSTSLPAQWPMHMQGPSAGFRHAHSAAVLPSSLPMPTQ # ASNIEAQPLSTVGSGSASLPPPPPPNADHILACKCKSQLLMDMDRSWALRDMLVSLQLQAFQVLQPFSGPIICVLTTQVSRFLRTPEKKRGVEKLSGH # LGLVVEIEFQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 Scaffold_7 AUGUSTUS gene 1770997 1772721 0.41 - . g353 Scaffold_7 AUGUSTUS transcript 1770997 1772721 0.41 - . g353.t1 Scaffold_7 AUGUSTUS stop_codon 1770997 1770999 . - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_7 AUGUSTUS CDS 1770997 1772721 0.41 - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_7 AUGUSTUS start_codon 1772719 1772721 . - 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MEGASVRELFSKINRFYIALERSPLDSRTMKAAVDVWPSVNLLLENSKVYDAGARILHHTIMLSHYRLYTWVSQSIEY # VLDHPSSHWWYRLINAVREIVESGTCGTFHFSSSEFLPMIEPPRTYLWNFQRKQHNQRTANILLVSRIIFHWLGVPIESDDKHRTQSLFLKSLMDSCG # TASILLLDEVWSAYSTPHHLCSIRSKRAYPSQTAIKKLGQTFLDHPILGSNRSIEIQQLIDALQTAHHAFVGLPASHDSPSSVIYTASLHSGSLLSPP # TLSNTPATSLLHVSRNDRIIFLRDWLLEIAEAYVRSPPLSVDQLSPEQRRVLEDSDSSCPFRELAQSRRQVSSPNGLYTHHSREGIFSALLFRGILFN # TEALHGTRHLGFFESFEIWTQFKAQYADRGEKYICNPRAYGTTKGRVSTNDENFWIASEILFEKLQDPNISFTTIWQFVVNARDDHKKKLFPSFGDLS # AYLLTVDLTYAQWIPWPDLDEVAQAVFVLAKGALHGLQKIGLVSANSYTKEEVVEGFKTLYRFLDEDPKFKMIKEAVVFDPFMVEHALCKMSKDRIYE # RANRSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 Scaffold_7 AUGUSTUS gene 1779823 1780480 0.31 + . g354 Scaffold_7 AUGUSTUS transcript 1779823 1780480 0.31 + . g354.t1 Scaffold_7 AUGUSTUS start_codon 1779823 1779825 . + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_7 AUGUSTUS CDS 1779823 1779840 0.32 + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_7 AUGUSTUS CDS 1779959 1780103 0.74 + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_7 AUGUSTUS CDS 1780161 1780480 0.92 + 2 transcript_id "g354.t1"; gene_id "g354"; Scaffold_7 AUGUSTUS stop_codon 1780478 1780480 . + 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MKSRRLARTALNTAQHTIEDSEEKLEKEKRKLDDYEESLGVEEKILEEVQDSLRDKTQKFYDQKESLQKDLQPWTAKI # NAKQKEIDVARGERDALVKKVESIQTTLHEAETHLEKVNSDQEEKVKLLSEAKSEKAELNDKKEAATERLNVRTLFFRTWSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 Scaffold_7 AUGUSTUS gene 1784987 1785319 0.77 - . g355 Scaffold_7 AUGUSTUS transcript 1784987 1785319 0.77 - . g355.t1 Scaffold_7 AUGUSTUS stop_codon 1784987 1784989 . - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_7 AUGUSTUS CDS 1784987 1785319 0.77 - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_7 AUGUSTUS start_codon 1785317 1785319 . - 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MDVLRMGLSGRDLDGGGVANVDPALRRNVIQPLKISETDESSDGGYLPEYSALPQTASTMSILSARSSMSTKQLRSIV # SPAYLIDAPLTVPLPPNTSSVFSSKTDQTTQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 Scaffold_7 AUGUSTUS gene 1810654 1811804 0.58 + . g356 Scaffold_7 AUGUSTUS transcript 1810654 1811804 0.58 + . g356.t1 Scaffold_7 AUGUSTUS start_codon 1810654 1810656 . + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_7 AUGUSTUS CDS 1810654 1811100 0.59 + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_7 AUGUSTUS CDS 1811178 1811804 0.66 + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_7 AUGUSTUS stop_codon 1811802 1811804 . + 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MTHISAGINEMSWELRTLRAVKILKGRAFHWHSPGTSRSGPIIDPSELGTLILDDELVAEDTETTSGSALYQIFLFDA # MLLCCLPGPQGNSLRHGYNDEHLGSARYPVRPWELGPALRRTVPLNLIYAIPTKEMVELRLLDSGKQNPRLDQASRFALSTLSLLFQCPSGQGQYNQW # TSALEEFVHTVIDARYTSFNPGGKPPHSNTKIKGYDGDDGDVQSLALSEDFPDDLSTELAKFNLSPESSNGRRHSHPRPWSLIARKGPHSESSSLHQQ # LLEEEGQELEDVLSPNMLPTLFTSISIGSKGSITPLSPIAVGGVMRDPAEFQHMVMPPTPPPEGDLGELVICSKPHDNHSNII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 Scaffold_7 AUGUSTUS gene 1812260 1815759 0.13 + . g357 Scaffold_7 AUGUSTUS transcript 1812260 1815759 0.13 + . g357.t1 Scaffold_7 AUGUSTUS start_codon 1812260 1812262 . + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_7 AUGUSTUS CDS 1812260 1812349 0.62 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_7 AUGUSTUS CDS 1812494 1812752 0.82 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_7 AUGUSTUS CDS 1814433 1814817 0.88 + 2 transcript_id "g357.t1"; gene_id "g357"; Scaffold_7 AUGUSTUS CDS 1815179 1815311 0.86 + 1 transcript_id "g357.t1"; gene_id "g357"; Scaffold_7 AUGUSTUS CDS 1815379 1815759 1 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_7 AUGUSTUS stop_codon 1815757 1815759 . + 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MEKWGDILSVTDRLQLLCEVAEGLCYCESFSNILIDDNKHACLCDFGLSSIVNEYQGASSTHSTISGAIRWADATLFM # AQAAQSEMEEPSDEQQGIMPMLTAKSDIYSFGSVTLEVMETYPQLIGYDTSFYDYIREQNHLCGYDLNLTYPQLGGKFPSIEVKYGSIGDRVPGLSRR # DSDLIGGSNRNVPPKNFNSPWSKRAKSQARRQNDSPGFNTTLTEEINDYYGCDIRDMVFEYTLNYTYPXTNPRSIDFMDELMANATAENIGILWFSGN # DDALSAHFSLEVAIQNTTWDGIQGFTQRPNTTWYDDNGIPSGIVHEERGLMYALVYGAGHQINTVHPERVFAFIRDFFVGDMYTGLVNATAKDTTTSN # DPGALPDGVVPGQREIYYGSKTVTWPEATITAFNNHLLSTMLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 Scaffold_7 AUGUSTUS gene 1819577 1821596 0.19 - . g358 Scaffold_7 AUGUSTUS transcript 1819577 1821596 0.19 - . g358.t1 Scaffold_7 AUGUSTUS stop_codon 1819577 1819579 . - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_7 AUGUSTUS CDS 1819577 1820051 0.53 - 1 transcript_id "g358.t1"; gene_id "g358"; Scaffold_7 AUGUSTUS CDS 1820434 1821596 0.19 - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_7 AUGUSTUS start_codon 1821594 1821596 . - 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MKILRLKCVFFQIVRPSIKDTKASYSASDASSGTLTFTCEHWSICSTRTDNIVLENTQMISVSESESSWAVYTTALTV # TSNRKQVGRAPLVAFTLDCQYMRIGTQLFELKNDKYYVSLYDTLSGDRYPTYVEEFAVRGPYAVFASRRRVKQEDIRKTGVSDDAVANLGVDFNAMEE # MVLLDDDDSSSSISSPENRSSSSICSSSDDSELNDAYESWSEGDTDVPEGVEFEEDRITPWSGPLRDPDEVGSSSESSSDSETSEQENEFPQPIGALD # ESSDEEIEFNPQVAGYGRWYDEDEDDGDDEDAYMYYAYGPTALFKTRPELQASISVFLIRSSDESPLLPAKLFHFTQELPISLYDSPPAIHPFKSLIV # WPIGRGDVLFADFSCHDNTLKVFRIDLFSSTAEVQKTCHTVAVPQKAIILPSTATKRKVHYMPPTPTDLKAKILIESEARVKGDFEVKTELHLGYEHH # RGGGVFGMEGAPVPISPPIGCFVDEDQDLGCWGPWKDLADVPDDFGIGHLDRRLEKFDFDDDCDCTFIISSLSER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 Scaffold_7 AUGUSTUS gene 1823509 1823913 0.94 - . g359 Scaffold_7 AUGUSTUS transcript 1823509 1823913 0.94 - . g359.t1 Scaffold_7 AUGUSTUS stop_codon 1823509 1823511 . - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_7 AUGUSTUS CDS 1823509 1823913 0.94 - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_7 AUGUSTUS start_codon 1823911 1823913 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MLKSFASGPESTGNVINTASGIPNLAAMSIDQQSAHSGIKSFLRVAVSFSTKKLDESIQEIETNVDTIDKLVPIIEAR # RARGEQEDAGRERVEAGIERLEARVERQAQREFREMYQDDRYSTYQPAFFNFKSPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 Scaffold_7 AUGUSTUS gene 1826807 1826995 0.58 + . g360 Scaffold_7 AUGUSTUS transcript 1826807 1826995 0.58 + . g360.t1 Scaffold_7 AUGUSTUS start_codon 1826807 1826809 . + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_7 AUGUSTUS CDS 1826807 1826995 0.58 + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_7 AUGUSTUS stop_codon 1826993 1826995 . + 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MVGSAQAIALDRNAPLTVEHVDTVLDVVNSWNSESSMSSEHLLDVGSSQSKENGQIEEDLLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 Scaffold_7 AUGUSTUS gene 1828843 1829181 0.7 - . g361 Scaffold_7 AUGUSTUS transcript 1828843 1829181 0.7 - . g361.t1 Scaffold_7 AUGUSTUS stop_codon 1828843 1828845 . - 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_7 AUGUSTUS CDS 1828843 1829181 0.7 - 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_7 AUGUSTUS start_codon 1829179 1829181 . - 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MPASNPAPTDPIKPITPPSRLIAPLEALVELALATLEPLPVVVALVPVEVLDALPPVISLRMEEASEANDPVNVAVME # DAIDAMRDVSERTALGIEGIEIPEGMVIVNLEKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 Scaffold_7 AUGUSTUS gene 1831153 1831425 0.47 - . g362 Scaffold_7 AUGUSTUS transcript 1831153 1831425 0.47 - . g362.t1 Scaffold_7 AUGUSTUS stop_codon 1831153 1831155 . - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_7 AUGUSTUS CDS 1831153 1831425 0.47 - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_7 AUGUSTUS start_codon 1831423 1831425 . - 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MGPEKIFKAIAFGRRTKYADSERRRRRNTSSSHRYPSFPKKKAVAYGSSEDEGSDDELSVKLHKTFELKGLDDSDDDL # PDLRHHASNEKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 Scaffold_7 AUGUSTUS gene 1835377 1835769 1 + . g363 Scaffold_7 AUGUSTUS transcript 1835377 1835769 1 + . g363.t1 Scaffold_7 AUGUSTUS start_codon 1835377 1835379 . + 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_7 AUGUSTUS CDS 1835377 1835769 1 + 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_7 AUGUSTUS stop_codon 1835767 1835769 . + 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MDFTDNTGANTTFNSQFNIEQSDIKIEYHPNSGKPTVIERFDIHTADHDHVPSNDSHLRPWLPFRTRMDFEVATLALE # CSMNDKQTEKLIMLLNHVQQGFDKCTLKDYKEVQDTWDLAAEKSTKVCNSIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 Scaffold_7 AUGUSTUS gene 1839948 1841410 0.45 + . g364 Scaffold_7 AUGUSTUS transcript 1839948 1841410 0.45 + . g364.t1 Scaffold_7 AUGUSTUS start_codon 1839948 1839950 . + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_7 AUGUSTUS CDS 1839948 1840668 0.61 + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_7 AUGUSTUS CDS 1840734 1841410 0.69 + 2 transcript_id "g364.t1"; gene_id "g364"; Scaffold_7 AUGUSTUS stop_codon 1841408 1841410 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFTLKPKVEDEFKDLLGIKLESLIPRELTEEQQQMV # ALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLL # EFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEDYQIDLGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 Scaffold_7 AUGUSTUS gene 1841458 1842396 0.73 + . g365 Scaffold_7 AUGUSTUS transcript 1841458 1842396 0.73 + . g365.t1 Scaffold_7 AUGUSTUS start_codon 1841458 1841460 . + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_7 AUGUSTUS CDS 1841458 1842396 0.73 + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_7 AUGUSTUS stop_codon 1842394 1842396 . + 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MEKKSTPMKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPK # SIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKK # IFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQ # KDIVESFLRDLSIDDERRNIAIVANQAWHMKTIVIIQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 Scaffold_7 AUGUSTUS gene 1842558 1843730 0.15 + . g366 Scaffold_7 AUGUSTUS transcript 1842558 1843730 0.15 + . g366.t1 Scaffold_7 AUGUSTUS start_codon 1842558 1842560 . + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_7 AUGUSTUS CDS 1842558 1842701 0.18 + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_7 AUGUSTUS CDS 1842984 1843730 0.6 + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_7 AUGUSTUS stop_codon 1843728 1843730 . + 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDQNIVLDGYKRCEQETFSKKELSEAYVLASR # EHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSEST # ETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKL # NQQDRSPINLIDETNKQVIMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 Scaffold_7 AUGUSTUS gene 1844804 1845832 0.77 + . g367 Scaffold_7 AUGUSTUS transcript 1844804 1845832 0.77 + . g367.t1 Scaffold_7 AUGUSTUS start_codon 1844804 1844806 . + 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_7 AUGUSTUS CDS 1844804 1845832 0.77 + 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_7 AUGUSTUS stop_codon 1845830 1845832 . + 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 Scaffold_7 AUGUSTUS gene 1845876 1847270 0.95 + . g368 Scaffold_7 AUGUSTUS transcript 1845876 1847270 0.95 + . g368.t1 Scaffold_7 AUGUSTUS start_codon 1845876 1845878 . + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_7 AUGUSTUS CDS 1845876 1847270 0.95 + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_7 AUGUSTUS stop_codon 1847268 1847270 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYK # DVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTD # NAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVEST # WLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKG # GSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 Scaffold_7 AUGUSTUS gene 1859237 1860445 0.48 - . g369 Scaffold_7 AUGUSTUS transcript 1859237 1860445 0.48 - . g369.t1 Scaffold_7 AUGUSTUS stop_codon 1859237 1859239 . - 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_7 AUGUSTUS CDS 1859237 1860445 0.48 - 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_7 AUGUSTUS start_codon 1860443 1860445 . - 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGAKYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL # EKHDLYLRPEKCEFEQQQIEYLGLIISEGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 Scaffold_7 AUGUSTUS gene 1860812 1861978 0.86 - . g370 Scaffold_7 AUGUSTUS transcript 1860812 1861978 0.86 - . g370.t1 Scaffold_7 AUGUSTUS stop_codon 1860812 1860814 . - 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_7 AUGUSTUS CDS 1860812 1861978 0.86 - 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_7 AUGUSTUS start_codon 1861976 1861978 . - 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSVPAPVAATPSPPNQDFSNQIGQIRELLD # RANTMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 Scaffold_7 AUGUSTUS gene 1867003 1867446 0.48 - . g371 Scaffold_7 AUGUSTUS transcript 1867003 1867446 0.48 - . g371.t1 Scaffold_7 AUGUSTUS stop_codon 1867003 1867005 . - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_7 AUGUSTUS CDS 1867003 1867243 0.98 - 1 transcript_id "g371.t1"; gene_id "g371"; Scaffold_7 AUGUSTUS CDS 1867349 1867446 0.48 - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_7 AUGUSTUS start_codon 1867444 1867446 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MTGIVVEDAPTGIRSGKASGALVLATCTSHTRDVKASRNPDGSVCLAIAQPADRKETAPTPDDTPLHTPALSRVPSAT # DIFTKIHSGTATPREPGTEIDDYGARGIKAMGGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 Scaffold_7 AUGUSTUS gene 1875685 1876657 0.76 + . g372 Scaffold_7 AUGUSTUS transcript 1875685 1876657 0.76 + . g372.t1 Scaffold_7 AUGUSTUS start_codon 1875685 1875687 . + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_7 AUGUSTUS CDS 1875685 1875829 0.93 + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_7 AUGUSTUS CDS 1875879 1876657 0.79 + 2 transcript_id "g372.t1"; gene_id "g372"; Scaffold_7 AUGUSTUS stop_codon 1876655 1876657 . + 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MRELSELKKSPPEGIRVQTSEDNILDVIGIIEGPGKLDSTLTPAGQASRGYFKVKFRFTEEFPAAPPKCTFATKIFHP # NVSNSGEICVNTLKKDWKSTYGIGHILVTVKCLLIYPNPESALDEEAGKLLLEDYQAYASRAKLITSVHATPRTKPVEFLSSSISGEDPSEAGPSVPT # SSSCVPTPFTQTPSPSLQSSLPIIVTSKPQSQSHPSPPSATALSIPLTPSPSSNKESLVSNKERHPSPSPLSTADANIENDKFKASAAVVDKNKMSLV # STTASHGPKAVKRAATGGGATNAEKRKKALKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 Scaffold_7 AUGUSTUS gene 1877472 1878445 0.11 - . g373 Scaffold_7 AUGUSTUS transcript 1877472 1878445 0.11 - . g373.t1 Scaffold_7 AUGUSTUS stop_codon 1877472 1877474 . - 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_7 AUGUSTUS CDS 1877472 1877841 0.49 - 1 transcript_id "g373.t1"; gene_id "g373"; Scaffold_7 AUGUSTUS CDS 1877928 1878445 0.11 - 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_7 AUGUSTUS start_codon 1878443 1878445 . - 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MEAQGEATFDASDSSAVDLPNAMTLPDILSVQAHPMERIEGSPNHNILVPYPFDLSSGRSLDLGFSYNPTQYQDHTSY # PCAPENRIGVAIASTSTAAQLPQMIQLPGAPQFPSLTHLLDQQNEGFIHRSDAQNVGSYSSPLPHQLVDSEYLSNHRNAFIPPSTTTTRISSFSRLQP # PKAALQAVQPILASAICRILDEHGRECGTNLTPENVNGHIQGHVDRLKPAPAKGKQTNSAHREKLRLACAWNMGEEGRAAGDILHDDGCGYQRVETTF # PHASQDQGPLSGSRLHERADG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 Scaffold_7 AUGUSTUS gene 1880860 1881339 0.25 + . g374 Scaffold_7 AUGUSTUS transcript 1880860 1881339 0.25 + . g374.t1 Scaffold_7 AUGUSTUS start_codon 1880860 1880862 . + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_7 AUGUSTUS CDS 1880860 1880881 0.25 + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_7 AUGUSTUS CDS 1881005 1881339 0.7 + 2 transcript_id "g374.t1"; gene_id "g374"; Scaffold_7 AUGUSTUS stop_codon 1881337 1881339 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MRERHEESYPDLESHFSTAHYACTHPECLQRKFVVFGSALDLQAHMVDEHGASRKVVGIEFASGAGGGRDIGSRNNRD # PPPRQQPPPLPPPAPSQNQSRRRQAFGGALTSGGGLNLNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 Scaffold_7 AUGUSTUS gene 1882057 1882422 0.95 - . g375 Scaffold_7 AUGUSTUS transcript 1882057 1882422 0.95 - . g375.t1 Scaffold_7 AUGUSTUS stop_codon 1882057 1882059 . - 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_7 AUGUSTUS CDS 1882057 1882422 0.95 - 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_7 AUGUSTUS start_codon 1882420 1882422 . - 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MDEAGTENGRNGAGEEDEAEDDRPGNADVALGLTAPEVVDPEPAQGVFRDPVGALDEPTPPPPSGGNLSAVFAFTAAK # EPGTREPEGPAAFGNRAPELELAACATRSHTLLVEEPPRLEEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 Scaffold_7 AUGUSTUS gene 1887351 1887827 0.93 - . g376 Scaffold_7 AUGUSTUS transcript 1887351 1887827 0.93 - . g376.t1 Scaffold_7 AUGUSTUS stop_codon 1887351 1887353 . - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_7 AUGUSTUS CDS 1887351 1887827 0.93 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_7 AUGUSTUS start_codon 1887825 1887827 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MSSAQIETPGSSYFQPSHQSFAASSSTSTTLYSAPTLDSTIPDSNSRDFWSQNGRMLDSDRGVQAVPAQQQEQEHGVQ # QPQPQFIPQSATFGFTFQSQDIQGIRDVHSRVEQAMAMESENGQEVDIGDEAMMNPCLGAKADTEKKKGSRCLVLRMQPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 Scaffold_7 AUGUSTUS gene 1894569 1895515 0.9 - . g377 Scaffold_7 AUGUSTUS transcript 1894569 1895515 0.9 - . g377.t1 Scaffold_7 AUGUSTUS stop_codon 1894569 1894571 . - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_7 AUGUSTUS CDS 1894569 1894856 0.9 - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_7 AUGUSTUS CDS 1894922 1895515 0.9 - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_7 AUGUSTUS start_codon 1895513 1895515 . - 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MGPPQQLASQSYFRTPTQTSNIQTIRDSLPSIQALPAQLQTYLLTALATGVPGILPPALGGSYSMQAGTGAGTIGNAG # AVGNASVIPNVDSGSGFGIPGPLLAQPSTSVSSSALPAQAPSYNNYAPLQSASVPPMSAAPINHPASFAIPYSPTASLPTHGPGSTAEISGSSTQKKG # KSQKAAKASAKKNKEPSTMPETDKTNKVPGMGEKKSEVMDGKAPAFASSSSSAVTNIEAASMASGSGLNRKEGTANEMPVPISGGVDGDGDIDAEGEI # DLDIYAPYCVDINNANFQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 Scaffold_7 AUGUSTUS gene 1895785 1897614 1 - . g378 Scaffold_7 AUGUSTUS transcript 1895785 1897614 1 - . g378.t1 Scaffold_7 AUGUSTUS stop_codon 1895785 1895787 . - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_7 AUGUSTUS CDS 1895785 1897614 1 - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_7 AUGUSTUS start_codon 1897612 1897614 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MSTASVVQPEAPPTPGRQNDSLCTEESMTVLNRSTTPSVIRFAEKETVEAKSARLVVEIQRPISKTNINAIASSSEQL # SFVSSSNSIQKPELVSSAMTTPIQPTSTTSEGAFTSLKDALMSSISHNNLPENIYLEIDLPKHTGIKRSRTNEGGPGRVKRLRRDDEGEELPGSWSLS # KVRNDIPVPVTVSAQDTPVQATIEADDEDDEADLIRLFVVSRAGHVLPPPSSSTPTESQLSTRFDDASLSVRNLNTRFVRSKGEPGIKSNSDGEDVRI # NGGETELSSAVHDTPDQEINHEENATSIDVDHNITSLNSKAEIPLRKGWIFAALDQNIYRSKKKPSSDLPLSQTLPRIRLGCFIPSEAKHSTDGQDPD # RPASLTQGGVNLNADEPPPTEGNIDLSGDADLDLDMYPDADDNSQVGIAVLDDGGDDGESEEDAVTEVDLPIDELADDDAHEKQDIASLPSVQIAQTG # TPTKFVTSETLSSLEPRRSLRKPVHKPVTLTNTPRRNVGKKAAGTDASVSAANPTTATSITSTPINTGRKKGSLAGRRSSLRKVENQGTKKTRVSTTA # PSTSKGKGKAKEDVEMTSSSSSLVGHDLNSNVAGTSPYQQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 Scaffold_7 AUGUSTUS gene 1898879 1899511 0.46 + . g379 Scaffold_7 AUGUSTUS transcript 1898879 1899511 0.46 + . g379.t1 Scaffold_7 AUGUSTUS start_codon 1898879 1898881 . + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_7 AUGUSTUS CDS 1898879 1899511 0.46 + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_7 AUGUSTUS stop_codon 1899509 1899511 . + 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MTSFKGGMLITGANGALGRGFVSCFIRSPYAKDYKGLYVVRSPERAAELKELLEKAPKDHSYEILSLDLSTLASVRAF # ATSLNARVSGGEIPPIHALVLNAATQQVSGRSSTNDGFEVHFGMNYLANFLLVLLILYSMDKEHGRIINVASSAHDPHHWGTRDHFPDDVRDSLYTDT # EALAKGHLTNEPKDNYTVGMRRYGTSKLLGVMWM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 Scaffold_7 AUGUSTUS gene 1900319 1901404 0.82 - . g380 Scaffold_7 AUGUSTUS transcript 1900319 1901404 0.82 - . g380.t1 Scaffold_7 AUGUSTUS stop_codon 1900319 1900321 . - 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_7 AUGUSTUS CDS 1900319 1901404 0.82 - 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_7 AUGUSTUS start_codon 1901402 1901404 . - 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MPNLVSLDFVVHPRLIYKAHIVNLLHPLSMLQKLTIPAFHNLSSILTSISNINTTSLTHISFFNTSDAPHLITHVINL # AGVQGHGLANLTVLQIHSTYSAASEIFVGERNLKDITITSHDPASAADIRKLLSRIGQTCTCVEEVKLTFESNSRELIDKSDVVTFEDITPILCCTGM # KWFMLSTACPISMDDDDIQKLAESWPSLVSLWLSSRSGRLVLPNRRRLSFKSLIHLAYHCPCLFYASLYIDDSCIPGPENLPVFSSPFNFDVGFSPIE # NPAEIASFLSKLFPVNFTLWYGVDHFLSEGEHWEDPDLISPNIKGQWSERWATVESFLPQLIQMRLDAEKLKQEVARLKIKCEPRWY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 Scaffold_7 AUGUSTUS gene 1907271 1908029 0.32 + . g381 Scaffold_7 AUGUSTUS transcript 1907271 1908029 0.32 + . g381.t1 Scaffold_7 AUGUSTUS start_codon 1907271 1907273 . + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_7 AUGUSTUS CDS 1907271 1908029 0.32 + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_7 AUGUSTUS stop_codon 1908027 1908029 . + 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MWIGLGLVNRESYIIFTDENSLLTLPFTFPDHFLVVSSLIDTLPLHSHLLFRFVNADYRSTTRTIDSTDNDGWGLLEK # WFDESFSNQSQGMIQNVSHTSQSSVQGWNPYATSTPPDCQTYLTSSSPTNPPSSVYTSPSFFSTSTSPFDTLPSGSTSMLPPLWSEGYGNFDQGGSFH # SPSPESLQQERGVAVPSFGLSATSGVGHSGQQLPTTYPGYQSQVPWSDIVSEGQAQTISERLPFLDPHFQPPGSTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 Scaffold_7 AUGUSTUS gene 1909474 1910585 0.28 + . g382 Scaffold_7 AUGUSTUS transcript 1909474 1910585 0.28 + . g382.t1 Scaffold_7 AUGUSTUS start_codon 1909474 1909476 . + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_7 AUGUSTUS CDS 1909474 1909914 0.28 + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_7 AUGUSTUS CDS 1909992 1910585 0.66 + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_7 AUGUSTUS stop_codon 1910583 1910585 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MGGPTGEVHLLSPQSGSFMEKVQEVLFVPPDKLADTDKSRKALRYGSHAIEFAHLPGTNTRLAFVPVLGTNSIEVYTH # DPDSGFLTHVYSSPSPRSGVEDGPRHVKVHPNGKILYCVTEHNNLLDVYSFRATGRSDSRTEWSKQPSQRRHTDAWTKRWSRAVADRDMGYDTRATED # DRGWVSVFKLDQDGMFVPSNSSGKSFGEEEGVERYETPTSGGKAHAIDLYPKSPSSFDIPYPESRVGSPVWILLTDDSDYAAGEVRDGPSILSQPVKR # SNPVGGVRVLEWDSWSSGGIREVVSWPSARKRDVKVENVDEEAGDTEQVVEQGSDEERLMRGGSHAVWLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 Scaffold_7 AUGUSTUS gene 1910846 1911304 0.97 - . g383 Scaffold_7 AUGUSTUS transcript 1910846 1911304 0.97 - . g383.t1 Scaffold_7 AUGUSTUS stop_codon 1910846 1910848 . - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_7 AUGUSTUS CDS 1910846 1911304 0.97 - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_7 AUGUSTUS start_codon 1911302 1911304 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MEGASDKSSLSFQARESLPYRKLTSRTEETEPILAKQASHTTSLNSDKNDDHEPIDANNPRPEVSEAKHLTLGFVGES # SPETQKNGMSPEAAGPSQTKGSRFGLRTKLKTWRSKLTDRIATSSLTRPEDRSEFILQDVGKDPISEGKGGTSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 Scaffold_7 AUGUSTUS gene 1912296 1912979 0.62 - . g384 Scaffold_7 AUGUSTUS transcript 1912296 1912979 0.62 - . g384.t1 Scaffold_7 AUGUSTUS stop_codon 1912296 1912298 . - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_7 AUGUSTUS CDS 1912296 1912979 0.62 - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_7 AUGUSTUS start_codon 1912977 1912979 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MNDGVFEGEFDDFITELPTSSQISTSATQSVPVLSGKLLSTSVRSTGTMQTPKSKSMPIEKSPHPTSPSSSNRKIQVH # PPARRKPRKADFRDETIPSSVASSISSSANSTDSVSESAIDGGAFPSIRPARSINGAPSPPRMSLSSSTSAGGSMAHGAWAKPLVSNSSASTWSGSSP # AASSPMVQTAAPSSVPSVHSQGVDEDMDDDIKLAIRLSLESAEDEARRRRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 Scaffold_7 AUGUSTUS gene 1913262 1914602 0.58 - . g385 Scaffold_7 AUGUSTUS transcript 1913262 1914602 0.58 - . g385.t1 Scaffold_7 AUGUSTUS stop_codon 1913262 1913264 . - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_7 AUGUSTUS CDS 1913262 1914602 0.58 - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_7 AUGUSTUS start_codon 1914600 1914602 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MHLMPLYSLISSSVQYGIVSRSIPLTGKVIKGFLSPSLSGNGLGIGNPNTEFAPNVTACALSSDGGTAKIVWGFRNGA # IAVMTAAKTMETGTRSAGRLTRCKVEEEHEAEVNQVEWDETGCYIVSAARDGRIKVWDAKEIRCLWTSQYFLPNICVSVVLLANPEGYMVVSTMDSGE # IWVWLRITLTAENVLPSPVTSGSPNIRIPYPIQDNDTTRAPSSLYVDNIGSPSGVYVFVTYQSRQDFWGIYLEYTSSSYKVSKYFSDEASGAVTALFP # CFCGENSPDERGFVIAGHQMGWITVYPQIEVSVSRNVNIVPLITPTQKFEAHPDGSAVTALAWNGRILVTGSDFGDTSIFDACSFRRLRVLNSPLSPT # RIRNIGLGSQGEAFSGGVNQILLGEESDFLVASVGDHALAFKADALPKYGKRQSGKAAGKKPIRTVKGYGKCHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 Scaffold_7 AUGUSTUS gene 1920887 1921294 0.35 + . g386 Scaffold_7 AUGUSTUS transcript 1920887 1921294 0.35 + . g386.t1 Scaffold_7 AUGUSTUS start_codon 1920887 1920889 . + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_7 AUGUSTUS CDS 1920887 1921294 0.35 + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_7 AUGUSTUS stop_codon 1921292 1921294 . + 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MLDAFKLKPYDLEPIYASWKDAPLFYGNLPNDNGKTSKNALKDIPVDEWLKKIKEGCIERNVPKEYWHKVAQHYMGEK # AKGRLEELKAVMAKVQRELSLELGKIQLRCGTWVVSVFFSDICFSRFILNIDVDRER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 Scaffold_7 AUGUSTUS gene 1921349 1921795 0.61 + . g387 Scaffold_7 AUGUSTUS transcript 1921349 1921795 0.61 + . g387.t1 Scaffold_7 AUGUSTUS start_codon 1921349 1921351 . + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_7 AUGUSTUS CDS 1921349 1921795 0.61 + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_7 AUGUSTUS stop_codon 1921793 1921795 . + 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MPHHSSKRSDSSESQCDSPTEESSAHFPPTAADAAPEKGGGGPLWITRRPTFDSLDKKAKSDKDTSESNPPQRKRPQR # SATAGSTLTLQWPVRRGSKDEFEGPKHDTTSVVSMPRPTPQKATSDSTLTTTRSMTSPVIIPGHGNEESE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 Scaffold_7 AUGUSTUS gene 1923498 1924112 0.77 + . g388 Scaffold_7 AUGUSTUS transcript 1923498 1924112 0.77 + . g388.t1 Scaffold_7 AUGUSTUS start_codon 1923498 1923500 . + 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_7 AUGUSTUS CDS 1923498 1924112 0.77 + 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_7 AUGUSTUS stop_codon 1924110 1924112 . + 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MIVEVVDERMTGETILDETLRMMKATQDPPIGGAIPNGGTAHSGGGSLWGTSSWTSGPTASSTTTSPSGSSTGEKLSI # STWVDLLSGETWNVLKIGFQLKQVRERLAKGLVDKGVLRTEKRNFLLFDMATHPVADAGVKASLIRRLVEVLTARTTAVPEGALLPEGVQCRVLRTVC # LVCAAYTASVLDGAMGGATIGGSIHKIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 Scaffold_7 AUGUSTUS gene 1932780 1933463 0.99 + . g389 Scaffold_7 AUGUSTUS transcript 1932780 1933463 0.99 + . g389.t1 Scaffold_7 AUGUSTUS start_codon 1932780 1932782 . + 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_7 AUGUSTUS CDS 1932780 1933463 0.99 + 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_7 AUGUSTUS stop_codon 1933461 1933463 . + 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPETRKFTLQSPEEPSYEYAQLGAYTRNTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 Scaffold_7 AUGUSTUS gene 1937274 1937999 0.62 + . g390 Scaffold_7 AUGUSTUS transcript 1937274 1937999 0.62 + . g390.t1 Scaffold_7 AUGUSTUS start_codon 1937274 1937276 . + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_7 AUGUSTUS CDS 1937274 1937999 0.62 + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_7 AUGUSTUS stop_codon 1937997 1937999 . + 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGSTNGSIRERKHGRRGGGNPRGWAIRHGESNPETRRIRGGLSKVEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 Scaffold_7 AUGUSTUS gene 1949375 1950169 1 + . g391 Scaffold_7 AUGUSTUS transcript 1949375 1950169 1 + . g391.t1 Scaffold_7 AUGUSTUS start_codon 1949375 1949377 . + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_7 AUGUSTUS CDS 1949375 1950169 1 + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_7 AUGUSTUS stop_codon 1950167 1950169 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 Scaffold_7 AUGUSTUS gene 1950503 1950772 0.83 + . g392 Scaffold_7 AUGUSTUS transcript 1950503 1950772 0.83 + . g392.t1 Scaffold_7 AUGUSTUS start_codon 1950503 1950505 . + 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_7 AUGUSTUS CDS 1950503 1950772 0.83 + 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_7 AUGUSTUS stop_codon 1950770 1950772 . + 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 Scaffold_7 AUGUSTUS gene 1950802 1952205 0.81 + . g393 Scaffold_7 AUGUSTUS transcript 1950802 1952205 0.81 + . g393.t1 Scaffold_7 AUGUSTUS start_codon 1950802 1950804 . + 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_7 AUGUSTUS CDS 1950802 1952205 0.81 + 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_7 AUGUSTUS stop_codon 1952203 1952205 . + 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 Scaffold_7 AUGUSTUS gene 1952727 1953866 1 + . g394 Scaffold_7 AUGUSTUS transcript 1952727 1953866 1 + . g394.t1 Scaffold_7 AUGUSTUS start_codon 1952727 1952729 . + 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_7 AUGUSTUS CDS 1952727 1953866 1 + 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_7 AUGUSTUS stop_codon 1953864 1953866 . + 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MIIGINLKTLKELGREVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERI # KLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEII # DKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCV # IKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTIF # YEMKYHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 Scaffold_7 AUGUSTUS gene 1954147 1955001 0.99 + . g395 Scaffold_7 AUGUSTUS transcript 1954147 1955001 0.99 + . g395.t1 Scaffold_7 AUGUSTUS start_codon 1954147 1954149 . + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_7 AUGUSTUS CDS 1954147 1955001 0.99 + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_7 AUGUSTUS stop_codon 1954999 1955001 . + 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVR # NYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEE # RATRFVGTTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 Scaffold_7 AUGUSTUS gene 1955337 1956575 0.81 + . g396 Scaffold_7 AUGUSTUS transcript 1955337 1956575 0.81 + . g396.t1 Scaffold_7 AUGUSTUS start_codon 1955337 1955339 . + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_7 AUGUSTUS CDS 1955337 1955342 0.95 + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_7 AUGUSTUS CDS 1955461 1955912 0.82 + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_7 AUGUSTUS CDS 1956026 1956575 0.86 + 1 transcript_id "g396.t1"; gene_id "g396"; Scaffold_7 AUGUSTUS stop_codon 1956573 1956575 . + 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MITDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWRIEILTRDELIGYRAQALSKHNSFIE # KVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEP # IELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 Scaffold_7 AUGUSTUS gene 1956911 1957606 0.36 - . g397 Scaffold_7 AUGUSTUS transcript 1956911 1957606 0.36 - . g397.t1 Scaffold_7 AUGUSTUS stop_codon 1956911 1956913 . - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_7 AUGUSTUS CDS 1956911 1957257 0.71 - 2 transcript_id "g397.t1"; gene_id "g397"; Scaffold_7 AUGUSTUS CDS 1957339 1957474 0.43 - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_7 AUGUSTUS CDS 1957580 1957606 0.37 - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_7 AUGUSTUS start_codon 1957604 1957606 . - 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPPLVLRTPSSLLQRCCSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 Scaffold_7 AUGUSTUS gene 1961286 1962128 0.45 - . g398 Scaffold_7 AUGUSTUS transcript 1961286 1962128 0.45 - . g398.t1 Scaffold_7 AUGUSTUS stop_codon 1961286 1961288 . - 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_7 AUGUSTUS CDS 1961286 1962128 0.45 - 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_7 AUGUSTUS start_codon 1962126 1962128 . - 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRV # LPHFTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 Scaffold_7 AUGUSTUS gene 1962344 1963204 0.56 - . g399 Scaffold_7 AUGUSTUS transcript 1962344 1963204 0.56 - . g399.t1 Scaffold_7 AUGUSTUS stop_codon 1962344 1962346 . - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_7 AUGUSTUS CDS 1962344 1963204 0.56 - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_7 AUGUSTUS start_codon 1963202 1963204 . - 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHV # KGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNH # MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQP # QLVVEKKSVCTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 Scaffold_7 AUGUSTUS gene 1963285 1963548 0.44 - . g400 Scaffold_7 AUGUSTUS transcript 1963285 1963548 0.44 - . g400.t1 Scaffold_7 AUGUSTUS stop_codon 1963285 1963287 . - 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_7 AUGUSTUS CDS 1963285 1963548 0.44 - 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_7 AUGUSTUS start_codon 1963546 1963548 . - 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 Scaffold_7 AUGUSTUS gene 1963794 1965512 0.19 - . g401 Scaffold_7 AUGUSTUS transcript 1963794 1965512 0.19 - . g401.t1 Scaffold_7 AUGUSTUS stop_codon 1963794 1963796 . - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_7 AUGUSTUS CDS 1963794 1965021 1 - 1 transcript_id "g401.t1"; gene_id "g401"; Scaffold_7 AUGUSTUS CDS 1965114 1965370 0.46 - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_7 AUGUSTUS CDS 1965498 1965512 0.32 - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_7 AUGUSTUS start_codon 1965510 1965512 . - 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MKPKNQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQ # LNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKD # KKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPE # LSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIK # SKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHR # LVKLPMGWTNSVPIFHDDVTIFYEMKYHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 Scaffold_7 AUGUSTUS gene 1966191 1966859 0.59 - . g402 Scaffold_7 AUGUSTUS transcript 1966191 1966859 0.59 - . g402.t1 Scaffold_7 AUGUSTUS stop_codon 1966191 1966193 . - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_7 AUGUSTUS CDS 1966191 1966466 0.65 - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_7 AUGUSTUS CDS 1966578 1966859 0.73 - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_7 AUGUSTUS start_codon 1966857 1966859 . - 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDEPDDEDTIKLIPFTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGE # TENWTIHLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 Scaffold_7 AUGUSTUS gene 1966889 1968410 0.33 - . g403 Scaffold_7 AUGUSTUS transcript 1966889 1968410 0.33 - . g403.t1 Scaffold_7 AUGUSTUS stop_codon 1966889 1966891 . - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_7 AUGUSTUS CDS 1966889 1967573 0.73 - 1 transcript_id "g403.t1"; gene_id "g403"; Scaffold_7 AUGUSTUS CDS 1967672 1968015 0.44 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_7 AUGUSTUS CDS 1968090 1968410 0.53 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_7 AUGUSTUS start_codon 1968408 1968410 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKI # DEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPKFDPKGIDGEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAV # MAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYK # KIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 Scaffold_7 AUGUSTUS gene 1977448 1978873 0.39 + . g404 Scaffold_7 AUGUSTUS transcript 1977448 1978873 0.39 + . g404.t1 Scaffold_7 AUGUSTUS start_codon 1977448 1977450 . + 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_7 AUGUSTUS CDS 1977448 1978097 0.4 + 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_7 AUGUSTUS CDS 1978390 1978873 1 + 1 transcript_id "g404.t1"; gene_id "g404"; Scaffold_7 AUGUSTUS stop_codon 1978871 1978873 . + 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MSSYSTNSSRQTPVEQSSESSMHSHSLDASDLDPFAKGSVQVVTRRTSAGSSQGGSSVFSSNLIHPFSSSHPAQSIVA # VKGLSANDESAAEYGHFLTSTPPVSRAKSSERRKRVSPTGRPKQKPVPTCPLPLPPKSKPPTGPLPSVPIDSSYSDDSNSSLPSPPITPPGSFRLSKR # QSEKDWTLGLPYTSDEDLVNLRKISRHTGLSRSSEVMPRRSLLSSDSDTSDSLENAHRRLEKMMMEPAGMILGEKGIPIPLSVASLPKILPVNANAPM # QRDLGLDGDIETPMQSPITPMSGQFAYAQNLACSDRSLSLSPQPKRNRSEQVPKSVVMLSLDPFAISDSESLTSGEETSYWSARSSMDSVIDSTVELD # YLSAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 Scaffold_7 AUGUSTUS gene 1981167 1981529 0.51 - . g405 Scaffold_7 AUGUSTUS transcript 1981167 1981529 0.51 - . g405.t1 Scaffold_7 AUGUSTUS stop_codon 1981167 1981169 . - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_7 AUGUSTUS CDS 1981167 1981529 0.51 - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_7 AUGUSTUS start_codon 1981527 1981529 . - 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MDDNESMLPEGETDLVIRSRNDLAIHARTVESLQTAGKGMQSAGEIMGKVAKAADAIPEVGETLDGHSSRGYFREYIG # KLLNEVAEAEKESAHVSFFPIMFVTLAYLLLYYRPGGFSSYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 Scaffold_7 AUGUSTUS gene 1986794 1987408 0.96 + . g406 Scaffold_7 AUGUSTUS transcript 1986794 1987408 0.96 + . g406.t1 Scaffold_7 AUGUSTUS start_codon 1986794 1986796 . + 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_7 AUGUSTUS CDS 1986794 1987408 0.96 + 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_7 AUGUSTUS stop_codon 1987406 1987408 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MDPNDLRRLLHECLNLKDAQGNPAPRAVYAVVAIVGSTEHGACDPLKDILDVRDEVNTFSIVSKRRSLTLSTQFRRKG # LSFVLHADGAWGAYFATTIPEIIVQDSLRLSSELAKNRMDLVEYDKARLDIFVPTVPLNTKTLESIVRMRDCDSITVDPHKSGYIQYPAGGLLYRDER # MRYLVTWTSPIVYRNDLQSIGVFGVEGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 Scaffold_7 AUGUSTUS gene 1987822 1988481 0.42 + . g407 Scaffold_7 AUGUSTUS transcript 1987822 1988481 0.42 + . g407.t1 Scaffold_7 AUGUSTUS start_codon 1987822 1987824 . + 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_7 AUGUSTUS CDS 1987822 1988481 0.42 + 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_7 AUGUSTUS stop_codon 1988479 1988481 . + 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MGSDLSINTFAVNFKLGDVVNEDVIEANYLNKRIYEKLSTIDDSGKKPPLFLISTVLSQKNYGECLFKFKDRLGLKGS # QDLYTLVNAVMSPWPTAIGLTEEVAQSLQGTIVKECEVSVYRNTLTEDYHAFIMQGTDSKLFFVHLPMFNMENHRLQLIITGEIPIQMRFAYIGAREK # NPDTVYLLVNDTPTTLEKILAAKEFEARIEPFNPRGQQPCVPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 Scaffold_7 AUGUSTUS gene 1991236 1992317 0.27 + . g408 Scaffold_7 AUGUSTUS transcript 1991236 1992317 0.27 + . g408.t1 Scaffold_7 AUGUSTUS start_codon 1991236 1991238 . + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_7 AUGUSTUS CDS 1991236 1991377 0.27 + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_7 AUGUSTUS CDS 1991452 1992317 0.53 + 2 transcript_id "g408.t1"; gene_id "g408"; Scaffold_7 AUGUSTUS stop_codon 1992315 1992317 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MWLTFIFIFSFNLPARGFSQEAATKKTSYDWPPQGTYPYLRIPDIADSKFSRIFSHSRHRSVNAFFHLVFHILKSSTK # VDSYSDNHGPASDFLQSLVSSFEDNVNDGAEGLTPLVLGATSDHSSSDDDEWDEVAGPDQPQSLGSSVEDNVNDGAEGLTPVVLGATSGHSSSDEEWD # EVAGPDQPQSLGSLVEDNVDDGAEGLTPVVLGPASGYFSLNEDEWGEVAGPVDAGHIGESFDPTEYLPTLTETEQLDADYGSSSLFPTEEEDQLYGEP # CTLVEKNITDNTQIFQGWFAEEEFHPSPLPPTLSSSSVSPESSSSITPEGEQAHNIRVTLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 Scaffold_7 AUGUSTUS gene 1992880 1993305 0.87 + . g409 Scaffold_7 AUGUSTUS transcript 1992880 1993305 0.87 + . g409.t1 Scaffold_7 AUGUSTUS start_codon 1992880 1992882 . + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_7 AUGUSTUS CDS 1992880 1993305 0.87 + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_7 AUGUSTUS stop_codon 1993303 1993305 . + 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MSTDNILTNSDPPSASASRSPSPEITVAPPSPREESNSSNEFSIEQQPAGTPSKDGESQRRHTNMGLPGHDFTYFLLS # EEVILTELSRLSAPKIINNGALHTASLQPHPAKHSQDRLVAEQWDLGERGSWKFRAVFDGAFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 Scaffold_7 AUGUSTUS gene 1996284 1996700 1 + . g410 Scaffold_7 AUGUSTUS transcript 1996284 1996700 1 + . g410.t1 Scaffold_7 AUGUSTUS start_codon 1996284 1996286 . + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_7 AUGUSTUS CDS 1996284 1996700 1 + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_7 AUGUSTUS stop_codon 1996698 1996700 . + 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MVRTDLGISIENASNTDPNETVGLYDLEATGSDPYGTPKEKAYKNFPEFERPAHGYNWTADMKGKAPERDVPETEERS # NEITSLSPSDPVRDIDAPPPAFSESQYEGTSTLISSGPPAHRNEKQPQGLIVLNPPTMDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 Scaffold_7 AUGUSTUS gene 1998634 1999641 0.99 - . g411 Scaffold_7 AUGUSTUS transcript 1998634 1999641 0.99 - . g411.t1 Scaffold_7 AUGUSTUS stop_codon 1998634 1998636 . - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_7 AUGUSTUS CDS 1998634 1999641 0.99 - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_7 AUGUSTUS start_codon 1999639 1999641 . - 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MATTRSKTSATLGAPIEVSSVSEWNSILRNAYANNQTVVADFHAEWCQPCKVIAPVYANLASQQPFTYFLRVDVDGNR # TRPIAAKYSISAMPTFVVIKRPPGEEGATNATGKGVVVEKLQGADPQGLARITNTHASRAYAPPSTLQTPAAEKAKDLGNDLFKKRQYAAAVEEYSKA # IALSPDSGVLYANRALGYYKWIQSKREGADSAEARNALRVKQMQDGLKVTNMQERWGKGWVRLAEALLESGCEESLENVAEDKRSEGRRVSLEGAEEA # LTNAIQLSEGKVKIGEFVLHISPLRLFMFLMFQRHNPSLRMSKRQWLLYHRLCLKICTMNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 Scaffold_7 AUGUSTUS gene 2002180 2003355 0.27 + . g412 Scaffold_7 AUGUSTUS transcript 2002180 2003355 0.27 + . g412.t1 Scaffold_7 AUGUSTUS start_codon 2002180 2002182 . + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_7 AUGUSTUS CDS 2002180 2002210 0.31 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_7 AUGUSTUS CDS 2002348 2002481 0.32 + 2 transcript_id "g412.t1"; gene_id "g412"; Scaffold_7 AUGUSTUS CDS 2002566 2002662 0.6 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_7 AUGUSTUS CDS 2002724 2003355 0.64 + 2 transcript_id "g412.t1"; gene_id "g412"; Scaffold_7 AUGUSTUS stop_codon 2003353 2003355 . + 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MSKGTVLVRASSKLQSIFPKATAEQLQVVEVPTLISDHSAALKGVDALIHFHLSMGAYEGTVALVKQAIAAGVKKIIV # TGTFVNLFDADFQAAFGTRILTEKDFGSITSETIDLKNDGMRVYQEAKTLADKAVWELAHLHPDVDFTVLLPPAIFGPQLSPLTSSPSSLSTNSFVKM # LFAPEYAPNPIGHMIDVRDAARAHVLALSTPPVSGRDKRFIISNGTFQWKDVTALIRSKKPELASRLPSETSVPGPQTSAPMDTTFAKEVLGMKSYIP # QEETFLATVDVVLEWERKFGDKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 Scaffold_7 AUGUSTUS gene 2003612 2004428 0.24 + . g413 Scaffold_7 AUGUSTUS transcript 2003612 2004428 0.24 + . g413.t1 Scaffold_7 AUGUSTUS start_codon 2003612 2003614 . + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_7 AUGUSTUS CDS 2003612 2003614 0.26 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_7 AUGUSTUS CDS 2003745 2004428 0.65 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_7 AUGUSTUS stop_codon 2004426 2004428 . + 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MLRYKHIVKIYEESRIAISEQNLKRAQDALQTGDLFVLSRSEVSWEGEWVDPRWKQAAQQRLEIEEQKRKEEDRRRVE # EAHMHAWAIYNLENKDLEYDYSTDLEDDNSQDGSAVKSRSSTSPSSSLGGTSLERASKIVDTSVKESPSQNQSISNNSISQSKDMVPTTTISNEALEV # RIIGNADVSDPSMAMEKRKSLTCDYDENDDVSDRKRPRIDNGEQTISFPKTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 Scaffold_7 AUGUSTUS gene 2008219 2008761 0.37 - . g414 Scaffold_7 AUGUSTUS transcript 2008219 2008761 0.37 - . g414.t1 Scaffold_7 AUGUSTUS stop_codon 2008219 2008221 . - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_7 AUGUSTUS CDS 2008219 2008761 0.37 - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_7 AUGUSTUS start_codon 2008759 2008761 . - 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MWWLAHVTQQLLGVSKSHDKSIRQIVALMSVPFSILLFLIVLNIFTSWQAGIQLDLSCCFNHKHGCKPTTTGRHTTLP # HNNSGMCIIVHLLLYSARMKGIVPTLMLVKIELKIGIEDGSDKNVASNDLEALVQTVPPNGVDTITPYYIQPLHISDQDKLPTATEEHVRISPRKVKA # GHNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 Scaffold_7 AUGUSTUS gene 2015892 2016395 0.35 - . g415 Scaffold_7 AUGUSTUS transcript 2015892 2016395 0.35 - . g415.t1 Scaffold_7 AUGUSTUS stop_codon 2015892 2015894 . - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_7 AUGUSTUS CDS 2015892 2016395 0.35 - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_7 AUGUSTUS start_codon 2016393 2016395 . - 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MQSPVANSFAGSSRTLLPTADEHTSKWTNPDWEAVVKSLQNEDIHHTVENVEEIERDDTLPSYSTIMFQENFDAYLLD # ASVDIQDEDEYNMGTPDLIPSSSNSSPFYGFGKMDNHTLALLDVKQQEYNQLRLAVSKEIDGGESANSTHWDSHATTLPSSEDWEIYNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 Scaffold_7 AUGUSTUS gene 2017187 2018665 0.74 - . g416 Scaffold_7 AUGUSTUS transcript 2017187 2018665 0.74 - . g416.t1 Scaffold_7 AUGUSTUS stop_codon 2017187 2017189 . - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_7 AUGUSTUS CDS 2017187 2017895 0.96 - 1 transcript_id "g416.t1"; gene_id "g416"; Scaffold_7 AUGUSTUS CDS 2017959 2018665 0.75 - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_7 AUGUSTUS start_codon 2018663 2018665 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MTLLGTGFISFIAFRHHPLTTMTTALPISLPGMSAAPQYVLCIVNILNFTKLELYGSRFFPSASGFEIKGPVFNSHIY # PLPIEAPPHASTLPSPSKLTSLAHDYNSVPLVESEIYAQMLLLRKKGYPLWKPKSDNSRLPESYKREGIHIGDVGILTESGGFDYLFNICQGPDHELN # LGRVPDDFRPILDFDCDDTEDYTQEYELGSHVASDPNRIHQRRIPASPTPNNPFKNRLHSAIPDEVGAGLSYSSTASKGALLVLPEGGKRVDHLHRAR # FEKYAAECAPSWYMHVNGALGRTAYNGSLYLVTGFDKARAWGVASFSDAIPENIQLEYVPKSTHSEDRYPKYWFRTCNSASSSSGADDRYGQQSGCIF # LRGFKIAVRETWFREKVTEILHIYNLDADSLFPKAPNPEARWSSILRRWLYPLHQIPTPSEHKFALDEDAKKVDLDYISSIHVSREILLWLIFGNDFA # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 Scaffold_7 AUGUSTUS gene 2022739 2024278 0.21 + . g417 Scaffold_7 AUGUSTUS transcript 2022739 2024278 0.21 + . g417.t1 Scaffold_7 AUGUSTUS start_codon 2022739 2022741 . + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_7 AUGUSTUS CDS 2022739 2022910 0.21 + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_7 AUGUSTUS CDS 2022993 2024278 1 + 2 transcript_id "g417.t1"; gene_id "g417"; Scaffold_7 AUGUSTUS stop_codon 2024276 2024278 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MGRVSCQLWLLSLEYHVRSVVVSSRIQVLSQLFCRRYYPSDVVTLGNTSIPFYATVDPSTWPNAIFNVNQAQNISEQG # HPDVYGAPLTSSAPSSTPASSSKSNNAAAIGGGVAGGVVVLILGALAAWWILRRRRRSGLTGLKRQSGKPQELDSTPYNAFEQGHTRLISDHANPSNV # GEASFGNSSSGNGIDGYMGSIGMQQLGFSPSPFGSSSNMGSVNSMGAFSTPPHQIVLSSSPPPSTYNARASTITGITRYDSPSPSMQFMARSQSPDSS # FGHEMAIQPFVLPMTMPSSVSMHKGGGAGYEAAITRQSSQDSLFAPVPPRRMNPPAYNDAVGTTGLSDSRDVAAQRRETHGTGHSAVRLPVDEKSQHL # QVPQTIHGSQDSSIAGPDLAAIDAYVNQTSANTPRPGVGAGNSGGTGGGQGGLDTVPMLHTTAVTPGMPEAPQRRFTVKTINTTIDDGTNDSVGGDRD # HRGENGGDRESVGIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 Scaffold_7 AUGUSTUS gene 2026524 2027679 0.56 + . g418 Scaffold_7 AUGUSTUS transcript 2026524 2027679 0.56 + . g418.t1 Scaffold_7 AUGUSTUS start_codon 2026524 2026526 . + 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_7 AUGUSTUS CDS 2026524 2027118 0.63 + 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_7 AUGUSTUS CDS 2027267 2027679 0.98 + 2 transcript_id "g418.t1"; gene_id "g418"; Scaffold_7 AUGUSTUS stop_codon 2027677 2027679 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MAQIKRAIAFASLLSLGFPLVSAVAFEGAVGFGSIATGGTTSYVVTTLADSGTGTFRDAVSESGRNITFSVSGYIVLE # SPVSLSSDLTINGQTAPSPGIGVMAREISASGKSNIIIRNFRMRQGNEETDDTKSAFNMGDATNVILDHCSVAFGVYDSIDAVGAVNVTVSNSIIALP # IGQQFGAHLETGPSTWYANLWVIADTGGDFSHDIINNYFITGPSTTSASDDYYQIDDNQSVYASGNFLDSNKDGVLNGAAANTVGSAEVLSSPWYSTS # LSMASLTAAEAYSYVIANAGASPRDEVDTYVVSTVESLGTEGAIITNQDSTGLSNDGYGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 Scaffold_7 AUGUSTUS gene 2028109 2029261 0.35 + . g419 Scaffold_7 AUGUSTUS transcript 2028109 2029261 0.35 + . g419.t1 Scaffold_7 AUGUSTUS start_codon 2028109 2028111 . + 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_7 AUGUSTUS CDS 2028109 2028794 0.35 + 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_7 AUGUSTUS CDS 2028886 2029261 0.88 + 1 transcript_id "g419.t1"; gene_id "g419"; Scaffold_7 AUGUSTUS stop_codon 2029259 2029261 . + 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MAQSKRILASFAFIFLPSLVSALAFEGAVGFGSIATGGTSPFAVTTLADSGTGSFRDAVSESGRNITFSVSGYIVLES # PVSLSSDLTINGQTAPSPGIGVMGREVSASGKTNIIVRNFRMRQGTEETDDGKSAFNMGDASNIILDHCSLEYGVFDTVDAVGAVNVTVSNSIIALPI # GQQFGAHLETGPSTWYANLWVSAHNRQPLSKANTQYINNVSAFSGNRTHPRMNNYFIAGPSTTSASDDYFQIDDNQSVFATGNLLDSNQDGVLNGAAA # NTVGSAQVLSSPWAPTSLSIAGSLTAAEAYALVIANAGASPRDEVDAFVVSTVQSLGTEGAIITDQDSTGLSNDGYGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 Scaffold_7 AUGUSTUS gene 2033000 2033296 0.63 + . g420 Scaffold_7 AUGUSTUS transcript 2033000 2033296 0.63 + . g420.t1 Scaffold_7 AUGUSTUS start_codon 2033000 2033002 . + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_7 AUGUSTUS CDS 2033000 2033296 0.63 + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_7 AUGUSTUS stop_codon 2033294 2033296 . + 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MFPHVPVHDPQPYAAGPPFYSNFTSYEEVLRVGGSEWEVVLNKIPDDDTLLDVHKGRTGLLSGSGPLDTDTKLSNTLI # LTTVTKSPRVFTSNADYETH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 Scaffold_7 AUGUSTUS gene 2038481 2039062 1 + . g421 Scaffold_7 AUGUSTUS transcript 2038481 2039062 1 + . g421.t1 Scaffold_7 AUGUSTUS start_codon 2038481 2038483 . + 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_7 AUGUSTUS CDS 2038481 2039062 1 + 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_7 AUGUSTUS stop_codon 2039060 2039062 . + 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MALDPLSAVVTALERESIIPDVIPKTSGFVPTVLFSVIYPGGIEAVLSTELLRDNTLEEPEINFTPMVTSDETAGDLT # GDRGETSYTLVMTDPDAPSRADPKYRQFRHWVVSIVIDCTELYSICLLGLISQITGLKSPAISSSPSGTSSLIAFEDQSIHNSLSSTWSSTWERLPQI # LYAISNSCHFNFLILEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 Scaffold_7 AUGUSTUS gene 2046477 2047643 0.9 + . g422 Scaffold_7 AUGUSTUS transcript 2046477 2047643 0.9 + . g422.t1 Scaffold_7 AUGUSTUS start_codon 2046477 2046479 . + 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_7 AUGUSTUS CDS 2046477 2047643 0.9 + 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_7 AUGUSTUS stop_codon 2047641 2047643 . + 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 Scaffold_7 AUGUSTUS gene 2047694 2049346 0.89 + . g423 Scaffold_7 AUGUSTUS transcript 2047694 2049346 0.89 + . g423.t1 Scaffold_7 AUGUSTUS start_codon 2047694 2047696 . + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_7 AUGUSTUS CDS 2047694 2049346 0.89 + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_7 AUGUSTUS stop_codon 2049344 2049346 . + 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNFGNYEGSWDLQTSTDALSGILPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 Scaffold_7 AUGUSTUS gene 2056206 2056535 0.27 - . g424 Scaffold_7 AUGUSTUS transcript 2056206 2056535 0.27 - . g424.t1 Scaffold_7 AUGUSTUS stop_codon 2056206 2056208 . - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_7 AUGUSTUS CDS 2056206 2056434 0.53 - 1 transcript_id "g424.t1"; gene_id "g424"; Scaffold_7 AUGUSTUS CDS 2056516 2056535 0.27 - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_7 AUGUSTUS start_codon 2056533 2056535 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MNIREDNSVLPMYPNNVGFPPSRLPSSSVPATASDQEDDNEDADPDVVPETTGNPFTSVDDIRDSKLMGEKTRKNDRS # IIGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 Scaffold_7 AUGUSTUS gene 2062673 2063149 0.92 - . g425 Scaffold_7 AUGUSTUS transcript 2062673 2063149 0.92 - . g425.t1 Scaffold_7 AUGUSTUS stop_codon 2062673 2062675 . - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_7 AUGUSTUS CDS 2062673 2063149 0.92 - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_7 AUGUSTUS start_codon 2063147 2063149 . - 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MTNEDSGNYILAADVGSDGQVNLREAYATGGMGLHGINGGNTGPDGLFGQGSVAVSNVTNMLVAVNVRILVFLSIIIR # SDSDSFLCMYLQPGSGTVSLFSINPSDPSNLTHIGDPAGSGGQWPTSVTFNKAGDIVCALNGGEVNGVRYGAPSSNQYSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 Scaffold_7 AUGUSTUS gene 2065570 2066736 0.9 + . g426 Scaffold_7 AUGUSTUS transcript 2065570 2066736 0.9 + . g426.t1 Scaffold_7 AUGUSTUS start_codon 2065570 2065572 . + 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_7 AUGUSTUS CDS 2065570 2066736 0.9 + 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_7 AUGUSTUS stop_codon 2066734 2066736 . + 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 Scaffold_7 AUGUSTUS gene 2067554 2069572 0.97 + . g427 Scaffold_7 AUGUSTUS transcript 2067554 2069572 0.97 + . g427.t1 Scaffold_7 AUGUSTUS start_codon 2067554 2067556 . + 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_7 AUGUSTUS CDS 2067554 2069572 0.97 + 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_7 AUGUSTUS stop_codon 2069570 2069572 . + 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFEPLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN # RQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAKA # LLIFTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 Scaffold_7 AUGUSTUS gene 2074800 2075186 0.69 + . g428 Scaffold_7 AUGUSTUS transcript 2074800 2075186 0.69 + . g428.t1 Scaffold_7 AUGUSTUS start_codon 2074800 2074802 . + 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_7 AUGUSTUS CDS 2074800 2075186 0.69 + 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_7 AUGUSTUS stop_codon 2075184 2075186 . + 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MSDPIEIDDSDHSDVHIATKVESEDVDLHLVRSHIEKKMKIASHIWLTKKEPSPNYLPTATKQYLAKKASQQAISTNG # KVSNITFRIHVALQHKDGQNIGTRVPFQTKTFVGISSSMRSGAKTCLQVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 Scaffold_7 AUGUSTUS gene 2081860 2082882 0.38 + . g429 Scaffold_7 AUGUSTUS transcript 2081860 2082882 0.38 + . g429.t1 Scaffold_7 AUGUSTUS start_codon 2081860 2081862 . + 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_7 AUGUSTUS CDS 2081860 2082882 0.38 + 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_7 AUGUSTUS stop_codon 2082880 2082882 . + 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MLCTYTLIHIAGKVPRSSPKLHSTTSNDSAQLRLNRRNAAKQAQLTKRQSLVDSRRLFSSGGTPRIVAVVPLTSDIDS # RLCVERLALVLGETVEGSGESRSKLHASRFKTSLEFLFPTTFYSTLDALLIADYVLIILSPSVEVDEQGETLMRTMQSVGMPSVVAIVGESTQETATT # TSKEHKEILKSLLSFTQYFVPSLNRVYDLSSSASSEALNTIRALCESTPAEVKWRAGRSYLLADQLQWAKSMTDPTSELSTLGSLSITGIIRGASLDP # NRLVHIPSWGDYQIEKVSLRFLQFQSVHVSVISFIYLVTFTNFLSLTLINLIDTKRTSSTIYKNCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 Scaffold_7 AUGUSTUS gene 2083210 2083539 0.55 + . g430 Scaffold_7 AUGUSTUS transcript 2083210 2083539 0.55 + . g430.t1 Scaffold_7 AUGUSTUS start_codon 2083210 2083212 . + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_7 AUGUSTUS CDS 2083210 2083539 0.55 + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_7 AUGUSTUS stop_codon 2083537 2083539 . + 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MSEYQAAWIVDSDVEEDEEDDDKENRVDFKIDTPEGDDVAMEEDEEEAEGDDGISGGGGKRKVRFGDEADFEDLSQDE # EDAQLASWRLAREKNKEREKEGMLLYPIMNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 Scaffold_7 AUGUSTUS gene 2091624 2093393 0.56 + . g431 Scaffold_7 AUGUSTUS transcript 2091624 2093393 0.56 + . g431.t1 Scaffold_7 AUGUSTUS start_codon 2091624 2091626 . + 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_7 AUGUSTUS CDS 2091624 2092790 0.61 + 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_7 AUGUSTUS CDS 2092983 2093393 0.92 + 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_7 AUGUSTUS stop_codon 2093391 2093393 . + 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MVGPDSSIDAGYVAASSNCNITDNNIDSYNEASSSSLYSSTPRLVPSSEQVLSSCLFGNSTSGVKCSMFFSEHPNFSA # YAELHGLDVMGLHSHRQRRNAVIHHILSSHCFLNRHIKKSSACCMFVADFSSEVEFLDRIGNMISHSKARDLPVVRLKLIMESLNIQEHILPNQPRRQ # MLKYILKYINRLSAASSECVTRQLPLSVEDIFKDFGRLRFSILLQYCRMHNIEVNVFTATSTELRQQLASHVLSAECHSNATVFPENICPIGCRSIAH # TFHTRPSDFQPGNESFSEFRLLLTHLLSTKLSLGTLRSVLQILEVPFKDDDNKRTLCLRLQEFNGSDQFDFQGALQEKKLSDLRAAWPVLISGSLKRK # LVHDFQLHTSSQAMKRSISKVSLSTNMGTVAFLCSVSCYSALRNGKTPALSLANHMYIGEVPDILKGLTVVEEAMISRCHAKSWIVQLKEHQDVANRT # TQRSLKGNVIVYPQKPSSVAKILLPSLDELTAPICVILLDLLNRLTSGCKRKRNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 Scaffold_7 AUGUSTUS gene 2093597 2094947 0.58 + . g432 Scaffold_7 AUGUSTUS transcript 2093597 2094947 0.58 + . g432.t1 Scaffold_7 AUGUSTUS start_codon 2093597 2093599 . + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_7 AUGUSTUS CDS 2093597 2093853 0.6 + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_7 AUGUSTUS CDS 2094026 2094947 0.82 + 1 transcript_id "g432.t1"; gene_id "g432"; Scaffold_7 AUGUSTUS stop_codon 2094945 2094947 . + 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MPIASTLDEDIIFENIVIADVDANTTINELRAAAMRHIKSNGGSYVEIPHESAPMNKFFNPLLFPMIYPMLFPYGIGS # FEDYHRSDLRLSRLLQLQLWLIFAKGDLVSFRNSEERAVLQLMEQVNLVTSTVPGSSSALVNMRNEIRALMIDQGLPSFYITINPADVYNPLVKFLAG # SEIDIDCMLPTDVPSYWDQAMLIAKNPVVAAKFFNIYMKAFIRDLLGYDPNDKELTGGILGVVKGYYGCVEAQGRGTLHCHMMVWLEGSLNPNEIREK # AISDPDSPFCRRLIAFLDDTISNSVPAASSNCPRIPSTDLHPSSVRCTTMLGYHGYDCDSKEILQQDLHNLVHSCQVHKHTATCFKYCKDSSKPKECR # FGLDASNIVLESCLILTREN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 Scaffold_7 AUGUSTUS gene 2095016 2095543 0.89 + . g433 Scaffold_7 AUGUSTUS transcript 2095016 2095543 0.89 + . g433.t1 Scaffold_7 AUGUSTUS start_codon 2095016 2095018 . + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_7 AUGUSTUS CDS 2095016 2095543 0.89 + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_7 AUGUSTUS stop_codon 2095541 2095543 . + 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MDIKFIGSGASAKAVLYYITNYITKSQLKAHVAYAALERVVRRLDEQCPDDSELTVRAKKLLQKCAYSMISQQELSAQ # QVNTYLLDLEDHYTSHKYKNLYWVQIEHLLDTELPSPKCKPARKAFESVQTTFTGDVSTSANGACINDIVSDICNDPESTDALTEDEHDVEDDEEVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 Scaffold_7 AUGUSTUS gene 2095840 2097524 0.55 + . g434 Scaffold_7 AUGUSTUS transcript 2095840 2097524 0.55 + . g434.t1 Scaffold_7 AUGUSTUS start_codon 2095840 2095842 . + 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_7 AUGUSTUS CDS 2095840 2096050 0.87 + 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_7 AUGUSTUS CDS 2096166 2096603 0.85 + 2 transcript_id "g434.t1"; gene_id "g434"; Scaffold_7 AUGUSTUS CDS 2096726 2097114 0.66 + 2 transcript_id "g434.t1"; gene_id "g434"; Scaffold_7 AUGUSTUS CDS 2097198 2097524 0.97 + 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_7 AUGUSTUS stop_codon 2097522 2097524 . + 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNCGFGPATVPTTSTLPEAMEENNNSNTAPSIARRTGK # QPQRRAASESPRDPPPHFDLDAGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGSPGDPGGPGGPRSPISPDIPNEQRAML # ELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETEN # IRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPARSPIIVKKFFVLTIVIGNARKLESVRLPSSSSAPFTPKIKPFSGGKPNNNGKP # QNSSNSGQSGGQRPAFNHLGADGKASLRTGKKDEEQSCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 Scaffold_7 AUGUSTUS gene 2097855 2099014 0.55 + . g435 Scaffold_7 AUGUSTUS transcript 2097855 2099014 0.55 + . g435.t1 Scaffold_7 AUGUSTUS start_codon 2097855 2097857 . + 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_7 AUGUSTUS CDS 2097855 2098296 0.55 + 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_7 AUGUSTUS CDS 2098368 2099014 0.56 + 2 transcript_id "g435.t1"; gene_id "g435"; Scaffold_7 AUGUSTUS stop_codon 2099012 2099014 . + 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAV # PLPELRRRFHRQFWRPLLGTHSLSLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVKVAAPPPTALPPLLLSLHSILLSQKSTQF # ADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRY # PLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKPPFGPATALTNGRSCRSALRTPLRLSSGLLMTSSLTCSMSVSSSILTIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 Scaffold_7 AUGUSTUS gene 2099730 2101396 0.26 + . g436 Scaffold_7 AUGUSTUS transcript 2099730 2101396 0.26 + . g436.t1 Scaffold_7 AUGUSTUS start_codon 2099730 2099732 . + 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_7 AUGUSTUS CDS 2099730 2100285 0.89 + 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_7 AUGUSTUS CDS 2100383 2100941 0.27 + 2 transcript_id "g436.t1"; gene_id "g436"; Scaffold_7 AUGUSTUS CDS 2101015 2101396 0.44 + 1 transcript_id "g436.t1"; gene_id "g436"; Scaffold_7 AUGUSTUS stop_codon 2101394 2101396 . + 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFVLSLLTNNSLRLFELPSGRPGFTSLDYHGYRSPTPSII # LALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSALSVVAI # SPAVTGLTAFVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQ # YIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPE # KISWSFQGHQSTWYFVLRAQAPRLSSPHSPGFPRLTAGAGYAESFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDE # FSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 Scaffold_7 AUGUSTUS gene 2104765 2105097 0.59 + . g437 Scaffold_7 AUGUSTUS transcript 2104765 2105097 0.59 + . g437.t1 Scaffold_7 AUGUSTUS start_codon 2104765 2104767 . + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_7 AUGUSTUS CDS 2104765 2105097 0.59 + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_7 AUGUSTUS stop_codon 2105095 2105097 . + 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MRGRCFGCGAQGHVKQTAHTEKPPAATVDVEDIWKQSAKTNSWDSDETEADASNLDANRYPLRDPRHSPIPTNLSKSR # PRPQHLLPAPVAATPSPLTRTFQSDWSNKGIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 Scaffold_7 AUGUSTUS gene 2107574 2108914 0.98 + . g438 Scaffold_7 AUGUSTUS transcript 2107574 2108914 0.98 + . g438.t1 Scaffold_7 AUGUSTUS start_codon 2107574 2107576 . + 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_7 AUGUSTUS CDS 2107574 2108914 0.98 + 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_7 AUGUSTUS stop_codon 2108912 2108914 . + 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MGWSTTEVEYTYQQTTTYALRYSVNAMTIQLQDTPDYTGHSTWSVPISGGLRCALLLEKYVEGCEVCARKKIQRHPRA # VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIK # SDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDA # GAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEI # PTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 Scaffold_7 AUGUSTUS gene 2111390 2112182 0.74 + . g439 Scaffold_7 AUGUSTUS transcript 2111390 2112182 0.74 + . g439.t1 Scaffold_7 AUGUSTUS start_codon 2111390 2111392 . + 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_7 AUGUSTUS CDS 2111390 2111556 0.77 + 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_7 AUGUSTUS CDS 2111678 2112182 0.95 + 1 transcript_id "g439.t1"; gene_id "g439"; Scaffold_7 AUGUSTUS stop_codon 2112180 2112182 . + 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MTLHSALLLSSSTSSVKINSKSHRDLVALWQGVDYLFIDEVSMLGCRFMLKISHALVGTTYGQEIVFGKLLWLSVKTV # VLLTQVMRQSGIENQPFVELLSQLRTGVCTLADYDVLNTCIISAVQPDWCDAKWENTPTIVSSNRVKDMSNEPSAAAFARCTGRPLHWYYASDTRGGR # SVDDIGLQSFLENMDSGQTNQRLGRIPLVIGMPIMIMQNFDVQSGLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 Scaffold_7 AUGUSTUS gene 2114722 2116344 0.46 + . g440 Scaffold_7 AUGUSTUS transcript 2114722 2116344 0.46 + . g440.t1 Scaffold_7 AUGUSTUS start_codon 2114722 2114724 . + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_7 AUGUSTUS CDS 2114722 2114989 0.86 + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_7 AUGUSTUS CDS 2115624 2115877 0.49 + 2 transcript_id "g440.t1"; gene_id "g440"; Scaffold_7 AUGUSTUS CDS 2115919 2116344 1 + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_7 AUGUSTUS stop_codon 2116342 2116344 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MSASFDAPLFASPIFQARVKPGGIYDELSDLFSSMGPAAIANAEFGVDFFHQNFGDDFTSHFSYVDKDSEEFNSNLFG # EILSAAHGTCVDSDISVGALYDPRLMLDYGGQVFNLDKAKLVQPNWCKIDDTLIVPWKNYLHLRQGTLVVADISIRMHVLHPKNKKKPKQRVRLFIVY # QAIINYLKVVAVSDIPVAYPPQPAISRVQNALRTASGQSNAASVLRMIGSSRSSSTTSTTAGSTVSNKVLEPTSRNASIADDRPEVDQDSDGFIDPED # MDVGGDEFASDPADNRTKAAKRLRTISDFWRVSDDVGSSLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 Scaffold_7 AUGUSTUS gene 2134176 2134538 0.41 - . g441 Scaffold_7 AUGUSTUS transcript 2134176 2134538 0.41 - . g441.t1 Scaffold_7 AUGUSTUS stop_codon 2134176 2134178 . - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_7 AUGUSTUS CDS 2134176 2134538 0.41 - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_7 AUGUSTUS start_codon 2134536 2134538 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MTPYSNAGPPTIGGQDQHEIGHARPCPHPHMNPADFTLPDSFGAPFQPNTASGYQPPPNPRPLSPDTFPFPSELAASA # GNGQQGVTEQKKKKGTDGKEAEDNRVAKPMNKKGDKRKAMQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 Scaffold_7 AUGUSTUS gene 2144204 2145304 0.91 + . g442 Scaffold_7 AUGUSTUS transcript 2144204 2145304 0.91 + . g442.t1 Scaffold_7 AUGUSTUS start_codon 2144204 2144206 . + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_7 AUGUSTUS CDS 2144204 2145304 0.91 + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_7 AUGUSTUS stop_codon 2145302 2145304 . + 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGTEAHRFMAQFQNWASEQLDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFPIRLVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 Scaffold_7 AUGUSTUS gene 2147349 2149106 0.39 + . g443 Scaffold_7 AUGUSTUS transcript 2147349 2149106 0.39 + . g443.t1 Scaffold_7 AUGUSTUS start_codon 2147349 2147351 . + 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_7 AUGUSTUS CDS 2147349 2149106 0.39 + 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_7 AUGUSTUS stop_codon 2149104 2149106 . + 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVH # HVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHD # HPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPC # TSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVI # NSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLG # DRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYRRRAQLL # GTRSQPQSSTKNCSGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 Scaffold_7 AUGUSTUS gene 2162454 2162822 0.65 + . g444 Scaffold_7 AUGUSTUS transcript 2162454 2162822 0.65 + . g444.t1 Scaffold_7 AUGUSTUS start_codon 2162454 2162456 . + 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_7 AUGUSTUS CDS 2162454 2162822 0.65 + 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_7 AUGUSTUS stop_codon 2162820 2162822 . + 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKSFPPRRKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 Scaffold_7 AUGUSTUS gene 2173074 2173256 0.79 - . g445 Scaffold_7 AUGUSTUS transcript 2173074 2173256 0.79 - . g445.t1 Scaffold_7 AUGUSTUS stop_codon 2173074 2173076 . - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_7 AUGUSTUS CDS 2173074 2173256 0.79 - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_7 AUGUSTUS start_codon 2173254 2173256 . - 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MEFLKEAQDIGDDLEEGDDDDDFKDFVDEDMVEDAASLSTLRPALYACQVANSAREPPYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 Scaffold_7 AUGUSTUS gene 2180452 2180955 0.54 + . g446 Scaffold_7 AUGUSTUS transcript 2180452 2180955 0.54 + . g446.t1 Scaffold_7 AUGUSTUS start_codon 2180452 2180454 . + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_7 AUGUSTUS CDS 2180452 2180955 0.54 + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_7 AUGUSTUS stop_codon 2180953 2180955 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MQDDVDQLHYNPFAAPVDSRPRSLSTSSLQNNSFFPTSPSTLSVTANIHNDDRGSCAGGDNQHTEIRKTQAEDASILD # HHPLRSAGLSNSFEDAGVTRPHLTRILDGDRLVDVPSFPNDEEDTGQDEATSNEKVVIVHEVSEIWLNQVRILAYVASRYVLRSLPKTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 Scaffold_7 AUGUSTUS gene 2181137 2181412 0.56 - . g447 Scaffold_7 AUGUSTUS transcript 2181137 2181412 0.56 - . g447.t1 Scaffold_7 AUGUSTUS stop_codon 2181137 2181139 . - 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_7 AUGUSTUS CDS 2181137 2181412 0.56 - 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_7 AUGUSTUS start_codon 2181410 2181412 . - 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MIVSRVDAAMGNAVRIVFNDGAGVVACRLWIILLLEGRGCDRGDGDDEFDKADVLDDGGKKDSSDAGIRRMADDEIVV # AVGDWLASGTVNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 Scaffold_7 AUGUSTUS gene 2183195 2183509 0.9 - . g448 Scaffold_7 AUGUSTUS transcript 2183195 2183509 0.9 - . g448.t1 Scaffold_7 AUGUSTUS stop_codon 2183195 2183197 . - 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_7 AUGUSTUS CDS 2183195 2183509 0.9 - 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_7 AUGUSTUS start_codon 2183507 2183509 . - 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MIIVLLDAVVQNAIQNRVSQGEVHGLSVTGYVSYEGSTVKDEAGSWDIGAKNDISDTGVPLTTISVVTGDLPSSVTED # LCSRTVRGQEENKSLRAARCGGRVGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 Scaffold_7 AUGUSTUS gene 2199276 2199548 0.71 + . g449 Scaffold_7 AUGUSTUS transcript 2199276 2199548 0.71 + . g449.t1 Scaffold_7 AUGUSTUS start_codon 2199276 2199278 . + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_7 AUGUSTUS CDS 2199276 2199548 0.71 + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_7 AUGUSTUS stop_codon 2199546 2199548 . + 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSTLGFFTESARDLGNSPSATFQCGKSP # FRRKLGGVSEGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 Scaffold_7 AUGUSTUS gene 2202976 2204448 0.62 + . g450 Scaffold_7 AUGUSTUS transcript 2202976 2204448 0.62 + . g450.t1 Scaffold_7 AUGUSTUS start_codon 2202976 2202978 . + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_7 AUGUSTUS CDS 2202976 2204448 0.62 + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_7 AUGUSTUS stop_codon 2204446 2204448 . + 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILRNPLEDRIRKASEREAQVLEGLKTVKEHGL # QHLANGIAEWEEDNGLVYYQGRVYVPANDDLCTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQQHPRAVTQPLDV # PSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSIMAEGVADIYYQEIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGY # RPQSNGQTKRANQEVEKYIRLYVGRRQDNWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAGDDHIQILREVRQDAGAALHLG # KKQQKEGYERGKRKAHQFKVEDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINSEIPTPPELV # YLEDEDELEYEVEEILDSRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 Scaffold_7 AUGUSTUS gene 2205396 2207325 0.63 + . g451 Scaffold_7 AUGUSTUS transcript 2205396 2207325 0.63 + . g451.t1 Scaffold_7 AUGUSTUS start_codon 2205396 2205398 . + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_7 AUGUSTUS CDS 2205396 2206834 0.63 + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_7 AUGUSTUS CDS 2206929 2207325 0.88 + 1 transcript_id "g451.t1"; gene_id "g451"; Scaffold_7 AUGUSTUS stop_codon 2207323 2207325 . + 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MKGFQTYPSLSRENRAHKTHRTNEISALFKKMDIGLKLKLNFKIDKENRKRREKSLEFQLGNCADDASEIASFVTIDT # VSLENIRKDQTIFERLKEFLTMEMLDFFRQRNEEEEGDRRSRTRGREEETEEGARKKQKSGKVTLVPRTPGPCATTFDTLLFDTIDAFPTFPLFLFTN # KNLDLITMHMPELKRAKISHLEGKPHVLNLKEIAKWVKEAGGIFHNVDLDFIQWSQAAKNFYQFECLRDKELGKEAPRALFYVKHFTFFLNQQDSEDF # FAYWLKVEIKLRKEHQSKLYTFDSDTYECEWTLVRAEYISDAKYTVTSSAPPPIQTPSSKTNSSSMSQKPFPTGNKERTAAPCCLGCAACGHKLDGHD # DTKTDPSAGLAISEASLACREVKVSAGSGIFEGNAEAATRSTVAPSVAAPPTMHSNGNALPSPHCLKKTSGTSSPQPLSDSMTLQTLSSHAKHRRMPQ # QNTSNFTNESTPLGEMPQLTKSVIILNHTSVAKFPQVVKDYLAEEKSKGRMSGPFSLGEIESIMHGPIVSSPLIVAEQVQAPGIPTKYRVCRHLSKEA # KDADGNRFPSVNSFIAKDLFPTSFDTASKVAELVSLIPSSNPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 Scaffold_7 AUGUSTUS gene 2209002 2209373 0.32 + . g452 Scaffold_7 AUGUSTUS transcript 2209002 2209373 0.32 + . g452.t1 Scaffold_7 AUGUSTUS start_codon 2209002 2209004 . + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_7 AUGUSTUS CDS 2209002 2209373 0.32 + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_7 AUGUSTUS stop_codon 2209371 2209373 . + 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MRNHPKPTMTECTSRRLDSCLEHPVFNTERLEESNSLPATVIELGEQVMAKGTVKSTKEVYTAGLLRYNQFGDLMGIS # EDDRMPASDRLIIGFIGHYTGKVSGKSISNWLSGLRLWHETMGAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 Scaffold_7 AUGUSTUS gene 2215005 2215985 0.44 - . g453 Scaffold_7 AUGUSTUS transcript 2215005 2215985 0.44 - . g453.t1 Scaffold_7 AUGUSTUS stop_codon 2215005 2215007 . - 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_7 AUGUSTUS CDS 2215005 2215985 0.44 - 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_7 AUGUSTUS start_codon 2215983 2215985 . - 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAY # NNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFS # EKYLGPFKVISRPGTLSYELKLPGYLRRIHPVFHVSQLEPVTPNPSRIVLNLLHLQLKLMVKRSTTLPKFDSKLDRRYKRCPLRYYIRWAGYEGTDDE # FSWVAADELHADELYRIPRSIPSNLDLDHTKTFYSFPRSAVLRRSLLRVFRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 Scaffold_7 AUGUSTUS gene 2216027 2216590 0.45 - . g454 Scaffold_7 AUGUSTUS transcript 2216027 2216590 0.45 - . g454.t1 Scaffold_7 AUGUSTUS stop_codon 2216027 2216029 . - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_7 AUGUSTUS CDS 2216027 2216590 0.45 - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_7 AUGUSTUS start_codon 2216588 2216590 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MVIHFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAI # ILALPANPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLCLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTPALFVVA # ISPAVTGLTAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 Scaffold_7 AUGUSTUS gene 2227724 2227981 0.99 - . g455 Scaffold_7 AUGUSTUS transcript 2227724 2227981 0.99 - . g455.t1 Scaffold_7 AUGUSTUS stop_codon 2227724 2227726 . - 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_7 AUGUSTUS CDS 2227724 2227981 0.99 - 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_7 AUGUSTUS start_codon 2227979 2227981 . - 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 Scaffold_7 AUGUSTUS gene 2228020 2229688 0.21 - . g456 Scaffold_7 AUGUSTUS transcript 2228020 2229688 0.21 - . g456.t1 Scaffold_7 AUGUSTUS stop_codon 2228020 2228022 . - 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_7 AUGUSTUS CDS 2228020 2228651 0.6 - 2 transcript_id "g456.t1"; gene_id "g456"; Scaffold_7 AUGUSTUS CDS 2228957 2229004 0.42 - 2 transcript_id "g456.t1"; gene_id "g456"; Scaffold_7 AUGUSTUS CDS 2229148 2229688 0.43 - 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_7 AUGUSTUS start_codon 2229686 2229688 . - 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGET # EEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPL # IGSTLVEKEKRMHMLNSAHDXEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWF # YFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIK # DWDFKPGQLVQVRILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 Scaffold_7 AUGUSTUS gene 2229829 2230988 0.4 - . g457 Scaffold_7 AUGUSTUS transcript 2229829 2230988 0.4 - . g457.t1 Scaffold_7 AUGUSTUS stop_codon 2229829 2229831 . - 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_7 AUGUSTUS CDS 2229829 2230058 0.77 - 2 transcript_id "g457.t1"; gene_id "g457"; Scaffold_7 AUGUSTUS CDS 2230142 2230988 0.4 - 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_7 AUGUSTUS start_codon 2230986 2230988 . - 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIA # QVVLEWPSSPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFSITLDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 Scaffold_7 AUGUSTUS gene 2231263 2233496 0.25 - . g458 Scaffold_7 AUGUSTUS transcript 2231263 2233496 0.25 - . g458.t1 Scaffold_7 AUGUSTUS stop_codon 2231263 2231265 . - 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_7 AUGUSTUS CDS 2231263 2231659 1 - 1 transcript_id "g458.t1"; gene_id "g458"; Scaffold_7 AUGUSTUS CDS 2231752 2231992 0.47 - 2 transcript_id "g458.t1"; gene_id "g458"; Scaffold_7 AUGUSTUS CDS 2232067 2232718 0.64 - 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_7 AUGUSTUS CDS 2232831 2233496 0.57 - 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_7 AUGUSTUS start_codon 2233494 2233496 . - 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSINRSLKKPSVTIE # DVDESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTP # EINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKT # FGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQ # DEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRY # EILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVIMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 Scaffold_7 AUGUSTUS gene 2233526 2234074 0.48 - . g459 Scaffold_7 AUGUSTUS transcript 2233526 2234074 0.48 - . g459.t1 Scaffold_7 AUGUSTUS stop_codon 2233526 2233528 . - 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_7 AUGUSTUS CDS 2233526 2234074 0.48 - 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_7 AUGUSTUS start_codon 2234072 2234074 . - 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 Scaffold_7 AUGUSTUS gene 2234158 2236513 0.31 - . g460 Scaffold_7 AUGUSTUS transcript 2234158 2236513 0.31 - . g460.t1 Scaffold_7 AUGUSTUS stop_codon 2234158 2234160 . - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_7 AUGUSTUS CDS 2234158 2235494 0.62 - 2 transcript_id "g460.t1"; gene_id "g460"; Scaffold_7 AUGUSTUS CDS 2236498 2236513 0.4 - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_7 AUGUSTUS start_codon 2236511 2236513 . - 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 Scaffold_7 AUGUSTUS gene 2246036 2247250 0.41 + . g461 Scaffold_7 AUGUSTUS transcript 2246036 2247250 0.41 + . g461.t1 Scaffold_7 AUGUSTUS start_codon 2246036 2246038 . + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_7 AUGUSTUS CDS 2246036 2247250 0.41 + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_7 AUGUSTUS stop_codon 2247248 2247250 . + 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSLNG # TQWACFLCKSTDHFMNECPHFAGIYEKRLDDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 Scaffold_7 AUGUSTUS gene 2247294 2247563 0.8 + . g462 Scaffold_7 AUGUSTUS transcript 2247294 2247563 0.8 + . g462.t1 Scaffold_7 AUGUSTUS start_codon 2247294 2247296 . + 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_7 AUGUSTUS CDS 2247294 2247563 0.8 + 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_7 AUGUSTUS stop_codon 2247561 2247563 . + 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 Scaffold_7 AUGUSTUS gene 2247593 2249906 0.37 + . g463 Scaffold_7 AUGUSTUS transcript 2247593 2249906 0.37 + . g463.t1 Scaffold_7 AUGUSTUS start_codon 2247593 2247595 . + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_7 AUGUSTUS CDS 2247593 2248323 0.86 + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_7 AUGUSTUS CDS 2248450 2249021 0.78 + 1 transcript_id "g463.t1"; gene_id "g463"; Scaffold_7 AUGUSTUS CDS 2249096 2249336 0.53 + 2 transcript_id "g463.t1"; gene_id "g463"; Scaffold_7 AUGUSTUS CDS 2249429 2249906 1 + 1 transcript_id "g463.t1"; gene_id "g463"; Scaffold_7 AUGUSTUS stop_codon 2249904 2249906 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQRICLKVAYEDHSDHPVVVANQSNGLRAVTPEINNK # DEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGD # SEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAE # EIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKR # GTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKP # VDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 Scaffold_7 AUGUSTUS gene 2251091 2251744 0.63 + . g464 Scaffold_7 AUGUSTUS transcript 2251091 2251744 0.63 + . g464.t1 Scaffold_7 AUGUSTUS start_codon 2251091 2251093 . + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_7 AUGUSTUS CDS 2251091 2251744 0.63 + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_7 AUGUSTUS stop_codon 2251742 2251744 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDSKIQIXTFQALMNAIFADLLQLARWQFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 Scaffold_7 AUGUSTUS gene 2251911 2252744 0.94 + . g465 Scaffold_7 AUGUSTUS transcript 2251911 2252744 0.94 + . g465.t1 Scaffold_7 AUGUSTUS start_codon 2251911 2251913 . + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_7 AUGUSTUS CDS 2251911 2252744 0.94 + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_7 AUGUSTUS stop_codon 2252742 2252744 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MDPVKVAAVRDWPVPTNLRELRGFLGFANFLPALYPKFCKIARPLNDLTKKDTTFNWTGTQQEAFDTLREAFISAPIL # AYGRQIGPLEFEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDLSPTTPTSNSGAQHKTLPV # DKPDGPSIYHGFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKTWPLHQNRCFNPTEPPRGSYSESLRTGSTSTGRSGKQSRARVTTLGQ # WDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 Scaffold_7 AUGUSTUS gene 2254851 2256601 0.47 + . g466 Scaffold_7 AUGUSTUS transcript 2254851 2256601 0.47 + . g466.t1 Scaffold_7 AUGUSTUS start_codon 2254851 2254853 . + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_7 AUGUSTUS CDS 2254851 2255901 0.53 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_7 AUGUSTUS CDS 2256018 2256601 0.88 + 2 transcript_id "g466.t1"; gene_id "g466"; Scaffold_7 AUGUSTUS stop_codon 2256599 2256601 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDE # EFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLSEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGH # KGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTL # GEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGVYLNVESTWLVNPPNRILTRDELIGY # RAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTILKEKVG # AFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPRLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 Scaffold_7 AUGUSTUS gene 2256862 2257639 0.39 - . g467 Scaffold_7 AUGUSTUS transcript 2256862 2257639 0.39 - . g467.t1 Scaffold_7 AUGUSTUS stop_codon 2256862 2256864 . - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_7 AUGUSTUS CDS 2256862 2257289 1 - 2 transcript_id "g467.t1"; gene_id "g467"; Scaffold_7 AUGUSTUS CDS 2257371 2257506 0.55 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_7 AUGUSTUS CDS 2257613 2257639 0.39 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_7 AUGUSTUS start_codon 2257637 2257639 . - 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 Scaffold_7 AUGUSTUS gene 2259389 2259733 0.23 - . g468 Scaffold_7 AUGUSTUS transcript 2259389 2259733 0.23 - . g468.t1 Scaffold_7 AUGUSTUS stop_codon 2259389 2259391 . - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_7 AUGUSTUS CDS 2259389 2259733 0.23 - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_7 AUGUSTUS start_codon 2259731 2259733 . - 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 Scaffold_7 AUGUSTUS gene 2264241 2264894 0.67 - . g469 Scaffold_7 AUGUSTUS transcript 2264241 2264894 0.67 - . g469.t1 Scaffold_7 AUGUSTUS stop_codon 2264241 2264243 . - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_7 AUGUSTUS CDS 2264241 2264894 0.67 - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_7 AUGUSTUS start_codon 2264892 2264894 . - 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MLQEIRSLFHTKPRCVLSSFVSMFNMQISSFKLPSYPQDALQSENAQKWFPSAFEYLNQDLGDDYNDLFKNWVKFERL # KDWVSSTKGLARHNRPKELSKWILNCRYDRPGNEPQLKKEHLVQFRKSFSCWWRDLRSSGWQQNSATEDPCGKLEKERESLDRSGKNGWLSVLACLKW # WGTALGDNDDRNGPLGEEWRSMVKDVSFVLNNLIAVVPNKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 Scaffold_7 AUGUSTUS gene 2265047 2265562 0.41 - . g470 Scaffold_7 AUGUSTUS transcript 2265047 2265562 0.41 - . g470.t1 Scaffold_7 AUGUSTUS stop_codon 2265047 2265049 . - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_7 AUGUSTUS CDS 2265047 2265346 0.78 - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_7 AUGUSTUS CDS 2265398 2265562 0.42 - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_7 AUGUSTUS start_codon 2265560 2265562 . - 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MVSALIFSNAHSFMNSYQKVRLIVQPSREARELQRQLLDKDRLLKELDDELDELMNCDSDQLQILEDERKQLFQQKTV # AEIKSERLQRRVDELEAELHRLKPQKLDSTGPNRASGLSANANPAGNTEVIEAKNQVFKLSSLSDDVDLIERSLEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 Scaffold_7 AUGUSTUS gene 2280333 2280974 0.49 - . g471 Scaffold_7 AUGUSTUS transcript 2280333 2280974 0.49 - . g471.t1 Scaffold_7 AUGUSTUS stop_codon 2280333 2280335 . - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_7 AUGUSTUS CDS 2280333 2280974 0.49 - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_7 AUGUSTUS start_codon 2280972 2280974 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MAPSISAIRALNTSFSPSYLPCAVFVGGTSGVGQGMAEAFARHTKGNAHIILVGRNSSAAESIIGSFPRPTSSSAKHE # FITCDVSLMKNVQQTTQELLSRVTKINFLVLSPGLLSLNGRDETEEGIDRKMALHYYARWKFIHGLIPALLKAKEADEDAKVFSVLAAGKGGKVDLDD # LGLKKTFSLSAAASQVPTYNDLMMEVSSMYDCVFEWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 Scaffold_7 AUGUSTUS gene 2284005 2284382 0.47 + . g472 Scaffold_7 AUGUSTUS transcript 2284005 2284382 0.47 + . g472.t1 Scaffold_7 AUGUSTUS start_codon 2284005 2284007 . + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_7 AUGUSTUS CDS 2284005 2284078 0.5 + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_7 AUGUSTUS CDS 2284154 2284382 0.5 + 1 transcript_id "g472.t1"; gene_id "g472"; Scaffold_7 AUGUSTUS stop_codon 2284380 2284382 . + 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MKEEAIDLMCKEVAEVGKSKGILHKIENIHVTMSGNKVVSAKLTDWGAYELYTMDKSASEAEIVGSVYNCHFTQLKIA # MQIAFCKKHWTHVDWFVQADFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 Scaffold_7 AUGUSTUS gene 2285209 2285637 0.48 - . g473 Scaffold_7 AUGUSTUS transcript 2285209 2285637 0.48 - . g473.t1 Scaffold_7 AUGUSTUS stop_codon 2285209 2285211 . - 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_7 AUGUSTUS CDS 2285209 2285637 0.48 - 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_7 AUGUSTUS start_codon 2285635 2285637 . - 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MNLTVSHRGQSYSLTLLPDDTLAVLHARLEELTSTPPQLQKLLYKGKNSKALDDQVTLTLAGLKDGMKIQMLGTTANE # LDGVKAVEDDQQKRDRIMKERALKGPTKVCNNPTMLTQYRNPYSVTFMCSSSDLLTVAAVAAII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 Scaffold_7 AUGUSTUS gene 2286518 2287459 0.82 + . g474 Scaffold_7 AUGUSTUS transcript 2286518 2287459 0.82 + . g474.t1 Scaffold_7 AUGUSTUS start_codon 2286518 2286520 . + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_7 AUGUSTUS CDS 2286518 2287459 0.82 + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_7 AUGUSTUS stop_codon 2287457 2287459 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MIKCQCFSVSARSLTPIILNFKLMSSNAEVEAAPLAAHKDKGKGKARDVTERTPLLASSSSNSIPTENSVPRGQIRRL # GIRLVCIFLTALLMCICALAIIVILAWSYSSRASDMSPDDILHKALVMQGPDRVNVLNVSSSEGIWVHVEGRFGLDAGAVVGVNSDPGDGILDRVWKS # LGRWGVRNLDTVSVWTSTINITTRSDPPVFLAAVDIPPLQIPLTVNPPSGYSWLQHVSAPVLIRPTSKTSDLLRFAQDSWRNGQIMVQTEMSTINVRG # GELAALSWKSRLHRQLSDVETALSIKSVSGSILLLPSSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 Scaffold_7 AUGUSTUS gene 2287605 2288363 0.99 + . g475 Scaffold_7 AUGUSTUS transcript 2287605 2288363 0.99 + . g475.t1 Scaffold_7 AUGUSTUS start_codon 2287605 2287607 . + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_7 AUGUSTUS CDS 2287605 2288363 0.99 + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_7 AUGUSTUS stop_codon 2288361 2288363 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MVDPAPINFNVTVPTLPFVVSLLSESSLTPIASVQTDPFALTHPNITLSITGHVLSLPPDAFPVLSAFLTHYLAGRSN # LISISTPLVSDMTIEANFPAPNPKPQILRNVTIHDMKIKPGNTFLASGTVLAHVVLPKGMDVDIDVKRVLPDVLVFDGEVPDDVHIGTPPVQPLPNPL # PEGAFGHIRPDDWLKSRCVSIDHEEGQGSSYAVSAKIVDVPLEVLPGRQKEFSDFVSKVPRVSPLLVHLELTMNSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 Scaffold_7 AUGUSTUS gene 2291371 2292630 0.76 + . g476 Scaffold_7 AUGUSTUS transcript 2291371 2292630 0.76 + . g476.t1 Scaffold_7 AUGUSTUS start_codon 2291371 2291373 . + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_7 AUGUSTUS CDS 2291371 2292630 0.76 + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_7 AUGUSTUS stop_codon 2292628 2292630 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MHSHHGSESTLAFPYLRSTTSLSQSLTSEQEQSLRKAKSSLFLHNAKASTSNVPGPSSPPSSAGVAKSMLLPFMRKRS # KSRLRAKTLENDGRDREHPSLRPKTPPLPEFPAYASSVTLNMVAENGQVIGNGKKKAVGGVSHPRRWKDKEKDRDRSYGDFGDHAPVPPPKDGEVVMR # LDTNLDRMEGIVDTSILSTGTSTMGILSSKGSSIHTLSQSISDDRHSQHSQQSSTNTQYNNLGPILHSEFHNPFSSFSSQSTAATSSSSFTSHPSLSP # YSPPTSVSPPPPRSSSLAHINNVVDRKISPRTIVPNQQQHNKFREGLQPGLNVMIPPTSTNGLHGGVDSVNGLHRNDGSNAIVAPNAQPPVSSHPSDN # DAPPPDSPSWVPPQSWDVQFLDEGEHEAEDEYYSSSEDSLLHNLQEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 Scaffold_7 AUGUSTUS gene 2293899 2295434 0.41 + . g477 Scaffold_7 AUGUSTUS transcript 2293899 2295434 0.41 + . g477.t1 Scaffold_7 AUGUSTUS start_codon 2293899 2293901 . + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_7 AUGUSTUS CDS 2293899 2295434 0.41 + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_7 AUGUSTUS stop_codon 2295432 2295434 . + 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MALKKVPTNIQFAVSLTRLDLSSNRIGDLDDAYLEKIPGLKSLKVQNNRMEKLPWHFPRLRSLTTLNISNNKFRVLPA # VICQLESLRDLDISFNTISELPEELGLLRNLEHLIMVGNQITSIPPTASSLGSLRRLDCRRNLIGDLAVIGMLPKLEKLSADHNRLNGVELSLGPNLS # TIDAGYNEITEIRVVASPVGHPKPYTALFSLDVSHAKLSSISASALSSLPSLRTLKLSHNNIKVLPSSLGDLDYLEVLECADNLLERLPQGIGRLRRL # EVLDVHENNLTELPGELWACMSLGKLNATSNLIEKWDAPSAPPPPTSQNGDTSSSDTATRISTIDLHMHPFPDRKSSASSLSDPFSSPSRLPNLAYAL # EKLYLGENQLSAESLGFLSLFQKLKVLNLSFNLIQELPPGFFKNFLSEIPFTASPSPQQQPQTFQKSSLEELYLSGNKLTTLPTEDLARMTRLGTLFL # NGNRLQTLPQELGKVQSLTILDVGSNLLKYNIYNWEFDWNW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 Scaffold_7 AUGUSTUS gene 2296616 2297938 0.81 + . g478 Scaffold_7 AUGUSTUS transcript 2296616 2297938 0.81 + . g478.t1 Scaffold_7 AUGUSTUS start_codon 2296616 2296618 . + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_7 AUGUSTUS CDS 2296616 2297938 0.81 + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_7 AUGUSTUS stop_codon 2297936 2297938 . + 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MLAAQKLRDFAISYGADGSTMIMVISVSDLFRRDEARSREGSIVDPQPFKTPKAVITDRGLSRLQDEVSAPTGHLALV # FTDIRNSTHLWDVNRGMNTAWRLHNTLLRRKLRFCGGYEVKTEGDAFMCAFPTTMAAVWWSLAVQMELLEQDWPLEILECEDGKPIYDFDNRLIAQGL # SVRMGIHCGSPLCEVDPVNHRMDYFGPMVNRSARINSSAAGGQIMCSEEVIREIRAKLYNGPSTPQSDSQPLEAIDNVRRLGLSIIEVGAVKLKGLEL # PEQLSLIYPGHLVARHNMREVVADPDASGSRVQFSVSQIRQLGLVCLRLESLATSRVFKEIGERKSSIQTVNLSVENDHDEEEDPLYIYGDPNLLLPP # LDEKASSDRDMTLVLDALSGRIENAVAKIKEKALVNSVKYSLISAMGNTRGCLDERTLQSLLDIIQGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 Scaffold_7 AUGUSTUS gene 2301806 2303326 0.9 - . g479 Scaffold_7 AUGUSTUS transcript 2301806 2303326 0.9 - . g479.t1 Scaffold_7 AUGUSTUS stop_codon 2301806 2301808 . - 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_7 AUGUSTUS CDS 2301806 2303326 0.9 - 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_7 AUGUSTUS start_codon 2303324 2303326 . - 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MPHRTRKSEVVSAGNEEDVLANGDLGYEHPVTNTDTGSHPEETTPNGDNPPDGTAPITEIPAIPVPPPDPIRRSARGH # IPSRRLIESEEYGEREAAARRDGEQWSTDHATNENDDQPPPLALIIQNPYTFAATSGDLWVPQTYKQAMKRPDLWFTPMEREYNTLLDKDCWELVPLP # ADANLTGGRWTYAIKFDAEGNLLKRKARYVTQGYMQIQGQDYDKTYGGVARMESVRLVLAIIAVLRLSIFQVDFTAAFLNSPITHNVYMKQPEGFIKP # GSEHLVCKLKKSIYGTMQGSHDWQATLATGYVADGYIASRADPCIRYRQVGNEYTITSTYGDDVCGGSTTTEGRNSAVADLGRRWEANEVTTEVLLGM # TIKQDPGTKAVTISQQTYLLRMITNFSLLHVRRRSTPLPPNVKLSESPTPLADEELQFMKDKPYRSVVGCHHVGTSLYTTRSGIYSSLLARYQLNQDD # THWECVEWAAGYILNTLHYSITYQPDSTQINSQVPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 Scaffold_7 AUGUSTUS gene 2303387 2305768 0.59 - . g480 Scaffold_7 AUGUSTUS transcript 2303387 2305768 0.59 - . g480.t1 Scaffold_7 AUGUSTUS stop_codon 2303387 2303389 . - 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_7 AUGUSTUS CDS 2303387 2305768 0.59 - 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_7 AUGUSTUS start_codon 2305766 2305768 . - 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MSNGSMVNIPRLPDEKQLVGEENWRPFKREISFAVQSRGLTGYIDGTIPKPNPRTEVYPAPIYPTTATPPYSPTPYPE # EWDLHDRLVAGAIVSNIVDPIGLGIDETKRACDIWQSLIKRFEKRDEQRIHLAKTSLRHEVFDPSTDTMESHEKKMRNLLKRVHDLGGTTTDAQFRRI # LIFSMPPDWRQDVRTVPGSSSADAFTYLQTLWYQREEERKEEERDTKRVKALMAAHSQLPTFDQRKGGSRPVITCHNCGKPGHIAKKCWAKGGGMEGQ # GPRGNNKPKTNASANAIPSDENEIVSPMATYVMSANASMGTSTSTAYQRPNPHADTVHRQNHPILKDRNQREGNGEEEADVHRVVIVPVEDCTICHGH # TSLYSPPKPTIKTFLDSGASEHCWVKKDDFIEYTEVQGQGGSSAISGEAGRFQILGTGVVQFVTRIDNSERVIRLRGVKHTPSFGHNLISLTTLDGNG # MLGDWGRGIMTVRSLDGQKIMEGYGRNKMYEVEVLESGRTIVSYSRYQDRPADILTWHRRLGHVSIRRILRMANRNLVDGLKITKREVQGMCEDCIYG # KATKHPFDEVLTHETEVLERVHIDLFGPSRTQTRGGASYLMLCTDGKSSFRVPHFLNNKRKETGVKALHEYRIMAENQTGKKLRRIRIDGGGELNNSL # VDQYCVENGIIIEKVPHNSSAANGVAERAFRTVMEGTRTMLEDADLPYSFWGEAASTFIYTNNFVPSTRSPDTVPVEAWTKQRQDISHLRPFGCDCWA # TLPRRRTDGKLGRQAVKGRLLGYMGRRGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 Scaffold_7 AUGUSTUS gene 2312886 2314054 0.42 - . g481 Scaffold_7 AUGUSTUS transcript 2312886 2314054 0.42 - . g481.t1 Scaffold_7 AUGUSTUS stop_codon 2312886 2312888 . - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_7 AUGUSTUS CDS 2312886 2313829 0.95 - 2 transcript_id "g481.t1"; gene_id "g481"; Scaffold_7 AUGUSTUS CDS 2313871 2314054 0.43 - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_7 AUGUSTUS start_codon 2314052 2314054 . - 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MTTEATSETPSITRTEGSSIAEDLARKYRGVPDIFDRKLSDAVVDLTRVEEGDESGSSSAKEVEIERERAVEKGPGPA # IRLGKGKWPDDFMDAMQSHTSSNLSISTSPTSDPVERLRTPPISGSPPRKLAVVGIGSSRRNESVESLPQFPRRPSHRARHSIDTAGVPPKEALLRRE # ASPDGVPTRVLPRRHSTKPRPAHLLPRGVNDDSDSLVPFPRSVSGENTNSPSPYSSEDASGSQQRLEKPHQPRGRFQSDIEGSSRRRPRPNSYDELGA # KPARSRFESMVNLGGTSGNTSASDLMSRDSIDGSAVRKPLIIKEEGKVPTHFVSHYIVPIQALVPENTNTRQSSNLEIALEGVNLVLCTAPLISILVK # WLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 Scaffold_7 AUGUSTUS gene 2314193 2314525 0.34 + . g482 Scaffold_7 AUGUSTUS transcript 2314193 2314525 0.34 + . g482.t1 Scaffold_7 AUGUSTUS start_codon 2314193 2314195 . + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_7 AUGUSTUS CDS 2314193 2314525 0.34 + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_7 AUGUSTUS stop_codon 2314523 2314525 . + 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MSIEVLIDASPTEALVDSAADIREGDEGDAVELVTDQVNNDLPSSVDGWYGELEEDLREVRIRRGDLGGGVIGKSLSR # SLSTLLGGGIRSVSFLWDFTSCVMDTDTGPVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 Scaffold_7 AUGUSTUS gene 2322331 2323236 0.97 + . g483 Scaffold_7 AUGUSTUS transcript 2322331 2323236 0.97 + . g483.t1 Scaffold_7 AUGUSTUS start_codon 2322331 2322333 . + 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_7 AUGUSTUS CDS 2322331 2323236 0.97 + 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_7 AUGUSTUS stop_codon 2323234 2323236 . + 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MSSTDLANEELKQSIKSAEQESLKQSILTKSNAPRTKITHKGLEDIEDISGRDSNRERERQLEEEERMEKERLARLRA # VEPRQRTVSLSVPPESPVVPASEGWGAPPPVPPHALDMARETNATRPPLYLHTSSDLGTSEPEMNLADLINIDDEPGSNQTVASPKDVQESIEADAPA # VLRSPTGISPFAIQPAPSPSTPSPSAQLPSAQPPTPRPSIFDLNSLWSRSNSSNLSSGPSTSAAEPTANVEPDDQNDVVMDSEPVAANDQDFDMLLEE # KEPETPEIVQATFDTIPQVWTGKVTGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 Scaffold_7 AUGUSTUS gene 2325153 2326797 0.97 - . g484 Scaffold_7 AUGUSTUS transcript 2325153 2326797 0.97 - . g484.t1 Scaffold_7 AUGUSTUS stop_codon 2325153 2325155 . - 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_7 AUGUSTUS CDS 2325153 2325752 0.98 - 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_7 AUGUSTUS CDS 2325907 2326797 0.97 - 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_7 AUGUSTUS start_codon 2326795 2326797 . - 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MISLKDSESSKPETQTQPQSDHVEVPSEEVLELGEEDLATAVPWKKDNAFPKPEDDDNIGIEALKEKEGLAAELKSSS # SKVVLDTMLDVGNDSIVEGQNTSQSSAVGTKTPKAEKPPSSKASTFSLDTLFPLLILSVVASNPPRLISHLLFTQRFLFTHTFQAFPQNGSSAAGEQA # YCLVNLMAVAEFIGNLDLEGVMSARDNPVLSSEDGPMPIPVPMTLPINIGGRPSSRRASMSSQYSTTSKDGSTATTPVLSSSFTLRNRVEQQASVLSS # SANKGSYRHVRGHGFIHWRIRGVSNNPRETMERKESGFSIKSLKLPSIPNMPAIPNIPNLTRSITPGPGDSREKEMVNVSRPGSVRSMRSTRSRKSNI # GSLFGDESTEEDDESEDVGEDEYEDEYEDEDEDENDVDEEEDMDGDLLHPRPEVDDNDESDVGEARASADTRSIKSFESMMKDGKRRAKVKSADRDAA # VVLKKEKQADKKSTTLNTVAGPQGRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 Scaffold_7 AUGUSTUS gene 2326851 2327922 0.16 - . g485 Scaffold_7 AUGUSTUS transcript 2326851 2327922 0.16 - . g485.t1 Scaffold_7 AUGUSTUS stop_codon 2326851 2326853 . - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_7 AUGUSTUS CDS 2326851 2327235 0.66 - 1 transcript_id "g485.t1"; gene_id "g485"; Scaffold_7 AUGUSTUS CDS 2327319 2327810 0.46 - 1 transcript_id "g485.t1"; gene_id "g485"; Scaffold_7 AUGUSTUS CDS 2327903 2327922 0.21 - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_7 AUGUSTUS start_codon 2327920 2327922 . - 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MLYQFCEEGKEGKEAVESDSLQPGLDSTTPSSPSHSPSYFAHAHADSEYYVYEINPYGVKEGWGSAAVVLSATSVSAP # DGSTGAGGGIIDIKEAEIGAMEAIEDLSARWQSFYREVEDVVVEWAEAEIPEVEDESSGTDERSEKAGVSVQKEQRTKEILDQAERVLCCVVGLFPAP # SPCTAWTMLTSIEAAASDTNDTNPSNNSEPTEIITDSAHDDALASRIAALVMVDFGLRDLDLDIGADIGDETKSRKEEQVITVLRACGNELCLLEKVH # TPREKADAMVRAHRVLVGEFLSLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 Scaffold_7 AUGUSTUS gene 2337218 2337706 0.74 + . g486 Scaffold_7 AUGUSTUS transcript 2337218 2337706 0.74 + . g486.t1 Scaffold_7 AUGUSTUS start_codon 2337218 2337220 . + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_7 AUGUSTUS CDS 2337218 2337706 0.74 + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_7 AUGUSTUS stop_codon 2337704 2337706 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITTVMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 Scaffold_7 AUGUSTUS gene 2337787 2338207 0.37 + . g487 Scaffold_7 AUGUSTUS transcript 2337787 2338207 0.37 + . g487.t1 Scaffold_7 AUGUSTUS start_codon 2337787 2337789 . + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_7 AUGUSTUS CDS 2337787 2337862 0.38 + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_7 AUGUSTUS CDS 2337939 2338207 0.55 + 2 transcript_id "g487.t1"; gene_id "g487"; Scaffold_7 AUGUSTUS stop_codon 2338205 2338207 . + 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MSDRRKEDPFKIDEVMNAAEKYMIGIGDTLNLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQ # QMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 Scaffold_7 AUGUSTUS gene 2338249 2338743 0.58 + . g488 Scaffold_7 AUGUSTUS transcript 2338249 2338743 0.58 + . g488.t1 Scaffold_7 AUGUSTUS start_codon 2338249 2338251 . + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_7 AUGUSTUS CDS 2338249 2338743 0.58 + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_7 AUGUSTUS stop_codon 2338741 2338743 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPR # DDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 Scaffold_7 AUGUSTUS gene 2338773 2341079 0.31 + . g489 Scaffold_7 AUGUSTUS transcript 2338773 2341079 0.31 + . g489.t1 Scaffold_7 AUGUSTUS start_codon 2338773 2338775 . + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_7 AUGUSTUS CDS 2338773 2339496 0.8 + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_7 AUGUSTUS CDS 2339547 2340203 0.59 + 2 transcript_id "g489.t1"; gene_id "g489"; Scaffold_7 AUGUSTUS CDS 2340278 2340518 0.47 + 2 transcript_id "g489.t1"; gene_id "g489"; Scaffold_7 AUGUSTUS CDS 2340611 2341079 0.98 + 1 transcript_id "g489.t1"; gene_id "g489"; Scaffold_7 AUGUSTUS stop_codon 2341077 2341079 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYE # DHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNK # APFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQET # FSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETI # RDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNK # QVDNEAIGVEKPINLNTEEVFTKYKPVEKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 Scaffold_7 AUGUSTUS gene 2341381 2341967 0.39 + . g490 Scaffold_7 AUGUSTUS transcript 2341381 2341967 0.39 + . g490.t1 Scaffold_7 AUGUSTUS start_codon 2341381 2341383 . + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_7 AUGUSTUS CDS 2341381 2341387 0.39 + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_7 AUGUSTUS CDS 2341468 2341967 0.48 + 2 transcript_id "g490.t1"; gene_id "g490"; Scaffold_7 AUGUSTUS stop_codon 2341965 2341967 . + 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MNRIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELD # QLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 Scaffold_7 AUGUSTUS gene 2342081 2344251 0.8 + . g491 Scaffold_7 AUGUSTUS transcript 2342081 2344251 0.8 + . g491.t1 Scaffold_7 AUGUSTUS start_codon 2342081 2342083 . + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_7 AUGUSTUS CDS 2342081 2343331 0.84 + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_7 AUGUSTUS CDS 2343433 2344251 0.92 + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_7 AUGUSTUS stop_codon 2344249 2344251 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGTDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARA # VKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADR # VTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSR # LGILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 Scaffold_7 AUGUSTUS gene 2344290 2344547 0.92 + . g492 Scaffold_7 AUGUSTUS transcript 2344290 2344547 0.92 + . g492.t1 Scaffold_7 AUGUSTUS start_codon 2344290 2344292 . + 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_7 AUGUSTUS CDS 2344290 2344547 0.92 + 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_7 AUGUSTUS stop_codon 2344545 2344547 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 Scaffold_7 AUGUSTUS gene 2344837 2345708 0.55 - . g493 Scaffold_7 AUGUSTUS transcript 2344837 2345708 0.55 - . g493.t1 Scaffold_7 AUGUSTUS stop_codon 2344837 2344839 . - 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_7 AUGUSTUS CDS 2344837 2345234 0.97 - 2 transcript_id "g493.t1"; gene_id "g493"; Scaffold_7 AUGUSTUS CDS 2345316 2345440 0.55 - 1 transcript_id "g493.t1"; gene_id "g493"; Scaffold_7 AUGUSTUS CDS 2345704 2345708 0.58 - 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_7 AUGUSTUS start_codon 2345706 2345708 . - 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MCTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIA # ATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSNEPLLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 Scaffold_7 AUGUSTUS gene 2346079 2346456 0.83 + . g494 Scaffold_7 AUGUSTUS transcript 2346079 2346456 0.83 + . g494.t1 Scaffold_7 AUGUSTUS start_codon 2346079 2346081 . + 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_7 AUGUSTUS CDS 2346079 2346456 0.83 + 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_7 AUGUSTUS stop_codon 2346454 2346456 . + 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MLIDGKEIAPHTSSFSRNHLTAAPANPGVVSDLAHLATIMAMITPQTPAHLKTATPPPDITIPIKNTPSKLLRFLEYA # ETNVGGGACYPTPVAFAGRKDMGLIFLIKVDDKDLKILASNMVMFCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 Scaffold_7 AUGUSTUS gene 2350883 2351362 0.63 - . g495 Scaffold_7 AUGUSTUS transcript 2350883 2351362 0.63 - . g495.t1 Scaffold_7 AUGUSTUS stop_codon 2350883 2350885 . - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_7 AUGUSTUS CDS 2350883 2351362 0.63 - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_7 AUGUSTUS start_codon 2351360 2351362 . - 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MVYKRVRLPPCSRKVAPTPAKGKSQQVVVSEDDSASNEVESEDEEEDEDEEEDSAPPPKRPKTTSSISGNISSLLFRF # YFFNLILLQLRCLVVRLNGCPSPNEPKVTTKSAPEHSPDSTFQPVLLADAQGRLRLPEQSTGAVTPFPKFAHARVSHSDSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 Scaffold_7 AUGUSTUS gene 2353100 2353480 0.99 + . g496 Scaffold_7 AUGUSTUS transcript 2353100 2353480 0.99 + . g496.t1 Scaffold_7 AUGUSTUS start_codon 2353100 2353102 . + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_7 AUGUSTUS CDS 2353100 2353480 0.99 + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_7 AUGUSTUS stop_codon 2353478 2353480 . + 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWEVPERVWSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 Scaffold_7 AUGUSTUS gene 2365257 2365959 0.46 + . g497 Scaffold_7 AUGUSTUS transcript 2365257 2365959 0.46 + . g497.t1 Scaffold_7 AUGUSTUS start_codon 2365257 2365259 . + 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_7 AUGUSTUS CDS 2365257 2365464 0.46 + 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_7 AUGUSTUS CDS 2365523 2365959 0.98 + 2 transcript_id "g497.t1"; gene_id "g497"; Scaffold_7 AUGUSTUS stop_codon 2365957 2365959 . + 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS # KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE # AEDEDIAPPPKRLKTTSSISGRIFILHFSSHFINLIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 Scaffold_7 AUGUSTUS gene 2373070 2373489 0.97 - . g498 Scaffold_7 AUGUSTUS transcript 2373070 2373489 0.97 - . g498.t1 Scaffold_7 AUGUSTUS stop_codon 2373070 2373072 . - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_7 AUGUSTUS CDS 2373070 2373489 0.97 - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_7 AUGUSTUS start_codon 2373487 2373489 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MPYNRYAFDEYFHVHGDNPIIDPYTGKYCADTLHEDWSPTTPPVDEFDTPSKTNNSPYNPASSRPPAPLGNNNPYQNG # FRLPPITSFYPPVLDQSRITPPLSQFKPTPTSPGKENEGIQRAHVSGVLKLARKLGKNLDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 Scaffold_7 AUGUSTUS gene 2381483 2382810 0.28 + . g499 Scaffold_7 AUGUSTUS transcript 2381483 2382810 0.28 + . g499.t1 Scaffold_7 AUGUSTUS start_codon 2381483 2381485 . + 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_7 AUGUSTUS CDS 2381483 2381489 0.44 + 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_7 AUGUSTUS CDS 2381639 2381912 0.73 + 2 transcript_id "g499.t1"; gene_id "g499"; Scaffold_7 AUGUSTUS CDS 2381964 2382810 0.62 + 1 transcript_id "g499.t1"; gene_id "g499"; Scaffold_7 AUGUSTUS stop_codon 2382808 2382810 . + 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MRHASQDTDNFHDSNGWFFPVRCPHIIKPYQLILGRTSLCYLQGFYTDDTPSDYEPPHFKAGDYEKDKWYFATHDMEE # VPDNWSVGKVNAGWHEVDVSVSSIATYLPSSTEHDNQPFGGTVTRSVALVPPSLTPAGEIALRAEEIKKQIVDANSRRVVWAAEDEPKEETDTSGVGG # KGPDIVRKPIGIKNDNGEIRCLVNAEETFEERHYYGPSPIAPLGLKDIQRPINSTPTSDFPQTQLVNDSDVEDNNFGEDSHTNSGPRLMRRQESTVSE # AFSMSTSFAGDSVLDTPTPYPTTRKRIDEVISRSPSPDSFMTPDDTRLGSRTVSIEMGVSDNESRGIEANALMEKLALSYDGGMDDIEDEEMLGRLIN # PRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 Scaffold_7 AUGUSTUS gene 2400586 2401592 0.35 - . g500 Scaffold_7 AUGUSTUS transcript 2400586 2401592 0.35 - . g500.t1 Scaffold_7 AUGUSTUS stop_codon 2400586 2400588 . - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_7 AUGUSTUS CDS 2400586 2400750 0.89 - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_7 AUGUSTUS CDS 2401368 2401592 0.37 - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_7 AUGUSTUS start_codon 2401590 2401592 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MQFNGSLKKDLYKEIEVASVDAFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGVVILGNPKVLSKSDR # LRRRTSFGSSSVAGTDMGSISQYDYKAQDESGDLDDMKSQYTGTQSGVTVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 Scaffold_7 AUGUSTUS gene 2403848 2404222 0.87 - . g501 Scaffold_7 AUGUSTUS transcript 2403848 2404222 0.87 - . g501.t1 Scaffold_7 AUGUSTUS stop_codon 2403848 2403850 . - 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_7 AUGUSTUS CDS 2403848 2404222 0.87 - 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_7 AUGUSTUS start_codon 2404220 2404222 . - 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MDSFDNFQYDSTSSYGGMGIVDDTSSIYTANTQDNASSVDLSSLSLSESRHGDHTNGNGHTHSHSIKSGLDEDFDAVL # DDLKDEGAVDLPPHACRSVFAVYHSFNNSSSFCITVTVVSILQHQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 Scaffold_7 AUGUSTUS gene 2404805 2405317 0.76 - . g502 Scaffold_7 AUGUSTUS transcript 2404805 2405317 0.76 - . g502.t1 Scaffold_7 AUGUSTUS stop_codon 2404805 2404807 . - 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_7 AUGUSTUS CDS 2404805 2405317 0.76 - 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_7 AUGUSTUS start_codon 2405315 2405317 . - 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MLLGLIFRESLKSKRSITSWRSESKAVLPTIHDPRPVFVNVTPAYTGNSEKPQLASEFGSIRSTDKSGYGFGRQGEKA # AGLRGFILQRPEESLPRYVSPTPPASPPTVHVALARNPSTTSSFASPEPARESMQSASHYDDDERSTVAEEEDDEVIRQHRPPVFKSSRTAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 Scaffold_7 AUGUSTUS gene 2406886 2407506 0.45 - . g503 Scaffold_7 AUGUSTUS transcript 2406886 2407506 0.45 - . g503.t1 Scaffold_7 AUGUSTUS stop_codon 2406886 2406888 . - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_7 AUGUSTUS CDS 2406886 2407506 0.45 - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_7 AUGUSTUS start_codon 2407504 2407506 . - 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MSMQAQNVLQDWYAREVRGQLEYKEEKASTKKSARLHVDGCAKLLTSNEFTSLIEQANTKKAEETAELARKRDARMTA # NQRLATAMIRYDAEVKGIEEKNEQTLKEWEASVQEWEKERDIARTERRKPAWTKPSKPTYTSGALVKPPAKPKLADFLSAQRIAPSGNQRNAIRYTED # GCGSESDKGSDSEDDDDEDEGEDEGGGSDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 Scaffold_7 AUGUSTUS gene 2426732 2427755 0.62 - . g504 Scaffold_7 AUGUSTUS transcript 2426732 2427755 0.62 - . g504.t1 Scaffold_7 AUGUSTUS stop_codon 2426732 2426734 . - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_7 AUGUSTUS CDS 2426732 2427215 0.64 - 1 transcript_id "g504.t1"; gene_id "g504"; Scaffold_7 AUGUSTUS CDS 2427362 2427505 0.62 - 1 transcript_id "g504.t1"; gene_id "g504"; Scaffold_7 AUGUSTUS CDS 2427568 2427755 0.72 - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_7 AUGUSTUS start_codon 2427753 2427755 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MALPPSTANWHWKNKNVTQWGRNWFTKELENLSVKGDKEGEELTITSIYEFEGDVELGQRKSKLITIYDCKVNLEWSG # KASDGSEVTGHLDIPEVSHETTLDKSSDHQVRPRFPAALIETHGKDLTVSADPSRSGTPAPASAASTTSAATVASATPSVVPAVKKEAKKVSVNSATV # TVDASFMAAADDLFSLLTDEKRIPAWTRAPAQVNSLHMSFLLLIDCLLQSAAKPDTDYSLFGGGVKGKYISLDAPTKIVQTWALQSPTWPSGGES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 Scaffold_7 AUGUSTUS gene 2432126 2432605 0.68 + . g505 Scaffold_7 AUGUSTUS transcript 2432126 2432605 0.68 + . g505.t1 Scaffold_7 AUGUSTUS start_codon 2432126 2432128 . + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_7 AUGUSTUS CDS 2432126 2432605 0.68 + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_7 AUGUSTUS stop_codon 2432603 2432605 . + 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MAPGTTQDFLTTPLSSSGNLTGSTFSKLTSATRVVPTGNAASEKYKLRRMRQQELEQQMRAINEEIEELKNEAAERSD # PTSTGLMSRTSVRKKKSIRKGRNTDENTDSVAQLKAQIREMSEEILSLQSQQNSAWAQGLSDEPPPGYSPRLVVANINSDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 Scaffold_7 AUGUSTUS gene 2433336 2434453 0.83 + . g506 Scaffold_7 AUGUSTUS transcript 2433336 2434453 0.83 + . g506.t1 Scaffold_7 AUGUSTUS start_codon 2433336 2433338 . + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_7 AUGUSTUS CDS 2433336 2433917 0.84 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_7 AUGUSTUS CDS 2433971 2434453 0.9 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_7 AUGUSTUS stop_codon 2434451 2434453 . + 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MTLNTDVQSNWTNDPRAYGLGDWTDDPRAYGLGYSNPDIDIPLEDLDELQRPNTSSQSGQLISLADSVASDSKGMPPK # GKAAPAGLVEEEQHDEEPSSCEAASSPLPAVLDASTPSGSQKFPLSPPTLPVTIHPLDASSPTISIADEDEFPHPSQLTQMARAMRPTPTPKPKTQRD # KADREDQPIEILDDVESDDSTKSAKFQGKQREQYHSLAGAGPSTLAFAKRKWDKSISSSPSTARPKQRLKNSYDPGNEENESSSGSRSRTSSDFLRYH # FHDSFLYLDASVIVRIGLTQFKLHRTLLAEHGVWFTERFQNDPDDRFGELPVYILDGVIEEPDFVNLLTAVKEAMYVRCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 Scaffold_7 AUGUSTUS gene 2437525 2439117 0.4 - . g507 Scaffold_7 AUGUSTUS transcript 2437525 2439117 0.4 - . g507.t1 Scaffold_7 AUGUSTUS stop_codon 2437525 2437527 . - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_7 AUGUSTUS CDS 2437525 2438201 0.4 - 2 transcript_id "g507.t1"; gene_id "g507"; Scaffold_7 AUGUSTUS CDS 2438328 2439117 0.98 - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_7 AUGUSTUS start_codon 2439115 2439117 . - 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MVFRQCSIGGKAYRGDPEVLTDGDDDIQPNKISDSIELEKELQHNTTTRPVPSGDFTDATSSRLNLSNSSSTPRTKTT # NPRFRDAVLTSDIALACTEDEPAGTEAARARALNGFFSVLGLCHTVLTSVDPLTREIEYKAQSPDEAALVQAAADVGYVFLGRDKEILSIRTPGSEIA # ERYELLHILEFSSARKRMSVIVRKMDEEGREGEGEGRIFLLSKGADNVIFERLRKGNEDLKAETERHLSEFANEGLRTLTLAYKTIGDNREEKVEIVS # DEMEQGLRLLGATAIEDRLQDGVPEAIADLKRAGIKIWVATGDKLETAIGTCISYLVVADSRFSCLAIGRSTNLIGHDSNIIIVRGNSKPVHQQISNA # LERFFSEHQMQERPPSRPSTPSRMHPLTRADTNVSSIVGGDNGDRPGGFVLVVDGAALLHVRFLGFTKEGFCSFSVLFVLAGIRIRGNEGHFAQTRYP # LRRRDLLSSFSAAESSRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 Scaffold_7 AUGUSTUS gene 2439713 2440636 0.97 - . g508 Scaffold_7 AUGUSTUS transcript 2439713 2440636 0.97 - . g508.t1 Scaffold_7 AUGUSTUS stop_codon 2439713 2439715 . - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_7 AUGUSTUS CDS 2439713 2440636 0.97 - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_7 AUGUSTUS start_codon 2440634 2440636 . - 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MFSTIAPGVVILPLIIIIALTALKDAYEDFRRHQSDKRVNQTEVDVLAGSKWVNPNVTQGKSRTFVRGIIPTPRLRRK # SAAGAPTASATPDPASKFKPVTHEDPDATVALSPDLASSNRRRNSHRLSFINPFFSSSDDEAFWKPTLWEDIRVGDFVRITDGHPIPADILICATSDP # ENVAFIETKNLDGETNLKSRNAVPGLTHLRSPEACASAENSFKIMCDKPETNMYRLNAMVEMGKNDGDGSGTGAKYSVDLQTVLLRGTVLKNTDWVIG # VVLFTGEDTKIVMNAGKTPSKRSRVERQMNPQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 Scaffold_7 AUGUSTUS gene 2442534 2443630 0.63 + . g509 Scaffold_7 AUGUSTUS transcript 2442534 2443630 0.63 + . g509.t1 Scaffold_7 AUGUSTUS start_codon 2442534 2442536 . + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_7 AUGUSTUS CDS 2442534 2442773 0.9 + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_7 AUGUSTUS CDS 2442828 2443050 0.83 + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_7 AUGUSTUS CDS 2443140 2443176 0.77 + 2 transcript_id "g509.t1"; gene_id "g509"; Scaffold_7 AUGUSTUS CDS 2443225 2443630 0.72 + 1 transcript_id "g509.t1"; gene_id "g509"; Scaffold_7 AUGUSTUS stop_codon 2443628 2443630 . + 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MVHYRSVLTAAVAVGAASSTLAVPLPPSGDLSSIPNIAVTQATAPPIPGPLSTSSGDGSKLNARELDSVFKMEFRYLI # GCHHHPHAHGDEEIKVEVKEFYGHRHNNEQDEQDEQDVPRRTVRFNDTLPLLYAMLTVNAHFRLPTSSMRSKYSNSDIQGTYEHVARCRQRKLRPRWR # LMRKSRQVSLLFIWSAESHWYLRPVSSRPSKMTLDEAWSYIGDLETPLNDPEKLRLNNDLARYVNPSDARHAWTEVKENWDEFLKTAAGKKLEAQAKE # PQVQNIDFKQFVHASLVIGKTAENFKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 Scaffold_7 AUGUSTUS gene 2444206 2444850 0.14 - . g510 Scaffold_7 AUGUSTUS transcript 2444206 2444850 0.14 - . g510.t1 Scaffold_7 AUGUSTUS stop_codon 2444206 2444208 . - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_7 AUGUSTUS CDS 2444206 2444850 0.14 - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_7 AUGUSTUS start_codon 2444848 2444850 . - 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MNSPIEPGSPTLSTPSSGSDVEEISLPPSSSFPSGLVINSIGSFNNTVPSSATSSSSKRRLNPGSVSSRDPRDSKSRR # RDDPHHYAKGAGGEGERERDRERQGGRGANYEMQKEKREKDELLDMGAVEFLRKGRCKARTTTVPDLLSDLNVHCRNWRSICGNIIRMRFPTNPTPYR # IYKLWYGFTDSEFTLSCPSRVVCSFMHYSDSCSHVSVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 Scaffold_7 AUGUSTUS gene 2449534 2450295 0.65 - . g511 Scaffold_7 AUGUSTUS transcript 2449534 2450295 0.65 - . g511.t1 Scaffold_7 AUGUSTUS stop_codon 2449534 2449536 . - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_7 AUGUSTUS CDS 2449534 2450295 0.65 - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_7 AUGUSTUS start_codon 2450293 2450295 . - 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MDPEHNDNKELGRVEFAHVREEYGTPHMVSHRSSLAGELYNACKEEKAITFHFDSSCSIKTWQPKPKLVVTPRNGESY # DVFADVVLAADGIKSSVRPQILKELGVDVEVTDSGQSAYRIMLTRDQMKSDSETLELLEADQVTRWIGERRHIIAYPISNKNIYNISTAQPDTHFASA # PSATYTTRGSKVDMLDSFKDFCPLIHRMLNLVPEGDVCEWKLRVHSPLPTWVRGSVALVGDACHPTLPHLGKFLRGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 Scaffold_7 AUGUSTUS gene 2451291 2452184 0.75 - . g512 Scaffold_7 AUGUSTUS transcript 2451291 2452184 0.75 - . g512.t1 Scaffold_7 AUGUSTUS stop_codon 2451291 2451293 . - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_7 AUGUSTUS CDS 2451291 2452184 0.75 - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_7 AUGUSTUS start_codon 2452182 2452184 . - 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MPSKPPNYLFLFRSMFTKAHLEQTGRSPTEEQHTHAVKSLTPEERLRLKEASDCLKKSWNNSRGERNKRPRRDLTPDY # FQARNQSVRRRSRRRDQVLASPASSSSDSFESLPSPSSSDTPFDWASDSESCGSYQCDSFKPVTPSPLRANFDALPVSDMENDGYLDRLQDSAAFLAL # PSTESHSYTGSASPAVNHTRDISFHNVSSTALDSVFALCTCYAAHDEAQVWQGHTSATNTPFQRYSPAYPSAELGMSVANEYPKDELWWILFQRAIAS # DSDNDQLVWDQDIRALERYAASC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 Scaffold_7 AUGUSTUS gene 2454311 2455779 0.82 - . g513 Scaffold_7 AUGUSTUS transcript 2454311 2455779 0.82 - . g513.t1 Scaffold_7 AUGUSTUS stop_codon 2454311 2454313 . - 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_7 AUGUSTUS CDS 2454311 2454724 0.9 - 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_7 AUGUSTUS CDS 2454793 2455779 0.82 - 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_7 AUGUSTUS start_codon 2455777 2455779 . - 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MWFLSPVNHCQPEFSSGNVESSFPFFEKFRREILSSVEKVIACITSQNQTNDGDVKAEDGKSKQPNYLLMLRSMLSKA # YTEETGQRMTTREHGNAVKSLTSEETNILKSAYEDLRLGKSSKSTGREPPRKKRRSRNLTPQDFQARKRPRIDVERQNNFDESSVVSPTTSTYSFADT # QGSPSSRQTPSGSSSESGSYPSYNSYDNQRFKPSPISATFNKLPVDGYWNHSPHLTAPTSAPRTNYHYSLSATSPAVMVSSAATQDNYSSGTSALFSG # TYFSIDSEGQVQQEQRVFGTNMGLPYTYSPVHPADPSLGMVNGYSASVNSTRDPRAHQEREMFAFTRRTPRASFPNVPVPARPTAEYNLSMRNDYSSS # YLPNDSPIYLADNPLLVSNMGNHGLYHHSLRHSTAPLGTEYHSLDVENSAAVVYSAGNPLRNDTPSTSVAYFSVDDGKQVQEMFETFIEPDAYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 Scaffold_7 AUGUSTUS gene 2456795 2457232 0.76 - . g514 Scaffold_7 AUGUSTUS transcript 2456795 2457232 0.76 - . g514.t1 Scaffold_7 AUGUSTUS stop_codon 2456795 2456797 . - 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_7 AUGUSTUS CDS 2456795 2457232 0.76 - 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_7 AUGUSTUS start_codon 2457230 2457232 . - 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MSLWAETAYSTDGTSATIPPTDATPSGSRTEAKRDNDLEEEVVKLAERIQKQFDLERDNDTEEPGKPSKEAYSPTDKA # IHDLSSGGPGVPLIQPNSSTAAVALELEPAPLSVSATTFSEGRSTSQDTSILVNEGVNEGAQHQGTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 Scaffold_7 AUGUSTUS gene 2459018 2462070 0.31 + . g515 Scaffold_7 AUGUSTUS transcript 2459018 2462070 0.31 + . g515.t1 Scaffold_7 AUGUSTUS start_codon 2459018 2459020 . + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_7 AUGUSTUS CDS 2459018 2460685 0.89 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_7 AUGUSTUS CDS 2460757 2461126 0.36 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_7 AUGUSTUS CDS 2461295 2462070 0.44 + 2 transcript_id "g515.t1"; gene_id "g515"; Scaffold_7 AUGUSTUS stop_codon 2462068 2462070 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MGDWDFYCALCAAPFHTSGVEETLRDFHVDESDQKFFVWAHTLQVIAHNPQASGLSCCYISGDGRCDYYGTARCKPSD # DPNCPALSDGSETFDVDTYYNYASMQEGAIPVHRNCLEIFKKALAHEKGASSSQMGSVDLDPDILFSAMRSKRKSKGLRCLDLDYFELDEVKREQYFY # FDVETSVSTILCTFPSTLISFLSLQPFLFDPLHIKALEDYINVMPLSSPSLGTDSAPFHYPSSRDPFINLPPEILTEILLTLSEDSFTALIAASPATC # QVRLMPSFWRKRVEIHMSWSWEIIAHIALSEQLYNWEKIYSDLERFSKLDKTSGKDFLGVANRRRIYNVCRQLTPSYVQLENEARVASPTGDSEEMLR # TAKCQHFVSVSMPLVSAFNSTNTFVLHRWSDIAHEEKVLNISWNSSGALAGIALTIRGVRSVVEGSEIGAGAVESLRTNTLVIQEGDWIDGFLFFMSA # PEPKIIGVTVRTLRSPGTTFGSTNGAGLRLMSVDNGNVFVGLKAAVTTDSISKLGILECPLPSSVDLPPSPPKVDAATRKMIWKNQLPPSSVRALPFH # IGYNNCGDEATESGQIMEFLIFGESEAKLRTLTGIAVSADFLGFFAFHNDAEPSFIGLSKKNLKHFSIDGPGGERVVKLSLGVGSTPVGLKVSSLYLN # ISCFNSAHECSCSGFTISNKYYSQREYSRFTAFGVLRAPSTSSEPLPSSITISPGAWDPTPPPPHWHAEGPVYGSSEHYALTYLDLTKPISKISGLLA # APEWYDIVELGGFVVTYVDGSTCYVGMPTDQWREVKDAESAPVVVKRHEGMSHGVGKADEGVVAHVTTAEARLQNHDTGAGACWDLGIDGGHICEVTV # WAGKYLNGVQFHTDDGRASPRWGKCGQLATAVITTKPDSAVHTGAVAVKFYLDSDRDHYNASDARPLGLQALVAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 Scaffold_7 AUGUSTUS gene 2463309 2466099 0.77 - . g516 Scaffold_7 AUGUSTUS transcript 2463309 2466099 0.77 - . g516.t1 Scaffold_7 AUGUSTUS stop_codon 2463309 2463311 . - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_7 AUGUSTUS CDS 2463309 2464897 0.77 - 2 transcript_id "g516.t1"; gene_id "g516"; Scaffold_7 AUGUSTUS CDS 2465031 2466099 0.95 - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_7 AUGUSTUS start_codon 2466097 2466099 . - 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MPTADEVAVILPGPGEATDYRDIILQLRAGPLKRIYETNPAYQPLHYVLLFPRGKLGWHPKIHYVNGDASATKFVSQM # EYYAYQLHQRPAISVVDQKPWQESNHLFQAKNLFQQFIVDGWAQTNQSRLSFLKHNQSMLRAEVYSGLVDAVHSGDVDLDNIGTRTILPSSYIGGTKH # MYQLYQDSIALARHFGKPDLFLTVTADPNAKEIKDALLPGQTANDRPDLIARVFREKIRKLLKLIDDGCFGKCRGRVHTIEFQKRGLPHIHILIFLYP # DARLQEPHQIDQAISAQLPDPITQPKLFKLVEKLMIHGPCGYLNPNASCMKDGKCSKNFPKTFQEQTVLSEDEYTLYARPNNAFKYIHKYIYKGHDRT # TMAIGENKDEIQQYIDSPYVSTSEAVWRLFHYWMHEEKPNVVRLPVHTEAGRFVVFNPEVNTPVEILENAAAKSSKLEAYFKLNNAEKDYADQHPNDA # STLARSLLYQELPSKFVWVPSTTTWKIRESGEPSIGRMNFAHPISGERFYVRLLLTVVRGALSFAHLRSYNNIEYATHQEACFARGLLQDDKEWQECL # DDARHMQSGRQLRSLFATILKDCRPNQPAELWNQFKHHICDDIYIILHESGILDYPSQDEIYDYGLYLIDKNLFHAGLIQGLKHFVGMPLPNYDFWTN # LEGNRLIVEQLAFNADEQRQLANENIAKLNIEQAHAFNTIRAAVYGHLPKMFFLHGPAGTGKTFTYNTLCFDLRADKKIVLCCASSGLAALLLKKGCT # AHSTFKIPIELFDGKTCHVPKQSLLADLLRQTSLIIWDKVPMQDRLCQEAVDLTMQDIQGNSKPFGGVTVVFGGDFQQILPVVRKGGREQIVGQCIQR # SRLWRDIQALHLTENKRLDSGTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 Scaffold_7 AUGUSTUS gene 2468194 2469131 0.5 - . g517 Scaffold_7 AUGUSTUS transcript 2468194 2469131 0.5 - . g517.t1 Scaffold_7 AUGUSTUS stop_codon 2468194 2468196 . - 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_7 AUGUSTUS CDS 2468194 2468661 0.59 - 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_7 AUGUSTUS CDS 2468817 2469131 0.81 - 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_7 AUGUSTUS start_codon 2469129 2469131 . - 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MVVFRNSPPTTPQRQRNAAREQERQGRLLESPEIRRTPSRRHNGPPIPFLLGNNNVEHAQHPLFFQDDPFVDVDYNGQ # QQRLTPGIAEQVRRLAENPTTQTVSLPFNHLPPLLHAQAAAIPPHPVRASRGHPRGRGQGRGQRQSRGRAQGQAYNDLNQNQIPLIGLANHQHENNNP # PQRPDGLQGEGNPPADRPPNNGNRLPNPAEPIPIGLQPVDNNKIYETFYLGQMNVECPNCHALHWAAERLTKSSFLVHAVNQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 Scaffold_7 AUGUSTUS gene 2476395 2476912 0.42 + . g518 Scaffold_7 AUGUSTUS transcript 2476395 2476912 0.42 + . g518.t1 Scaffold_7 AUGUSTUS start_codon 2476395 2476397 . + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_7 AUGUSTUS CDS 2476395 2476413 0.42 + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_7 AUGUSTUS CDS 2476473 2476912 1 + 2 transcript_id "g518.t1"; gene_id "g518"; Scaffold_7 AUGUSTUS stop_codon 2476910 2476912 . + 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MLPRFVISSPGSTRSRDSDNELLSGFPSAVSASRASSSTKVSVDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLP # PRSRKIAPTTAKGKSRQVVVSDDDSAPNEVESEDEEEDEDEEEDSAPPPKRLKTTSSIPGKTLFFFLFDFINSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 Scaffold_7 AUGUSTUS gene 2480638 2481415 0.85 + . g519 Scaffold_7 AUGUSTUS transcript 2480638 2481415 0.85 + . g519.t1 Scaffold_7 AUGUSTUS start_codon 2480638 2480640 . + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_7 AUGUSTUS CDS 2480638 2480664 0.89 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_7 AUGUSTUS CDS 2480771 2480906 0.91 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_7 AUGUSTUS CDS 2480988 2481139 0.99 + 2 transcript_id "g519.t1"; gene_id "g519"; Scaffold_7 AUGUSTUS CDS 2481191 2481415 0.99 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_7 AUGUSTUS stop_codon 2481413 2481415 . + 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSTKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLLAAYLESRPDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGH # VSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 Scaffold_7 AUGUSTUS gene 2481970 2484140 0.83 - . g520 Scaffold_7 AUGUSTUS transcript 2481970 2484140 0.83 - . g520.t1 Scaffold_7 AUGUSTUS stop_codon 2481970 2481972 . - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_7 AUGUSTUS CDS 2481970 2482788 0.99 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_7 AUGUSTUS CDS 2482890 2484140 0.83 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_7 AUGUSTUS start_codon 2484138 2484140 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGTDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARA # VKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADR # VTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKIGISNQVNWSR # LEILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 Scaffold_7 AUGUSTUS gene 2485132 2485686 0.71 - . g521 Scaffold_7 AUGUSTUS transcript 2485132 2485686 0.71 - . g521.t1 Scaffold_7 AUGUSTUS stop_codon 2485132 2485134 . - 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_7 AUGUSTUS CDS 2485132 2485686 0.71 - 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_7 AUGUSTUS start_codon 2485684 2485686 . - 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MEGSSLNPYERKFRRGDLLNLYYKILVWGRIAINLNPQKPHRINVITKIPLKRSEMIIGINLKTLKELGREWRYEILK # RGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYK # PVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 Scaffold_7 AUGUSTUS gene 2486246 2486887 0.99 - . g522 Scaffold_7 AUGUSTUS transcript 2486246 2486887 0.99 - . g522.t1 Scaffold_7 AUGUSTUS stop_codon 2486246 2486248 . - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_7 AUGUSTUS CDS 2486246 2486887 0.99 - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_7 AUGUSTUS start_codon 2486885 2486887 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIV # ESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLN # QTLGLARNIPFKFGEVTVYLQLHVQNKAISSVIRETF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 Scaffold_7 AUGUSTUS gene 2487119 2487442 0.49 - . g523 Scaffold_7 AUGUSTUS transcript 2487119 2487442 0.49 - . g523.t1 Scaffold_7 AUGUSTUS stop_codon 2487119 2487121 . - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_7 AUGUSTUS CDS 2487119 2487442 0.49 - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_7 AUGUSTUS start_codon 2487440 2487442 . - 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 Scaffold_7 AUGUSTUS gene 2487472 2487741 0.48 - . g524 Scaffold_7 AUGUSTUS transcript 2487472 2487741 0.48 - . g524.t1 Scaffold_7 AUGUSTUS stop_codon 2487472 2487474 . - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_7 AUGUSTUS CDS 2487472 2487741 0.48 - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_7 AUGUSTUS start_codon 2487739 2487741 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 Scaffold_7 AUGUSTUS gene 2489047 2489433 0.54 + . g525 Scaffold_7 AUGUSTUS transcript 2489047 2489433 0.54 + . g525.t1 Scaffold_7 AUGUSTUS start_codon 2489047 2489049 . + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_7 AUGUSTUS CDS 2489047 2489433 0.54 + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_7 AUGUSTUS stop_codon 2489431 2489433 . + 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEDVNRRFR # GPLQWNLGWDHHNGGLPPWVTPNLPVVPWEVSHTPLPGEREDLPLDRYRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 Scaffold_7 AUGUSTUS gene 2498028 2499207 0.3 - . g526 Scaffold_7 AUGUSTUS transcript 2498028 2499207 0.3 - . g526.t1 Scaffold_7 AUGUSTUS stop_codon 2498028 2498030 . - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_7 AUGUSTUS CDS 2498028 2498711 0.75 - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_7 AUGUSTUS CDS 2498890 2499207 0.31 - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_7 AUGUSTUS start_codon 2499205 2499207 . - 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MEGDLRDAVRERKVAEEKLSSSTRKSSQLTTTLLYQQGRVDESNALATRQRRLVEELQEEVHRARDRAAFVEQMVKEY # PDEGYYEVVLPPFRSSKEILTRLARTSAAARGVHGDLYIRSISSIQWFFNNAVDEDEGLYRLVLEHSRFDNDSPFLTAAQHAGFAPPPDNSLEPPLHR # RMLALSTALPHSDGVGRWDDLVPALPSVDQLTVDWEQLMLRYIHHITDVPLSGTDTQVPMSSVEPGTESLAEVTVEQLPEAPPLFLPEQESPTSPSPP # PTSPTLPPPFASLANLTIDLTGDDDDLYETEESRMARVSMSREVVDSVAVQSVVKEEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 Scaffold_7 AUGUSTUS gene 2502660 2503097 1 - . g527 Scaffold_7 AUGUSTUS transcript 2502660 2503097 1 - . g527.t1 Scaffold_7 AUGUSTUS stop_codon 2502660 2502662 . - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_7 AUGUSTUS CDS 2502660 2503097 1 - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_7 AUGUSTUS start_codon 2503095 2503097 . - 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MARLPEPATRADYRQEVLRIDNCYWKCEETRKREAGKPFIARNPKKGSSDFKTGSTNQQNDSQPSGSSAPFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKQKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 Scaffold_7 AUGUSTUS gene 2503411 2504397 0.11 - . g528 Scaffold_7 AUGUSTUS transcript 2503411 2504397 0.11 - . g528.t1 Scaffold_7 AUGUSTUS stop_codon 2503411 2503413 . - 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_7 AUGUSTUS CDS 2503411 2503904 0.51 - 2 transcript_id "g528.t1"; gene_id "g528"; Scaffold_7 AUGUSTUS CDS 2503963 2504204 0.31 - 1 transcript_id "g528.t1"; gene_id "g528"; Scaffold_7 AUGUSTUS CDS 2504300 2504397 0.65 - 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_7 AUGUSTUS start_codon 2504395 2504397 . - 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MCLLIITYDYDTQYISVIIWDQPAAVLLSRSALANSEENTFFTTAQSFAPFSDSISAIGQPRCCNRGFGPATVPTTSI # LLEAMEEEQQFEYSALYTGDGQPVQVLTPRCGQPPPIARRTGKQPQRHGASESPRHPPPHFDLDAGDHNDQDPPVDPDDPGADNNNDDLDDGSSGLPR # GEPGDPSGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTILAALGHPSDSSESKSKVKELEVFDGSDPENSRGSSSILPWSSMTVPSISPT # SGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 Scaffold_7 AUGUSTUS gene 2532085 2532600 0.49 - . g529 Scaffold_7 AUGUSTUS transcript 2532085 2532600 0.49 - . g529.t1 Scaffold_7 AUGUSTUS stop_codon 2532085 2532087 . - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_7 AUGUSTUS CDS 2532085 2532600 0.49 - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_7 AUGUSTUS start_codon 2532598 2532600 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MHFAMNGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNL # LEELGYKLDAIPIAGDNQGSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFRSMLGLEFYSSTNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 Scaffold_7 AUGUSTUS gene 2533109 2535906 0.69 - . g530 Scaffold_7 AUGUSTUS transcript 2533109 2535906 0.69 - . g530.t1 Scaffold_7 AUGUSTUS stop_codon 2533109 2533111 . - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_7 AUGUSTUS CDS 2533109 2534213 0.77 - 1 transcript_id "g530.t1"; gene_id "g530"; Scaffold_7 AUGUSTUS CDS 2534396 2535906 0.9 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_7 AUGUSTUS start_codon 2535904 2535906 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVA # VAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVG # TVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMH # RRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKS # GALPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVY # NRTPMRRHKWKTPYEILYNKVPRIDHLRVFGCGAASSLYATTRSNPDPKDPIPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPPPQP # RNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIR # LCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVV # KGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYM # KTLGFKPEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 Scaffold_7 AUGUSTUS gene 2536462 2536968 0.97 - . g531 Scaffold_7 AUGUSTUS transcript 2536462 2536968 0.97 - . g531.t1 Scaffold_7 AUGUSTUS stop_codon 2536462 2536464 . - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_7 AUGUSTUS CDS 2536462 2536968 0.97 - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_7 AUGUSTUS start_codon 2536966 2536968 . - 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAIGNIRLRISPSIRILAKEYSDTAKK # LWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILYLSSHHVTLSLSKPCLSLKLQSSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 Scaffold_7 AUGUSTUS gene 2545947 2546468 0.99 + . g532 Scaffold_7 AUGUSTUS transcript 2545947 2546468 0.99 + . g532.t1 Scaffold_7 AUGUSTUS start_codon 2545947 2545949 . + 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_7 AUGUSTUS CDS 2545947 2546468 0.99 + 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_7 AUGUSTUS stop_codon 2546466 2546468 . + 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MAHRHAPDGVHRPVAGDISARGAADALELDADGYSIERYTLFAVGSNTNSRKLFQRQMSTHHDRSDTLQQNILRVDIL # TIQRQKHDLNDQLQRRRLDEDPQYRKEAAVVVTATAVIVVPMASEACGRAMRRPDPISHEGGGDDVEHDSEGVEDLDPDGEAGCEYGVGGGDFAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 Scaffold_7 AUGUSTUS gene 2550697 2551692 0.88 - . g533 Scaffold_7 AUGUSTUS transcript 2550697 2551692 0.88 - . g533.t1 Scaffold_7 AUGUSTUS stop_codon 2550697 2550699 . - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_7 AUGUSTUS CDS 2550697 2551692 0.88 - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_7 AUGUSTUS start_codon 2551690 2551692 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MKTLGFKRLSSDAGIFIRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGNSCHTGNAEILVKPKNSFACGLIVVAKR # SILINAYLDKVLKRCGMENAKMADTPLPAGFQPEPTKGQSNSALRSKFQMVIGSLLYLMLGTRPDISFAVTKLAQHAANPSQEHLNKALYICRYLLGT # RSYALCYDGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNLLEELGYKLDAIPIAGDNQ # GSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNTLQIFSQRILAYQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 Scaffold_7 AUGUSTUS gene 2551734 2554456 0.74 - . g534 Scaffold_7 AUGUSTUS transcript 2551734 2554456 0.74 - . g534.t1 Scaffold_7 AUGUSTUS stop_codon 2551734 2551736 . - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_7 AUGUSTUS CDS 2551734 2552540 0.98 - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_7 AUGUSTUS CDS 2552588 2554456 0.76 - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_7 AUGUSTUS start_codon 2554454 2554456 . - 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVA # VAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVG # TVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMH # RRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKS # GALPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVY # NRTPMRRHKWKTPYEILYNKVPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHR # STRLPDRNPDPKDPIPPPGDDDVPIFHQPTTPQMRQDPEQDVARLCQLNSQHEILLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQ # PGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKAC # QEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLH # ETIYMEQPEGFRIKGKEDKVPYCAKLCMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 Scaffold_7 AUGUSTUS gene 2555011 2555589 0.5 - . g535 Scaffold_7 AUGUSTUS transcript 2555011 2555589 0.5 - . g535.t1 Scaffold_7 AUGUSTUS stop_codon 2555011 2555013 . - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_7 AUGUSTUS CDS 2555011 2555589 0.5 - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_7 AUGUSTUS start_codon 2555587 2555589 . - 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI # GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILYLSSHHVTL # SLSKPCLSLKLQSSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 Scaffold_7 AUGUSTUS gene 2560296 2561072 0.55 + . g536 Scaffold_7 AUGUSTUS transcript 2560296 2561072 0.55 + . g536.t1 Scaffold_7 AUGUSTUS start_codon 2560296 2560298 . + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_7 AUGUSTUS CDS 2560296 2560544 0.56 + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_7 AUGUSTUS CDS 2560824 2561072 0.55 + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_7 AUGUSTUS stop_codon 2561070 2561072 . + 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MVHSQSLLAALVAIAVTSFALAIPIQGAAGVFSTQENAASTPGVPRTNFIPPPAPINSVYRRSVIVGEEAEDIDIDSG # EEPYWVEEEVRLSLDISESPLRELSRRAGNSVGDKELSEAGELTYKDTKGFDHTIKLVGVQKTESSRATSFEGVHYVGMYEFRGCPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 Scaffold_7 AUGUSTUS gene 2566936 2567394 0.99 + . g537 Scaffold_7 AUGUSTUS transcript 2566936 2567394 0.99 + . g537.t1 Scaffold_7 AUGUSTUS start_codon 2566936 2566938 . + 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_7 AUGUSTUS CDS 2566936 2567394 0.99 + 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_7 AUGUSTUS stop_codon 2567392 2567394 . + 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MPSTKRSTPVVKLSKSFKKPRCSSNIHCIPSSSLKTNNNAGSSSSSSDSSSDSGSDSTSDSCSSDGNNNDDIAQDDTL # KEKGRKEKTRVKIIHIPYVVLDCQSLSIYSSHSRKHRIDPMDKAGRWAVCAVDAFLNINSIETTKLESLEEEYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 Scaffold_7 AUGUSTUS gene 2576466 2578399 0.16 + . g538 Scaffold_7 AUGUSTUS transcript 2576466 2578399 0.16 + . g538.t1 Scaffold_7 AUGUSTUS start_codon 2576466 2576468 . + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_7 AUGUSTUS CDS 2576466 2577590 0.88 + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_7 AUGUSTUS CDS 2578007 2578399 0.21 + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_7 AUGUSTUS stop_codon 2578397 2578399 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MLKNPFTPVVIIIDALDECGSQEKDGPRDKLLSLLINNTNELPRNFHVLVTTRLESDVIVHLESASEPHVQYMSKISN # TNEDIFKYVCHQMMNGSKRGMLKEDQCKILAERAEGFFQWAYTVCKSLHGQGKAGMSVNKRFQRFITLGPADQKDLQALDRLYMSILNDVFDPEDEEA # MNSYRQVVSQLLAAFQPLSQTVLKRLQLAGDVEEDDESNVEYVLPFLGSLLTGVDGLDAPVKPVHASVRDFLLDSNRSKQFVVDLKEGHTTLAKGTLN # IMVEDLHFNMCDLENSYILNSEVKDLHKKILKGLSMEILYACCFWDLHLEKLEQKDWCLPILQKFFYNYSLFWIETLSLTRNMHVASRAATIIRKIIG # NAKQWGLMLLLSPDCKKIVIGSSDSSVIIWDVESEKICGDPLQGHTHQVSSVAFSPDGRKIISGSWDKSVRVWSAQTGMALFDALQGHTKGVKSVAFS # PNGQTIVSGSDDFTIRVWDAETGKAVGHPLQGPYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 Scaffold_7 AUGUSTUS gene 2578855 2579892 0.94 + . g539 Scaffold_7 AUGUSTUS transcript 2578855 2579892 0.94 + . g539.t1 Scaffold_7 AUGUSTUS start_codon 2578855 2578857 . + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_7 AUGUSTUS CDS 2578855 2579892 0.94 + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_7 AUGUSTUS stop_codon 2579890 2579892 . + 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MLILDIQLAIHCWDIAIISLQLLVHLWKETCDRLFRSFSEDLGCRNSRSYWKSTARSYKRDTLHLLLTRWKDNCIRIF # GQLYKIWNAESGNAVGNQLNEHTGAVSSVAFSPNGQKIISGSWDKTIRIWNRYTGEAVGDCLQGHTNGVTSVAFSPDGQKLISGSFDCTLCIWDLNNE # DPKPVVLQGHKGIVTSVAFSPDGNKIASASEDHSIRIWNVETGSAIGVPLWGHSRRVNSIAFSPNGKMIASGSLDKSVRLWHVENGYSTSELSRISSP # FDTCHIDSKGWLCNSNSELLIWIPPEYRFVLLFLPMQLLISQDGLCILDLSHFKHGTDWKECFTGYMQISK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 Scaffold_7 AUGUSTUS gene 2589692 2590261 1 + . g540 Scaffold_7 AUGUSTUS transcript 2589692 2590261 1 + . g540.t1 Scaffold_7 AUGUSTUS start_codon 2589692 2589694 . + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_7 AUGUSTUS CDS 2589692 2590261 1 + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_7 AUGUSTUS stop_codon 2590259 2590261 . + 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDTLNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERI # EKFDELKQKIISQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 Scaffold_7 AUGUSTUS gene 2590882 2592615 0.54 + . g541 Scaffold_7 AUGUSTUS transcript 2590882 2592615 0.54 + . g541.t1 Scaffold_7 AUGUSTUS start_codon 2590882 2590884 . + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_7 AUGUSTUS CDS 2590882 2592615 0.54 + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_7 AUGUSTUS stop_codon 2592613 2592615 . + 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MPESRVREASEETVLAIRNLSHATATEAVTNLKSRKRFVRGTRGRELKLRTTIENIDNGVQIETEALLDSGATGSCIN # KDFVEQHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHY # ESPEDDGTEEKLVDGERIFWFDWDGYLSDQGHIKVQTATTDAATPYLAEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDE # FLEENLRSGRIRPSRSPMASPFFFVKKKDGTLRPVQDYRKLNDMTVKNRYPLPLIQELIDKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTNRGL # FEPTVMFFGLTNSPATFQAFMNHILRELIDQGHVIVYMDDILIFTDNIEEHRIIVRKVLDILKANKLYLKPEKCTFEAREVEYLGIIVGNGQIRMDPK # KVEAVRTWQPPQKKRELQSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDAFNQLKDRIIEDVTLIIPRETGKFRIEADSSITQMVLSYR # KTSMESGDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 Scaffold_7 AUGUSTUS gene 2611516 2612759 0.67 + . g542 Scaffold_7 AUGUSTUS transcript 2611516 2612759 0.67 + . g542.t1 Scaffold_7 AUGUSTUS start_codon 2611516 2611518 . + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_7 AUGUSTUS CDS 2611516 2612149 0.93 + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_7 AUGUSTUS CDS 2612263 2612279 0.95 + 2 transcript_id "g542.t1"; gene_id "g542"; Scaffold_7 AUGUSTUS CDS 2612412 2612759 0.72 + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_7 AUGUSTUS stop_codon 2612757 2612759 . + 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MSFEGIWALEFEAENAANGRIINMECVDITNKQFPHQHPPNVHFSINSATDLPLDWVSSFSYAHQRLLIVAMNDSLWK # KVVKELYRVLQPGGWIELLEVEAQELCFDVGPQSKKLVSLIKAMYGAKGIIGNLGTYLPSILTQAGFTQVGFERRDVPIGQSQADGNERKIFIRSKYW # QNLWKAMKEPVLKGGGMALLKQVKNMMSFYKIVVGKDSSWLGSGPTGRTSSLHAQALNESLIIQVVIQFRFKDKNSNPNCQNSYNRCPKTSHWCSSSA # YSQQEKAFIPAVNPVSPPNSGKKHYCFTQIIDVMSNQVLTTSYKGPIQSLTDKCQSKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 Scaffold_7 AUGUSTUS gene 2628036 2630550 0.3 - . g543 Scaffold_7 AUGUSTUS transcript 2628036 2630550 0.3 - . g543.t1 Scaffold_7 AUGUSTUS stop_codon 2628036 2628038 . - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_7 AUGUSTUS CDS 2628036 2628311 0.84 - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_7 AUGUSTUS CDS 2628424 2630550 0.31 - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_7 AUGUSTUS start_codon 2630548 2630550 . - 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MENPYNHGRPSYYDQSGPVSYNYENHAGPSSYPFQYGVNGHAYQNYHPQLSSQNYMHAQNPMINAKQPQNYPHPPQPY # PTYTNHHSYTAPPIPNSSSAWHHPIHQQPEVHSPLQQISTSLPYNLNVETPSHNDASSHSHPPTPAPTSSSSQTAQLFTASTSSPTNPSSSSNSQDSH # STPMSIFSTTWAIWSRRPTDPNLAPGLVFSSRIRPPDYIVRDALDIRTPPASPTTEATPLPDIESQQTREDVEWGVTDSVPEPAVVLLPAASVASSEE # TSTTATATPSTTLPGSPASSTTSISVSAPAGPSKDTSSEYTETPTSPELALTPDVAAVSTTTMSPKSPPPLKKSWASILRPTTDPSPSDAVTQRTRPR # IPTSSIVGFSVPADAIGSSQGGGQAIPTGKRAELLALLNSDLKPASNSGPTSSGISYAAMSVASTKIDFKAKTSPSKIHPRGLINTGNMCFANSVLQL # LTYSPPFFRLFHELGRIGMEDVKQTSGVQVPLVDATIEFLTEFLPEDRKARLEEENKKVNARMTSTSSSNGASIAGSSSSKGKERSMTPQPEDDLCPF # IPTGIYDALKTKKQFDSMRGGQQEDAEEFLGFYLEGLEEELTTLTETLTHGESGTLLEGKNKKKGATAVEETEEDAPPEAEQDGWMEVGKRNRTVVTR # TVSVSILFCSYLTKPSSGHRLNRLIHPLHASLAGNSARHFVSLRDSIHTIQEALANISKPQTVHLVDPPREGSQLVLIEALPPVLVLHMKRFEYDASV # GSVVKVGKQVAFGPELVIGADLLSAKARSNLGFPRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 Scaffold_7 AUGUSTUS gene 2635107 2635736 0.98 - . g544 Scaffold_7 AUGUSTUS transcript 2635107 2635736 0.98 - . g544.t1 Scaffold_7 AUGUSTUS stop_codon 2635107 2635109 . - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_7 AUGUSTUS CDS 2635107 2635736 0.98 - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_7 AUGUSTUS start_codon 2635734 2635736 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MHVVLIAAVGEWWSFRFVPRSIFGGKTFDGKKYVSHVNAQLEGEERNNPIEEDAARLMDPNLIQDMKNFMAHAGETPA # QIKDRHDAERDARQKRRAERNMIRQHNEDQLQKFIDKIQEKQHEPGAIPDRTINEYSRRRSACDEEWNFSWSFRNEFMESESGYQVALEDRADWSGVM # RLGSETSKYYLDQIQNYLNQISKNHVEEDDISQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 Scaffold_7 AUGUSTUS gene 2652614 2653201 0.49 + . g545 Scaffold_7 AUGUSTUS transcript 2652614 2653201 0.49 + . g545.t1 Scaffold_7 AUGUSTUS start_codon 2652614 2652616 . + 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_7 AUGUSTUS CDS 2652614 2652671 0.49 + 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_7 AUGUSTUS CDS 2652747 2653201 0.74 + 2 transcript_id "g545.t1"; gene_id "g545"; Scaffold_7 AUGUSTUS stop_codon 2653199 2653201 . + 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MLARYETRVSIASWDDKQVFPVKKEHQNISDSDPKKFNASLGALILLKEPDGATVHCVSINQFIFKQGRITVPPALAL # ACEGYANLSLNNQKYSLTDPPPHWSHVKEVMKTGGAKALSNYMKSWKTVPEHNRWWKSVFNGAIEDQRAAHLSLIQGVWKGMQGARSIISDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 Scaffold_7 AUGUSTUS gene 2666464 2669427 0.74 - . g546 Scaffold_7 AUGUSTUS transcript 2666464 2669427 0.74 - . g546.t1 Scaffold_7 AUGUSTUS stop_codon 2666464 2666466 . - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_7 AUGUSTUS CDS 2666464 2668026 0.86 - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_7 AUGUSTUS CDS 2668183 2669427 0.8 - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_7 AUGUSTUS start_codon 2669425 2669427 . - 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MILTHWDCLDKFQGCKRSHALAQIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTI # YILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISY # HKYKYTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVKNLYETNVKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEK # SEPQRFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTPYEILYNKVPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSN # NAMFTATHAVFDEKLFPRCKSSERHRSTRLPDRNPDPKEFLHLLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGSSSAEQERPE # PEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALKRRGT # FELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYMEQPEGFR # IKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYMKTLGFKRLSSDAGIFIRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGNSCHTGNAEILVKPKN # SFACGLIVMAKRSILINAPTLTKSLSVAVWKMLKWLIHHFLQGSNLNPPKANRIPLFVASSKWLLVPFSTLCWAHVPTSFAVTKLAQHAANPSQEHLN # KALYICRYLLGTRSYALCYDGESGMVSALGLIRMGFRSLYTPVTDWIFYEACQWHLLLDQPYAEDNRSLVYRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 Scaffold_7 AUGUSTUS gene 2670000 2670506 0.93 - . g547 Scaffold_7 AUGUSTUS transcript 2670000 2670506 0.93 - . g547.t1 Scaffold_7 AUGUSTUS stop_codon 2670000 2670002 . - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_7 AUGUSTUS CDS 2670000 2670506 0.93 - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_7 AUGUSTUS start_codon 2670504 2670506 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MKRTCVLPSEDDVEDGNKASTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVSSSDLDHTKCTN # APSSVAVTKTCKSAFKPDLLSCLYNYRIDIKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEHEDLEEKFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 Scaffold_7 AUGUSTUS gene 2670780 2671088 0.87 - . g548 Scaffold_7 AUGUSTUS transcript 2670780 2671088 0.87 - . g548.t1 Scaffold_7 AUGUSTUS stop_codon 2670780 2670782 . - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_7 AUGUSTUS CDS 2670780 2671088 0.87 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_7 AUGUSTUS start_codon 2671086 2671088 . - 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MSQLETAELKKLTFAKVRIAVMNAFSGDTIGNSQPQNANKFSNVHRKGNDPKFSQQQHGNNNHQQQKGQNGNDDNKKK # RKCALERTRRLRRMQMLPKLMQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 Scaffold_7 AUGUSTUS gene 2679261 2679998 0.6 + . g549 Scaffold_7 AUGUSTUS transcript 2679261 2679998 0.6 + . g549.t1 Scaffold_7 AUGUSTUS start_codon 2679261 2679263 . + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_7 AUGUSTUS CDS 2679261 2679435 0.69 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_7 AUGUSTUS CDS 2679595 2679998 0.79 + 2 transcript_id "g549.t1"; gene_id "g549"; Scaffold_7 AUGUSTUS stop_codon 2679996 2679998 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MPPKTRAQSRAKSEENTFFTTAQSFAPFSESISAIGQPHRRNRGFGPATVPTSSTLPDARRTGKQPQRHPTSQSPCDP # PPHDDQDHPVDPNDPGADNDHPDHDDLDDDSGGLPRGEPGDPSGPGDPGSPGGPCSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSE # SKSKVKEPEVLDSSDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 Scaffold_7 AUGUSTUS gene 2683249 2683587 0.43 - . g550 Scaffold_7 AUGUSTUS transcript 2683249 2683587 0.43 - . g550.t1 Scaffold_7 AUGUSTUS stop_codon 2683249 2683251 . - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_7 AUGUSTUS CDS 2683249 2683587 0.43 - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_7 AUGUSTUS start_codon 2683585 2683587 . - 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MFQDQLMETLILVHCIIEKPLNAADGPHIEVPVNTSSRLHIVQGELEVMSNNIWAGRIQTTSKKGDDGFNDVANITTM # VVEDRGSIGTIEAMGKGGDMLNVLMGLFEISLQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 Scaffold_7 AUGUSTUS gene 2683783 2684136 0.67 + . g551 Scaffold_7 AUGUSTUS transcript 2683783 2684136 0.67 + . g551.t1 Scaffold_7 AUGUSTUS start_codon 2683783 2683785 . + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_7 AUGUSTUS CDS 2683783 2684136 0.67 + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_7 AUGUSTUS stop_codon 2684134 2684136 . + 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MGTVDAEYIHHITDTPLSIPMPLGEPSSVVGESVPSPPFPPSRVPLFLPEQESPTSLSPPPSPSLPPLFGSVANLAIN # LTGGDDDLYEPEESRRAQVSEADGMEVAPLSDVPKEEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 Scaffold_7 AUGUSTUS gene 2686582 2686959 0.56 - . g552 Scaffold_7 AUGUSTUS transcript 2686582 2686959 0.56 - . g552.t1 Scaffold_7 AUGUSTUS stop_codon 2686582 2686584 . - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_7 AUGUSTUS CDS 2686582 2686959 0.56 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_7 AUGUSTUS start_codon 2686957 2686959 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MDRLLRERTPAYFLHISPTKEESPTKEMLRASDSSSLEEVQQPKDPESGNPSPEQGEVVKEFDKEALKRQETEELKKS # IPVQYQDYLDIFSPGKARTLPLHQPLQYQNQNGRGYDTSHREALQHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 Scaffold_7 AUGUSTUS gene 2688590 2689429 0.66 + . g553 Scaffold_7 AUGUSTUS transcript 2688590 2689429 0.66 + . g553.t1 Scaffold_7 AUGUSTUS start_codon 2688590 2688592 . + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_7 AUGUSTUS CDS 2688590 2689429 0.66 + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_7 AUGUSTUS stop_codon 2689427 2689429 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIACRTGKKPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPVDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPRSSNSPDIPNEQRAMLELLSGFKVSMETLGSVLAALGRPSDSSESKSKVKEPRYSTVRTPENSRRSSSISPWSLMTVQSTS # PTNGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 Scaffold_7 AUGUSTUS gene 2690591 2691569 0.78 + . g554 Scaffold_7 AUGUSTUS transcript 2690591 2691569 0.78 + . g554.t1 Scaffold_7 AUGUSTUS start_codon 2690591 2690593 . + 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_7 AUGUSTUS CDS 2690591 2691029 0.8 + 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_7 AUGUSTUS CDS 2691100 2691569 0.98 + 2 transcript_id "g554.t1"; gene_id "g554"; Scaffold_7 AUGUSTUS stop_codon 2691567 2691569 . + 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAV # PLPEPSPSVSPTILETPPGDSPRALARSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVKVAARAADRSSTTPTVPPLHPSIPEEYAEF # ADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRY # PLPLIDLLSTLRKELKYTPNWISLTLII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 Scaffold_7 AUGUSTUS gene 2691853 2692774 0.51 + . g555 Scaffold_7 AUGUSTUS transcript 2691853 2692774 0.51 + . g555.t1 Scaffold_7 AUGUSTUS start_codon 2691853 2691855 . + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_7 AUGUSTUS CDS 2691853 2691935 0.51 + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_7 AUGUSTUS CDS 2692018 2692774 0.84 + 1 transcript_id "g555.t1"; gene_id "g555"; Scaffold_7 AUGUSTUS stop_codon 2692772 2692774 . + 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLDDIVVPMTRLTRKGASWIWDSSCQEAFENLKTLSSAPILAHWEPNRPLIVE # TDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQF # NMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFVLSLLTNNSLRPSSYLQGPVYEPRLSWISKPYTKLSSRPSRRSRAPLLVWNLQKILP # MNVGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 Scaffold_7 AUGUSTUS gene 2693340 2693909 0.71 + . g556 Scaffold_7 AUGUSTUS transcript 2693340 2693909 0.71 + . g556.t1 Scaffold_7 AUGUSTUS start_codon 2693340 2693342 . + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_7 AUGUSTUS CDS 2693340 2693909 0.71 + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_7 AUGUSTUS stop_codon 2693907 2693909 . + 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MGKLSVSIRLSNSTSGSIVPTNKMTGRLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVN # LDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTSYELKLPDYFADSPGFPRLTAGAGYAE # SFPESYSISSTSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 Scaffold_7 AUGUSTUS gene 2697897 2698571 0.65 + . g557 Scaffold_7 AUGUSTUS transcript 2697897 2698571 0.65 + . g557.t1 Scaffold_7 AUGUSTUS start_codon 2697897 2697899 . + 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_7 AUGUSTUS CDS 2697897 2698571 0.65 + 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_7 AUGUSTUS stop_codon 2698569 2698571 . + 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MLRASDSSSLEEVQQPKDPESGNPSPEQGEVVKEFDKEALKRQETEELKKSIPVQYQDYLDIFSPGKARTLPLHNLTI # SNQNGRGYDTSIGKLYNMSEKELESLKEYINKMLGKGFIRSSSSPAGAPVLFAKKKDGTLQLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTK # IDLRAGYNNDRVAQGHEWKTAFRTRYGLFEYLVMPLGSQMLPLHFNSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 Scaffold_7 AUGUSTUS gene 2726689 2727793 0.76 - . g558 Scaffold_7 AUGUSTUS transcript 2726689 2727793 0.76 - . g558.t1 Scaffold_7 AUGUSTUS stop_codon 2726689 2726691 . - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_7 AUGUSTUS CDS 2726689 2726991 0.77 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_7 AUGUSTUS CDS 2727329 2727793 0.8 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_7 AUGUSTUS start_codon 2727791 2727793 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MSTSRTTTTTISATAGPSRSRPVPPPPPPPPSDSAAQEEEDLEDEDEDDIIRRAHARVERVRARKAAEAARKKAEEEA # ARAAAERERKAQEAREQARRAQQQQEEVTERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEDGQVKANTYHRHMNRKLDWLV # TDAARRRRTPPEMPQAGPSELPKKRRRVMDSDEEEDREREKEVEEMGMEEDGEGDEDEMVEEEPAPAKAQSEKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 Scaffold_7 AUGUSTUS gene 2730318 2730761 0.88 - . g559 Scaffold_7 AUGUSTUS transcript 2730318 2730761 0.88 - . g559.t1 Scaffold_7 AUGUSTUS stop_codon 2730318 2730320 . - 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_7 AUGUSTUS CDS 2730318 2730761 0.88 - 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_7 AUGUSTUS start_codon 2730759 2730761 . - 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MSTSRTVTTTTTKSSTAGPSRSRPAPPPPIDLTVPDEPREDDNDDEAIQQAEEKVHRMKARKAAAAAKKKAEEEVARK # AAEEAQRKKEAAARELEERRRRMVEAATARSCCGSSPGGSSVSPQRPVVEIRKDKGKGKGKAQVSTDTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 Scaffold_7 AUGUSTUS gene 2734237 2735619 0.75 + . g560 Scaffold_7 AUGUSTUS transcript 2734237 2735619 0.75 + . g560.t1 Scaffold_7 AUGUSTUS start_codon 2734237 2734239 . + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_7 AUGUSTUS CDS 2734237 2735619 0.75 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_7 AUGUSTUS stop_codon 2735617 2735619 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MGSNISTSQSFHLPPRPNVPVPSKPASSTTATRVNLSSPASSSSTYSVKYGMQHLVLDSNGNAIKPSSSLTRSKAEIP # IKSSTPSISRLPTSGTVPYSPALSLPPASSSNIASPRSLLPRTGAPALGSTSSPVLSSGLPLSTTNPQTTTNGNPLSQGVHSALRSPPKLKKSKSSGI # KPRTSVSIVPSAISLPRSSSTSVLPLEPKSSTPTSGPPRVGRVVSTSAMVDESKNRNDNPPNGVKSLPQVSTGQQLFSPNNPLMPQGINISIARTLPT # IPPTSSSISNGSQAPPDKAMSSSASVSGVLPPIITPALIPHAHACCTTSTDALVHAEKLGSTPHVNRDSVLNGSSKSRCATTVMSVSPNPHSSVATSL # STPAISSTPAPSSAVKIITNDVQMEPAIEIIDKAMVAAPPTSVTVIGDEIDEGISDGIAAAVHEVSPMAVEVCIKILCSLFMLMVFTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 Scaffold_7 AUGUSTUS gene 2735761 2736360 0.88 + . g561 Scaffold_7 AUGUSTUS transcript 2735761 2736360 0.88 + . g561.t1 Scaffold_7 AUGUSTUS start_codon 2735761 2735763 . + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_7 AUGUSTUS CDS 2735761 2736360 0.88 + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_7 AUGUSTUS stop_codon 2736358 2736360 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MEDRFRELVTALEHERKLRAQIEHRLETDKHNSTGVEEALRDEITLLKAGNETSQTQISSLETENGFLQNRVETLERM # VTTSRKLAALERADGIMGTKDVQAIREELELKRVKVGVLESELQSTSNELELAKSHLNEKDREIAQLHADLIREQALRREMEGVVEDMRRECKEPFLV # PALVDAFMEVSRLTTRSTKPYTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 Scaffold_7 AUGUSTUS gene 2758828 2759640 0.51 - . g562 Scaffold_7 AUGUSTUS transcript 2758828 2759640 0.51 - . g562.t1 Scaffold_7 AUGUSTUS stop_codon 2758828 2758830 . - 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_7 AUGUSTUS CDS 2758828 2759640 0.51 - 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_7 AUGUSTUS start_codon 2759638 2759640 . - 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDAKKLQSYEDSNENIDIQLKIGISNQVNWSRLEILELKRVWIERCIQDIEDGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 Scaffold_7 AUGUSTUS gene 2759811 2760995 0.78 - . g563 Scaffold_7 AUGUSTUS transcript 2759811 2760995 0.78 - . g563.t1 Scaffold_7 AUGUSTUS stop_codon 2759811 2759813 . - 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_7 AUGUSTUS CDS 2759811 2760995 0.78 - 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_7 AUGUSTUS start_codon 2760993 2760995 . - 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRILINLINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 Scaffold_7 AUGUSTUS gene 2761996 2764303 0.49 - . g564 Scaffold_7 AUGUSTUS transcript 2761996 2764303 0.49 - . g564.t1 Scaffold_7 AUGUSTUS stop_codon 2761996 2761998 . - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_7 AUGUSTUS CDS 2761996 2762464 1 - 1 transcript_id "g564.t1"; gene_id "g564"; Scaffold_7 AUGUSTUS CDS 2762557 2762797 0.52 - 2 transcript_id "g564.t1"; gene_id "g564"; Scaffold_7 AUGUSTUS CDS 2762872 2764303 0.94 - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_7 AUGUSTUS start_codon 2764301 2764303 . - 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSES # TETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVLTEPPTNKLEERIK # LNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVEKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 Scaffold_7 AUGUSTUS gene 2764333 2765729 0.51 - . g565 Scaffold_7 AUGUSTUS transcript 2764333 2765729 0.51 - . g565.t1 Scaffold_7 AUGUSTUS stop_codon 2764333 2764335 . - 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_7 AUGUSTUS CDS 2764333 2765017 0.51 - 1 transcript_id "g565.t1"; gene_id "g565"; Scaffold_7 AUGUSTUS CDS 2765116 2765729 0.51 - 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_7 AUGUSTUS start_codon 2765727 2765729 . - 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPKFDPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIP # PSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESY # FANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 Scaffold_7 AUGUSTUS gene 2768577 2768921 0.84 + . g566 Scaffold_7 AUGUSTUS transcript 2768577 2768921 0.84 + . g566.t1 Scaffold_7 AUGUSTUS start_codon 2768577 2768579 . + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_7 AUGUSTUS CDS 2768577 2768921 0.84 + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_7 AUGUSTUS stop_codon 2768919 2768921 . + 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 Scaffold_7 AUGUSTUS gene 2771704 2772942 0.33 - . g567 Scaffold_7 AUGUSTUS transcript 2771704 2772942 0.33 - . g567.t1 Scaffold_7 AUGUSTUS stop_codon 2771704 2771706 . - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_7 AUGUSTUS CDS 2771704 2772819 0.86 - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_7 AUGUSTUS CDS 2772937 2772942 0.34 - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_7 AUGUSTUS start_codon 2772940 2772942 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MITDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLP # FDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMV # VIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGED # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 Scaffold_7 AUGUSTUS gene 2773628 2774488 0.16 - . g568 Scaffold_7 AUGUSTUS transcript 2773628 2774488 0.16 - . g568.t1 Scaffold_7 AUGUSTUS stop_codon 2773628 2773630 . - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_7 AUGUSTUS CDS 2773628 2774488 0.16 - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_7 AUGUSTUS start_codon 2774486 2774488 . - 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY # AGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELK # DGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKG # MLDNPVVVLMQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 Scaffold_7 AUGUSTUS gene 2775154 2776909 0.36 - . g569 Scaffold_7 AUGUSTUS transcript 2775154 2776909 0.36 - . g569.t1 Scaffold_7 AUGUSTUS stop_codon 2775154 2775156 . - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_7 AUGUSTUS CDS 2775154 2775628 0.7 - 1 transcript_id "g569.t1"; gene_id "g569"; Scaffold_7 AUGUSTUS CDS 2775721 2775961 0.45 - 2 transcript_id "g569.t1"; gene_id "g569"; Scaffold_7 AUGUSTUS CDS 2776036 2776909 0.97 - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_7 AUGUSTUS start_codon 2776907 2776909 . - 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIV # ESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLN # QTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDN # EKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKS # LGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEP # PINKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPNLNTEEVFTSINQLIRRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 Scaffold_7 AUGUSTUS gene 2777060 2777464 0.62 - . g570 Scaffold_7 AUGUSTUS transcript 2777060 2777464 0.62 - . g570.t1 Scaffold_7 AUGUSTUS stop_codon 2777060 2777062 . - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_7 AUGUSTUS CDS 2777060 2777464 0.62 - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_7 AUGUSTUS start_codon 2777462 2777464 . - 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTYEGTKRPDESN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 Scaffold_7 AUGUSTUS gene 2777494 2777763 0.59 - . g571 Scaffold_7 AUGUSTUS transcript 2777494 2777763 0.59 - . g571.t1 Scaffold_7 AUGUSTUS stop_codon 2777494 2777496 . - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_7 AUGUSTUS CDS 2777494 2777763 0.59 - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_7 AUGUSTUS start_codon 2777761 2777763 . - 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 Scaffold_7 AUGUSTUS gene 2777854 2779017 0.77 - . g572 Scaffold_7 AUGUSTUS transcript 2777854 2779017 0.77 - . g572.t1 Scaffold_7 AUGUSTUS stop_codon 2777854 2777856 . - 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_7 AUGUSTUS CDS 2777854 2779017 0.77 - 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_7 AUGUSTUS start_codon 2779015 2779017 . - 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKFEWN # SVGMFLVQVDRSFYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 Scaffold_7 AUGUSTUS gene 2781445 2785160 0.34 + . g573 Scaffold_7 AUGUSTUS transcript 2781445 2785160 0.34 + . g573.t1 Scaffold_7 AUGUSTUS start_codon 2781445 2781447 . + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_7 AUGUSTUS CDS 2781445 2782690 0.36 + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_7 AUGUSTUS CDS 2782783 2785160 0.57 + 2 transcript_id "g573.t1"; gene_id "g573"; Scaffold_7 AUGUSTUS stop_codon 2785158 2785160 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISDFREPDTSRSLMSAGVTITYGLRRGMNGKARSQQPEASGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLG # LIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRI # EVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSR # FDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGL # VYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQL # PNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVE # KYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAH # QFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEIL # DSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 Scaffold_7 AUGUSTUS gene 2804091 2804453 0.74 + . g574 Scaffold_7 AUGUSTUS transcript 2804091 2804453 0.74 + . g574.t1 Scaffold_7 AUGUSTUS start_codon 2804091 2804093 . + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_7 AUGUSTUS CDS 2804091 2804453 0.74 + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_7 AUGUSTUS stop_codon 2804451 2804453 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MYISNLLELFILTSYFLISTLAMSEELAQDEADAEDYDLEYLERGRGARDDDEATLRGDEHGHPVGEDSIVFEIGDEE # EDMTPITAKSSAPTRHRPERLSGEHAEEERRGLMSENGGGHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 Scaffold_7 AUGUSTUS gene 2804830 2805468 0.86 - . g575 Scaffold_7 AUGUSTUS transcript 2804830 2805468 0.86 - . g575.t1 Scaffold_7 AUGUSTUS stop_codon 2804830 2804832 . - 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_7 AUGUSTUS CDS 2804830 2805468 0.86 - 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_7 AUGUSTUS start_codon 2805466 2805468 . - 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MPFTAEGIVPDIVINPHAIPSRMTIGHLVECLLSKVATLIGNEGDATPFTDLTVESVSMFLKQKGYQSRGLEVMFHGH # TGRKLQAQVYLGPTYYQRLKHMVDDKIHSRARGPVQILTRQPVEGRSRDGGLRFGEMERDCMISHGIAGFLKERLFEASDAYRVHVCEMYVFPLIVFA # LIWLIGRNSCGLTAIANLKKQSFEVIILLQSHIALF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 Scaffold_7 AUGUSTUS gene 2808089 2808598 0.99 - . g576 Scaffold_7 AUGUSTUS transcript 2808089 2808598 0.99 - . g576.t1 Scaffold_7 AUGUSTUS stop_codon 2808089 2808091 . - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_7 AUGUSTUS CDS 2808089 2808598 0.99 - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_7 AUGUSTUS start_codon 2808596 2808598 . - 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MDDEEDDQYSEITQEDCWTVISSFFEQKGLVRQQLDSFDEFVQNTMQELVDENADLILDQQDQHSGREGDMTRRYEIR # FGQIYLSRPTVTEADGSVVPVFPQEARLRNLTYSAPLYIEMKKKVMVGREDPDGVPGDMAWETENDDGPENSTKVWIGKVRWKFPCSGTAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 Scaffold_7 AUGUSTUS gene 2809134 2811152 0.99 + . g577 Scaffold_7 AUGUSTUS transcript 2809134 2811152 0.99 + . g577.t1 Scaffold_7 AUGUSTUS start_codon 2809134 2809136 . + 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_7 AUGUSTUS CDS 2809134 2811152 0.99 + 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_7 AUGUSTUS stop_codon 2811150 2811152 . + 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MQITRQGPLPNDPSIISANRTRKTHKDAETISRISKLPIESKLRINFNKQTRNASRRERVFEGNDDVSDVSSYLSIPE # VEYDKMLKDQDYFDKVKAWLSAHTISWLVDRRKSLRLRPREGDDTSVEASGTQPSKRFRSNDDLIEIDPTSPPNVFFDQAFLDLGLYGYHIPLALFTN # KNVEFLNNNSISFHRTKISHIEGKPQILDLADVIKKVKGSREGGPTQDLAIEHFEWLEATANFFVYQSLLYAEGDEANEPQFYRKHFGFFENQTDSVK # LFDLWKDIELELRQKHQNKKLISTSSITEQNGAALNHVLTPLKPLPRLIPPSLSLIVILTSQTSGPPKSLGMMSHPQHLRIPFRLATRKRPPANLVAS # SAEASVIPSSLIPTLPMAQPSGHYATGRSSSTHPARCDSAPTGTFSQPAPKNVQVLPTSALSVAVPTPHSNGILVVPSPIPEVTDSFQSNSNSLPSLS # WHNFSATKISRLPFPNTPPHFLEIYDRIITPYNASAFAIELARHNIWDRFPFLIEYLTTGFPLGDMPVLHETIIIPNHSSVHKHPDVVWDYIHEEAAS # NRMSGPFSQNEIESIMRGPFFCSPFIIIEQSQGPGKPAKRRVCRNLSKDGRDSSGKSIPCINSYILKEHFPTSFDSAAYTANLVSHYYSIITLNSPLL # FAYSLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 Scaffold_7 AUGUSTUS gene 2824529 2825332 0.8 + . g578 Scaffold_7 AUGUSTUS transcript 2824529 2825332 0.8 + . g578.t1 Scaffold_7 AUGUSTUS start_codon 2824529 2824531 . + 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_7 AUGUSTUS CDS 2824529 2825332 0.8 + 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_7 AUGUSTUS stop_codon 2825330 2825332 . + 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MDYFSQYGGHEASSSINVPPRVESITDSSSSESVSDTAGTSPFLNAQQLPLPDFSKTFTTEKLQPTMQEEQNAFASTS # AQPAYYPMPAAGYMSFQAPFSHNPSAPPSPPLAAALSQTPSPVPIPNPSTSMPVPMPMPHPEFTPPVPVTNDVRDSGVDFGLGIRPPSQAASTAVIAT # EPPLFRARSLLGFAKSQSRLGFVRPRPPTATTVTSESSSESDLDSDLNLIQPHYHTWDESTRALIEGLRPVMESCIEIVVRLIPVSHSTLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 Scaffold_7 AUGUSTUS gene 2832584 2833480 0.95 + . g579 Scaffold_7 AUGUSTUS transcript 2832584 2833480 0.95 + . g579.t1 Scaffold_7 AUGUSTUS start_codon 2832584 2832586 . + 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_7 AUGUSTUS CDS 2832584 2833480 0.95 + 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_7 AUGUSTUS stop_codon 2833478 2833480 . + 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MILSNGLLFASLALDFVNFLSATDIVHYPPKLTNLNNLTFVLNGIGTPGIFNSSITPDFEYGMYNWCNMPHVRAREYQ # TPSSAYTLKYIEIIQRHHKRTPYASNTFFKEDIPWDCTGEGPVYYGKGTVGVTDDPTVIQWSAYTNSQNPFTNSVGPGFVGSNCAFPQITTGGLNDSY # THGADLRAVYTERLNLSTKADPNTFKIRVTSNPITSQVSGGLLKGLFPDSSDVAALIQADAFDSLTASYSCPAAKSIFTAYTTDSSNWTEHLVNAAGI # YEELDEVSGIAADDTAGWHTSFDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 Scaffold_7 AUGUSTUS gene 2846200 2846859 1 + . g580 Scaffold_7 AUGUSTUS transcript 2846200 2846859 1 + . g580.t1 Scaffold_7 AUGUSTUS start_codon 2846200 2846202 . + 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_7 AUGUSTUS CDS 2846200 2846859 1 + 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_7 AUGUSTUS stop_codon 2846857 2846859 . + 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MCGWCVRWRGWESIDSGDILGGNTNNNNNNNTTNNDNTTATTTTTNVADNTNTYPDYPPTNLPTLPDLSSLSSLPDLT # SFPTFPTLPTSTFPNTSNSNTSSSFDTFDFSSFPSLPEFNLNLDSEFNLEEGFPDFLVDPGFGSNVNVDFGFGSVGSFGVGDGGAGNGDGSAGNGDGS # AGNGDGDVDVDSFVAMLQSQSQNQTQSQSQSQIQSQTQTQSQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 Scaffold_7 AUGUSTUS gene 2863027 2864047 0.6 + . g581 Scaffold_7 AUGUSTUS transcript 2863027 2864047 0.6 + . g581.t1 Scaffold_7 AUGUSTUS start_codon 2863027 2863029 . + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_7 AUGUSTUS CDS 2863027 2863470 0.61 + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_7 AUGUSTUS CDS 2863631 2864047 0.82 + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_7 AUGUSTUS stop_codon 2864045 2864047 . + 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MPLVKLVLILSQMSGPSSRSQSDTLPSIAHLVSQSTASVPASTPLNSTSTSFGDEHRPGVTIQNRVGKKKTVEILTSQ # DYQERAEAERKAEKVLTPTQGQHLTRIQCASYAKEMLSKGFIRSHAVGITADDTSLRFQYYDRSKVVESKPFNIVNDEVKKLFMAMVCQLNELSTENL # GFIPNLDLDGFDHLRNPKQLKLPHKNGIDPLVGSTYAFTGAMVGGEESKSRKSSTALKASLVDARSLFEVECLCTEAGCDWHEEGQATTKVMKISFPS # MTRPSEDGLLGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 Scaffold_7 AUGUSTUS gene 2867690 2868232 0.6 - . g582 Scaffold_7 AUGUSTUS transcript 2867690 2868232 0.6 - . g582.t1 Scaffold_7 AUGUSTUS stop_codon 2867690 2867692 . - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_7 AUGUSTUS CDS 2867690 2868232 0.6 - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_7 AUGUSTUS start_codon 2868230 2868232 . - 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MYRCKNGKVYGVLNDFDLSSHVRDMDKGPTSKQRTGTRPFMSLDLLNPDWEGGHLYRHDLESLFYIMLCLACRYEAPG # IPSPDPRPYSEWFSGTDAEVLSNKSKFLLNALSKGLPVQPYFSSFKQWLWKIFKGLRLGYTLRPLAYSNLPASETDSKAWNLDDDDDEDSDSDSKFNY # DGQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 Scaffold_7 AUGUSTUS gene 2868483 2870677 0.4 - . g583 Scaffold_7 AUGUSTUS transcript 2868483 2870677 0.4 - . g583.t1 Scaffold_7 AUGUSTUS stop_codon 2868483 2868485 . - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_7 AUGUSTUS CDS 2868483 2869010 0.57 - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_7 AUGUSTUS CDS 2869173 2869426 0.59 - 2 transcript_id "g583.t1"; gene_id "g583"; Scaffold_7 AUGUSTUS CDS 2869778 2869948 0.55 - 2 transcript_id "g583.t1"; gene_id "g583"; Scaffold_7 AUGUSTUS CDS 2870029 2870677 0.43 - 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_7 AUGUSTUS start_codon 2870675 2870677 . - 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MISQPLPPQTPKPKQDHGPPVVESTPMSRRCTTHAEDEVPKRADVVNKFLEDDISDRFEVSLDDFATLILDLPADWQI # RDDFTLLPDSEAVKDAFAAYLKVAIGEVDGENQKRKGMAGHESGLYQPLANLLNSLRDGEGRRVGKDIDEKIFYVQDPRPVLGSLIARKPDLGGIYIE # LLKLTKTKNSQITCKKENCRCFWGLLLYFIEVKHEQGRFVEAKTPTNGSSRSGVSKQHGSRQTSQTAGPSTLPTPQSGPSQSQSIKRARPYEGPDATK # SGWQEEDSRDPDVAGLPRKGGGRKESRKGVDSDAGTAFNKNSVRELRQRNAFERIIRSHAVGITADDTSLRFQYYDRSKVVESKPFNIVNDEVKKLFM # AMVCQLNKLSTENLGFIPNLDLDGFDHLRNPKQLKLPHKNGIDPLVGSTYVFTGSDGRRRRVKITKVLYRAEGIIGRCSIVVEVECLCTEAGCDWHEE # GQATTKVMKISFPSMTRPSEDGLIGEARSKAESSGDLWALNHLPEVIDSITFHTTKNQPFRAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 Scaffold_7 AUGUSTUS gene 2887260 2887694 0.92 - . g584 Scaffold_7 AUGUSTUS transcript 2887260 2887694 0.92 - . g584.t1 Scaffold_7 AUGUSTUS stop_codon 2887260 2887262 . - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_7 AUGUSTUS CDS 2887260 2887694 0.92 - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_7 AUGUSTUS start_codon 2887692 2887694 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MSSTLDALLAFRQAIQSHNQTILLSSPSTSTPVESLSQATHIQISPSEIFPKSTPTRWRKGSSSTSTSSLTLNDLYTL # EAIYLAYQLKSLPAPNYTKQAREDGLGIGMVSVTERKIVVDWLEGNSDSSERLVESEKLSAALKGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 Scaffold_7 AUGUSTUS gene 2888303 2891622 0.48 - . g585 Scaffold_7 AUGUSTUS transcript 2888303 2891622 0.48 - . g585.t1 Scaffold_7 AUGUSTUS stop_codon 2888303 2888305 . - 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_7 AUGUSTUS CDS 2888303 2890627 0.63 - 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_7 AUGUSTUS CDS 2891332 2891622 0.84 - 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_7 AUGUSTUS start_codon 2891620 2891622 . - 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MASQYAFVTLLTSDHYLPGALTLAAALRDVHPSPAVSPEVEFQTVCLVTPETVDVSTIKLLRKAFDIVIGVELIAQDD # EEGLKLLGVCLFKYPSRARQPQQPSEPHQRAYDYDSLVDKWFNVYDTHYRAEAIVPETNFEVQRYVSAWDEQIQKGAPALVSSQPEALGLEELRRLAI # QGINSSVNSSENRIGEGEYKSMPLEGRVDLMRPQPPPRLHEQREDEVRHLSIDTQPHQASSLYGSSPRTPGPNEIPPSPHPQTISLPPTPSLTASEHY # IPQPHYENQKQPEHHDYQAPLPQQHFEYQQSFLPPSQEQPSSETVHKSPSQPYIPPTLEQHSELHHQTPLRPSSPPKLLWNPAVEPPPNTAPPPSAFP # SDTYFQNIWDQAPSKQHDRTHPHTHYTISPTPDSGAFFEPPPPSHIPERIQDHYKNVIGDVHHDPSAAPNPNLNKVKHVFPWEDKPRSKPGRVFPASD # APPAELFTSSMVAEEPERPPSPEPVKEVFSPPSKPNPPPPKGLPATLSYANAWDTVPSIQRYASRLVRPPPAQPPPIPFDSEDYRHYRRGKKSWDERT # DASSRDGDDEDNTDSDDDEPVVSRLADSDNETSVSGSSSRTRSRRGSSASYGVKSKKKEYRVRGVQTISPEMREQAVQVSILVDSPKVSNAPKLLQDQ # KIGSPRRSSLTLQTGNSRRPQWTTSSVPSALPPIVSVGRGGSPESRVNPAGTGIGSGGNDAPNSRTSPTLDPLSPREFGFKESPTTVRPPARSSSSST # ITPSNANVVATAGVNQRSFGSPQGPNAPPLGPLRNTSNDSTITSPPSSAGPVSPHEGQPITSVASSRKAGRVFDPARGVELFKRGSEEVLARFLKMSS # WEEESSPQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 Scaffold_7 AUGUSTUS gene 2896001 2896593 0.18 - . g586 Scaffold_7 AUGUSTUS transcript 2896001 2896593 0.18 - . g586.t1 Scaffold_7 AUGUSTUS stop_codon 2896001 2896003 . - 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_7 AUGUSTUS CDS 2896001 2896525 0.7 - 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_7 AUGUSTUS CDS 2896573 2896593 0.31 - 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_7 AUGUSTUS start_codon 2896591 2896593 . - 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MLDFMRCVLKAVLTDKDIIEYIGPEAIQTALIFWRDFEKSAINLPPDQRDRFVALSTEILVLGREFQRGVVTPRPPAS # IRPEELSGLKDQGMGVRLKLQARFTKRDLLVYPGSLQAQMIMRAAPDEEPRRRVYVASNSSTPEQINILETMLKKRAELSRLVGSESFAHLTLDDKMA # KSPGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 Scaffold_7 AUGUSTUS gene 2908551 2909372 0.41 + . g587 Scaffold_7 AUGUSTUS transcript 2908551 2909372 0.41 + . g587.t1 Scaffold_7 AUGUSTUS start_codon 2908551 2908553 . + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_7 AUGUSTUS CDS 2908551 2909372 0.41 + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_7 AUGUSTUS stop_codon 2909370 2909372 . + 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MQEIGLPYNTTVADMLHVMYLDKQRFRYAEEIVVLYNDSYSDLLPPGLLWENEWLLRLSAAVKEGGVATGLKLISQYR # EEGGKPSVRTLGVFMQRITRFEHLCSVRDQLGIAPSQEQWSMLLSKCVKRGTISEMLECYNEIRNEGVMPTASAISRLIQSVLASPSSDAVDTSFKIF # NDFTDSLPDRCDLLERETQRSLADLFSKMLREVTQHLDKYAPMKELILKEAEVHNVPLQSASAYLTAISMNSALHAQSATPWKHIEKANIFWMKLDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 Scaffold_7 AUGUSTUS gene 2912315 2913860 0.05 - . g588 Scaffold_7 AUGUSTUS transcript 2912315 2913860 0.05 - . g588.t1 Scaffold_7 AUGUSTUS stop_codon 2912315 2912317 . - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_7 AUGUSTUS CDS 2912315 2912749 0.95 - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_7 AUGUSTUS CDS 2913004 2913212 0.5 - 2 transcript_id "g588.t1"; gene_id "g588"; Scaffold_7 AUGUSTUS CDS 2913355 2913486 0.86 - 2 transcript_id "g588.t1"; gene_id "g588"; Scaffold_7 AUGUSTUS CDS 2913568 2913604 0.61 - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_7 AUGUSTUS CDS 2913687 2913860 0.15 - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_7 AUGUSTUS start_codon 2913858 2913860 . - 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MDAFVDEAVPPKIRISADEISNKTIPAFSESQLLARAKDLGSLNKPYKSYIGMGYHCAVIEIHNGTPRTPRRLESLVN # FQTMVMSLTSMDIANASLLDEATAAAEGMVMSYVSSDLCGVLVQYPDVNGHIKDFSTFAESVHAAGALVVCATDLLALTMIKPPGEWGADIVLGNSGG # YSLCSRIILESSTSDARKLPVIYAQPSAASKYGGNVCSLSRSHWSTVSPQSTWLRAGFKDSVESFGYDVVNATFFDTITVKVSNAKELHDVSITAGIN # LRHIDDHNVGVTFDESVTSNNLVDLINVFATASSSSPVSHNSFGSPMPHLYLLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 Scaffold_7 AUGUSTUS gene 2916441 2917013 0.75 + . g589 Scaffold_7 AUGUSTUS transcript 2916441 2917013 0.75 + . g589.t1 Scaffold_7 AUGUSTUS start_codon 2916441 2916443 . + 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_7 AUGUSTUS CDS 2916441 2917013 0.75 + 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_7 AUGUSTUS stop_codon 2917011 2917013 . + 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MVEIPAKRRLGQLSDVEDLAAERQPTPVHQNHASLVRSVYQTVWSEFCEWSKQDFANSMNDLGMPPADANTRVKDAED # SDIVGKLGQLNLQERELTTLTDPHTIILEAPFEPPPSYDSCNPVSNNQFTGDDASHMQFLPLADDPSFDWKGYCVNYKYFAWQTKFFDSDREFYVRYV # NSLSFKLSSTRNGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 Scaffold_7 AUGUSTUS gene 2919826 2920461 0.76 - . g590 Scaffold_7 AUGUSTUS transcript 2919826 2920461 0.76 - . g590.t1 Scaffold_7 AUGUSTUS stop_codon 2919826 2919828 . - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_7 AUGUSTUS CDS 2919826 2920461 0.76 - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_7 AUGUSTUS start_codon 2920459 2920461 . - 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MELPTIDLDLFLSQSLETPAVQHECKKVRSILQRVLAILMICKVADALITFGALILHDSRVTESKNSAFLDLLEDYFA # QSTSDIQKDERPELSYQVGVTLENTEKPKCAVDESCLGIIQRLEPSERPLDISAHSPDPKCRFFWKMSEVPPYETQFPGLNAPNVVPQAEEINARWTQ # IMEDWGESMKQACALLSMSYACTLNCILEWKTLPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 Scaffold_7 AUGUSTUS gene 2925476 2926294 0.64 - . g591 Scaffold_7 AUGUSTUS transcript 2925476 2926294 0.64 - . g591.t1 Scaffold_7 AUGUSTUS stop_codon 2925476 2925478 . - 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_7 AUGUSTUS CDS 2925476 2926221 0.99 - 2 transcript_id "g591.t1"; gene_id "g591"; Scaffold_7 AUGUSTUS CDS 2926267 2926294 0.64 - 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_7 AUGUSTUS start_codon 2926292 2926294 . - 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MRDMDQSFVTHNFHDVLNLFPHFYLTSHKRTIPLSLVHIFVSIAQSLDITASPVDFPVRVLVHISVPDPEVDDFYVDV # FGSQTILTLRDDIPAILARQGIQADSMMHYISPSGAASMLLRNGRNILSSLNIPATPLSLIRPSALLALTIFLVLTGGGRLVIQLMSQAEPLDCATFI # TEALIPSLDGAGKVQDDLHQASQKGLEEEAISAQEIKLRSPEETVHHFVGMLFEHKRYNYTALITGWDVSCGFENMTFSPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 Scaffold_7 AUGUSTUS gene 2929591 2929899 0.93 - . g592 Scaffold_7 AUGUSTUS transcript 2929591 2929899 0.93 - . g592.t1 Scaffold_7 AUGUSTUS stop_codon 2929591 2929593 . - 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_7 AUGUSTUS CDS 2929591 2929899 0.93 - 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_7 AUGUSTUS start_codon 2929897 2929899 . - 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MTGAPKKRSVEILQNLEDEDRSLYSGIFGYWCVGGGGDWSVAIRSCFKHELDSQDPEMENWVIGAGGAITALSDPQAE # WDEMLLKLQGVLGAFGAAKPRCYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 Scaffold_7 AUGUSTUS gene 2929939 2931354 0.59 - . g593 Scaffold_7 AUGUSTUS transcript 2929939 2931354 0.59 - . g593.t1 Scaffold_7 AUGUSTUS stop_codon 2929939 2929941 . - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_7 AUGUSTUS CDS 2929939 2931354 0.59 - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_7 AUGUSTUS start_codon 2931352 2931354 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MAGRHRTRPFWGVQYHPESVLTDEGGLHILRNFWALAVEWSQKRGRCLFPLEPSALDILGPSWPHLQPSSLSSSQTTA # TSVLTHVVDLPGATAVKICEMLGVDDHKSPFILLDSAASPGRFSIIASLLPTSLQILYSVGDIAVTLKSANSVWHETLDGYDVWSWISRFMRLSKARD # GCPEVPFWGGLIGTLSYELGVDSLDVPLRRNRRDMNAHPDINLLYVQRSLVLDTLTNKVYIQSLLPDDSEWMANISDELKKLPSSSLPTRAPSNMRSA # SALVALPDRSRYIAKIESAQDFLRSGDSYELCLTAHTHLSVPSFLSTWERYKLLRRCNPAPYSAYLRLQPSTFLSSSPERFISYSRSPNTLCQLRPIK # GTLRKAPGVTRAYAEEALRGSQKEVAENLMIVDLIRHDLHSVVGLDVYVKQFCQIEEYENVWQMVSVIEGRLPAGSQRDDLGWEVLRQSLPPGKSSSS # C] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 Scaffold_7 AUGUSTUS gene 2932217 2935558 0.97 + . g594 Scaffold_7 AUGUSTUS transcript 2932217 2935558 0.97 + . g594.t1 Scaffold_7 AUGUSTUS start_codon 2932217 2932219 . + 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_7 AUGUSTUS CDS 2932217 2935558 0.97 + 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_7 AUGUSTUS stop_codon 2935556 2935558 . + 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MGVTALTASSIPTVTRLLNELLETLHNIRSSGYSLNEATIKYVFFPIYALLNRNDSTAIPDQVLEKVFAILNTLCEDW # WWYLELKDWDQLFMLCGSVIGGFGAKGKGKERAEETKEAAAHCLLTLLRPRDNDDGPLTPNQVRSRMRIFVEHAQTPSFIPILGQTLNSVLLATEHPS # LSLQLSMLDLLFIMLSRYFPDDLIVSILPGVVSTTCKLCLGAPGSKGWAKGAVVGNSLRVMQEVISKSIGDEPCIKAGVVLSAETIEELADLVGEQLP # EQSAQEESKYGTSRTSSWLKVTSSQLLIALKSLSPLIKHPTSSALMGLAEFSAHVLRTTPTTLPQIQPLLLSYLLALTNSELPSVSGKVTELLLELLT # ASSKARYSLTWTLMRITRDNLIALPVLLPSQSDTKVEHVTGIIEAICRLALIGKDNTKSNLSPIAFEIGKLLGPTGGVEKWGWSLLSVLELVDPPVTV # TSTSAAQMMLENEPEVSAWLPFPQPMLKNVSSMNTFDSLVRMFHALGKAAGDAGLFAVEWFVNIGQSGKDFKAVTGMWCACRLLEGISNVSLSEDPST # SLRLSRSKRLEKLARGLVKSTAQLWDSIHEDDPIDTPSEGIPDGHDEVPNPIQHVRGLIRLHDTLQITRGTPIGPRITTQPMLHSALSVQLISITAGI # LETRFSPLFIYSLYPILHSLVSPFSFLAETGLRALTFVTVCTSYASPANLLLSNFDYVLDSVSRRLSRQWLDVDATKVLAVMIRLVGSDIVERAGDVV # EECFDRLDEYHGYEIVVEGLVEVLGEVMKIIKFEELSKLSDDQTPPVRQSYIDQQKFDSFFEWFAHRSESTVEEDQEDYGPAPRKGWGDDNPPDKANT # GDQPEDIPEVMPDQEPSLTSSQALTKQIVQRSIYFLTHESTGIRARILNLLSSSVAVLSESTLMPSIHSAWPFILNRLADTEVFVVSAAAGLVEALVT # SMGSLMFRRVWDDVWPRFRSMLSKLETADKINAVSHRIRGGVGTESVYTHSHRLYRSIINTMTAALKGVDPQDSSNWEVIVAFRRFLHSEAAEELQQC # VRKLYLAAGTVNADAVWLALTATSGQVTSTSTKFLYESQWDIVQNVELILGELDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 Scaffold_7 AUGUSTUS gene 2938399 2939217 0.67 + . g595 Scaffold_7 AUGUSTUS transcript 2938399 2939217 0.67 + . g595.t1 Scaffold_7 AUGUSTUS start_codon 2938399 2938401 . + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_7 AUGUSTUS CDS 2938399 2939217 0.67 + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_7 AUGUSTUS stop_codon 2939215 2939217 . + 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MSKITVGLGLNTPTYDVSESQLSAPSRKASVDGGSSIRSASSMQGLLQAEIGEAMVELDAGNGTSGFKQGSRIITESL # ASCTQSLHSSSTFIASGHDWSPEKASLSRHGTLLTANATPSRNTAELKSILGNSNARLKPGASIVPVGALSSAESTSLEQAKPRARVEVDVIPETNIF # VQGGYINGTIKIRIRPRSRTESEVLISDGKIRVVGFECIQNEKERHTFYQQSVSLSDASPSAELLFDSPPDNEGFYAAKEGVHVLPVFDVSRARRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 Scaffold_7 AUGUSTUS gene 2939430 2941348 0.44 + . g596 Scaffold_7 AUGUSTUS transcript 2939430 2941348 0.44 + . g596.t1 Scaffold_7 AUGUSTUS start_codon 2939430 2939432 . + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_7 AUGUSTUS CDS 2939430 2940568 0.44 + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_7 AUGUSTUS CDS 2940625 2941348 1 + 1 transcript_id "g596.t1"; gene_id "g596"; Scaffold_7 AUGUSTUS stop_codon 2941346 2941348 . + 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MLSPAAQPIRESAAKSLLMGGSGKVGLTASLHRIYWVAGQQGCVKVRIINKSKKTIKNLTLTLLRSTVAYKPNPHLDV # EGFDEHDADACQTSTVQKQVAECVLEMGQRDHTRGHASVKGWWAGVRPEETSEFCHFLSIPSDAITIPRARLLEIAYNLRVTISAGPIASNIHVVLPI # RIINFLSIDPPPSFPREDQAILDFLGQKPPPEIDEIPNTDVPFTLNGRVLEPLSEDDAADAEYEGDLCAEIDNEYISGRRGSSQSSISEDVTTTNDDT # HPTQLGNATACDDDDSFVQQAVTSLKVDIKYGECGGRFADLYYSTEEVSLPPIPVTPPKLTLHVLQAPKNTVSLHLIPVLAQAYLSPTWLDRDLPDPE # ALLLLRNDQINRERGADESASFVSAPPNASQEPSVGQSNLYRSKRTSSQAGGTAMARQRSSTAGSYFRPREEIPDEVEVLDEEGGDESPSRSPFAEIT # RKASALSSLTTGGSKASSRMLPNIPSSRNTGLPPQSGGSVLMRDGAVDGVPPRVVPTGASDTIGVTSIHPDHLEMDIVPEHSTQIPYKNTRTKLSTPI # TGRARSHTLAAPPSDRERPVSIDQSPLKFSVGGNSVKDRIRMLEEKARAEKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 Scaffold_7 AUGUSTUS gene 2941832 2943145 0.99 - . g597 Scaffold_7 AUGUSTUS transcript 2941832 2943145 0.99 - . g597.t1 Scaffold_7 AUGUSTUS stop_codon 2941832 2941834 . - 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_7 AUGUSTUS CDS 2941832 2943145 0.99 - 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_7 AUGUSTUS start_codon 2943143 2943145 . - 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MLSEAWDRVENDDVDIVETASKSSGVNSGSRLNNTSFLNSLLEENHLTRNDLLSHSALSTLLLDDSPLKARMQPYNHV # CVPEYEGKFYARDVRIAEARDGDAFSDDIAVAVERTETSSSEDVASAGVGKRKRSRSLSPQLLPRNHKKMKRLSPEYDADDLSQQHDHILLAVIGLLE # ALKYESNVAAWIKDNGLFAPNRTESEYINPTLLEGDPEATRIVEGHDAKLDSLYRNSVPEGANGVALTAKKKKERWRNNRHSGRDSGVSALSLGSESS # WTDGSMSFSESVDSGHGNDIGVGDARIKNEDNEIYPSQSQHTEPASRPNTPDSRDTSTYSGATTQPPSPPNARLRRDLARKMHLLPRQERRDVPQHLP # PTLNFIDSIYLYGKEDTSDMKAEPSLKRSNLDCTRHVDHAVESNSGEKDIFSNPVQVRLVLPERG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 Scaffold_7 AUGUSTUS gene 2945798 2946442 0.97 - . g598 Scaffold_7 AUGUSTUS transcript 2945798 2946442 0.97 - . g598.t1 Scaffold_7 AUGUSTUS stop_codon 2945798 2945800 . - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_7 AUGUSTUS CDS 2945798 2946442 0.97 - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_7 AUGUSTUS start_codon 2946440 2946442 . - 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MSYYHHSEEFQQQDTNFSNDTTEPLPNWETLDHQPQQPQDSPSDSHSAFVSPAAPIPHALPSHQFDFSPLHTPVEYGE # NSDFLFPSQQAGPSRVMNFAPQERLGRSEGYPSPEAEFSQPSPSPTTPTLVGPQRTTRSRGTVPRGPSRGSATQRQHHPYQRPQSAMAGRAPEHPGAR # FSLVTGGGIQPYPASMSAPASEAGSRCVVNCSLDSEYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 Scaffold_7 AUGUSTUS gene 2946944 2947951 0.56 - . g599 Scaffold_7 AUGUSTUS transcript 2946944 2947951 0.56 - . g599.t1 Scaffold_7 AUGUSTUS stop_codon 2946944 2946946 . - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_7 AUGUSTUS CDS 2946944 2947951 0.56 - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_7 AUGUSTUS start_codon 2947949 2947951 . - 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MLTNSSQTEGKIRYSKWKAADIAKAFREGRKPTPGAAGEQSSQPVLELSEVLPTSTRTETDETSAASTMSFGIDTNPS # LKSASLTSSPHSRLSPLIKRSSPPPVLDELPPPQPFTPPRTLLGVDPHTLEPTSPGNWSTAATPGAGTVRGTPTDDSPMPFAFTGNSWPPESPTPDTR # NKNRRGSQSSAGSTDSAQSSGLGGTERQRANMSPRKVHFSTDTTSIHPPSANVALFPSDAITPSFVPPHLPSTSSTHHPPVPPNLHSEIQTFQAPPSL # SVPNTILPLIPPPIVSQEVELTPAVVAKAQKHCRFAISALDYEDAEQAKKELRAALTALGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 Scaffold_7 AUGUSTUS gene 2950646 2952019 0.09 - . g600 Scaffold_7 AUGUSTUS transcript 2950646 2952019 0.09 - . g600.t1 Scaffold_7 AUGUSTUS stop_codon 2950646 2950648 . - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_7 AUGUSTUS CDS 2950646 2951250 0.35 - 2 transcript_id "g600.t1"; gene_id "g600"; Scaffold_7 AUGUSTUS CDS 2951764 2952019 0.28 - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_7 AUGUSTUS start_codon 2952017 2952019 . - 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MTNAVNSLKAKGAIPIISSQTPDNIWDGDVIAAPPRFVPYAQEVAGNTSVTYIDHYDYVAQAYEAIGETTVNTYYPID # HTHTTVTEHFEHESEGGTIEEAHASVSLPSPAIATSNHPNPREVVGDPFNGQKLGILGLPDSNLNPEAHIPLSDAASRNEEIWSRLSTVIDLQSQIAT # LHLEMEGIGGKGDQGKGKGKANKAPNVSKRPPVRAASSTAELLDLEHDEGVGVGDDEDEEQRKDREREEDFARLADQFEGRKEGVKSIMSKVIVYFIP # LSHLPNNVLLAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 Scaffold_7 AUGUSTUS gene 2953144 2953694 0.32 - . g601 Scaffold_7 AUGUSTUS transcript 2953144 2953694 0.32 - . g601.t1 Scaffold_7 AUGUSTUS stop_codon 2953144 2953146 . - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_7 AUGUSTUS CDS 2953144 2953514 0.86 - 2 transcript_id "g601.t1"; gene_id "g601"; Scaffold_7 AUGUSTUS CDS 2953598 2953694 0.39 - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_7 AUGUSTUS start_codon 2953692 2953694 . - 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MKRVENVSMYWTAMDILVSFANKKSWVTAKAGLLRALAEGQVSWGFWPPGTPLSSIELEYRDGSGRGVWIKRANKETS # GGEDSNELSEEDSDGDDDPVSEDLDDNDSNGSELESDRQSGGNTGPIDDEKYPLTTTRFAVLHIESDEGASELDDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 Scaffold_7 AUGUSTUS gene 2954686 2955249 0.48 - . g602 Scaffold_7 AUGUSTUS transcript 2954686 2955249 0.48 - . g602.t1 Scaffold_7 AUGUSTUS stop_codon 2954686 2954688 . - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_7 AUGUSTUS CDS 2954686 2955249 0.48 - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_7 AUGUSTUS start_codon 2955247 2955249 . - 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MPRRQPTSTRQKKEERQLKRAVKRGEVSPPPPKGRKKPTNRSRVLHSNAPASALVESSRKLQSTFIKSSRQFLENTKT # LASTIPLPRPIPPTAAILPQSYEQSSEFEALTCPRRPKWRYDMSKKEVESNEEGLFKKWLQETDSALERWRLGNKRSDDHFDDTEHEREPAIVRSSSS # FERNLEVWRQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 Scaffold_7 AUGUSTUS gene 2958014 2959109 0.33 + . g603 Scaffold_7 AUGUSTUS transcript 2958014 2959109 0.33 + . g603.t1 Scaffold_7 AUGUSTUS start_codon 2958014 2958016 . + 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_7 AUGUSTUS CDS 2958014 2958020 0.62 + 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_7 AUGUSTUS CDS 2958096 2958374 0.48 + 2 transcript_id "g603.t1"; gene_id "g603"; Scaffold_7 AUGUSTUS CDS 2958451 2959109 1 + 2 transcript_id "g603.t1"; gene_id "g603"; Scaffold_7 AUGUSTUS stop_codon 2959107 2959109 . + 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MAGSSVKIFATSTGQLVSTLSVPSSTTGVSSEITSVVLNPMNIFQIITSSLDGTIRIWDYLDATLIRTLDIAQPIHHI # CTHDKHQDFVFVTVSRPTEDASSVLRISLKAAAASAQSAVQKPSDITPLGKIRFPTGLAISPSGNWLVATAGHKAYVANLLIIKSGFTKYVSSDRINC # LAFHPVEDYFATGDVKGNIRLWYCLHEPTNVKVAGLEKKTQTASFHWHAHAVSSLAFTSNGAYLLSGGEESVLVIWQLHSGKKEFVPRLGAPIQTISI # TKTLHAGEEYLLGLNDATFVFVSASTLRISRSYSRIKLCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 Scaffold_7 AUGUSTUS gene 2961337 2963217 0.97 - . g604 Scaffold_7 AUGUSTUS transcript 2961337 2963217 0.97 - . g604.t1 Scaffold_7 AUGUSTUS stop_codon 2961337 2961339 . - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_7 AUGUSTUS CDS 2961337 2963217 0.97 - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_7 AUGUSTUS start_codon 2963215 2963217 . - 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MASNSSRGAGPSGIGRGGPNGRGSAARGNGALVHRPSHGPIPEGFRAVSVDEYFRAMLARDPWVPHALGSDEKIGIRR # ECAKLLVSFLRQEAYIKQLRLRPASDATERERHNVEIHEYEANSVKTYISYQLIYWRTFRLNDLPIEILSNIIRYIVWSAPSPPIGISWRLQLTWVSR # HLRHAAISDSTLWNAIWFRDDPPFERSLAFVERSGISPLDLGINDTETRKFTDQEVCALLKALTPHLHHIRMLIILLDNWEPILSVLKWLSDHGKNGN # PPLMMERFEIHRTGNPYIWPGLVYRGERFDPVNHDVSLYSLFGGIYIPELKSFTMNGVYIDWANTPSLDNLNTLDLRRIPLELCPPLPRFRQILASSP # MLTKLSLDGAGPAGNPTSTQNYSAIDLPHLHTLVLANFAAPFTRSIVAHFTAPNVKDLTIMNFRGENYGPFYEFMIGRFRNIKILTLYTTNCPPDILP # TVIKWLDSMPLLTYARLAALEYDILQAFLFDPDTMQAHPALQPQMRTSFGMVEEFTFNEVTAPLQEALDDADREPRLPNPRLNILEVQNIRPQIFAKF # IGARKICGIPVKKTYIAKAMISSFNGPLLEYIRQHIEGLMIVDVGAKTQEEEELLNEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 Scaffold_7 AUGUSTUS gene 2964688 2967164 0.91 - . g605 Scaffold_7 AUGUSTUS transcript 2964688 2967164 0.91 - . g605.t1 Scaffold_7 AUGUSTUS stop_codon 2964688 2964690 . - 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_7 AUGUSTUS CDS 2964688 2965657 0.91 - 1 transcript_id "g605.t1"; gene_id "g605"; Scaffold_7 AUGUSTUS CDS 2965738 2967164 1 - 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_7 AUGUSTUS start_codon 2967162 2967164 . - 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MTAHFKLKLTGGPTRRLSFTDEPTWTLLAERIAGLFDIPAEAIAVAYIDSEDDEVTLSTQEELQDFYQTSYKPGDVVK # FIVEDLRIPRRRDRSSPTTPPAPNFRNTFGGSMSEGLPFNIDEDWQHFPSGVGGLFAANGGRENGSVHGFLEEVESGASTISGAQHDETTSISDSDSN # VSTVIPPRVDKGKGRAQDNDASSTASLIEEKTFEKPDIHVYNIKGTEPTQTHRSRRSSRRSSIAPTITPKAHVQEVPPPPASQPPPSIVPSAVSSRPV # SVARTNETIAPTSIPVLPSEPELVEAADPPLPALDSTSLEHANPSLSLDVANLLNNLASIVSTHPELSEGFRNILRNAAAGSYWTAQRDAMSQAANIA # KSVTEELSRADQEAGRRVSDALGLLFRTISQTVGTVPAATTGTSPSHSPPPLAPPPPADADDSRWGSGSWGRGGPWGARIMPGYEFMRQFGRGPSSPH # VFGRPPPRPPPPPPFGPPGRHGMSPPPPPPPDMRGGPPPPPFPPHVRPPSPPNMRGGPPPPFPPHVRPPSPPDMHGRHGDRPHHGRSYSGGMGYWWAP # TSAPRAPSMDAERRDRQSATELRNQVEAAKLLYKAEKERYRQNRDERRRERDRRMLELMGNLLVFLDLFLLTPSDWEILLRSLQRAAGENSTHQVPEV # PPTPSANPAPVAPPTPLGRDGSRTAHIISNARGSFPQFEMVSVPLPLGPSAGPSAGPRRSNTLPAHALGHGRGGHHGNLGRPHGRRHTFEPEDPATRA # VNRIQRKLTDVRLFYLRLPPYAGTHRFRTADGVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 Scaffold_7 AUGUSTUS gene 2967983 2969033 0.42 + . g606 Scaffold_7 AUGUSTUS transcript 2967983 2969033 0.42 + . g606.t1 Scaffold_7 AUGUSTUS start_codon 2967983 2967985 . + 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_7 AUGUSTUS CDS 2967983 2968437 0.42 + 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_7 AUGUSTUS CDS 2968529 2969033 0.84 + 1 transcript_id "g606.t1"; gene_id "g606"; Scaffold_7 AUGUSTUS stop_codon 2969031 2969033 . + 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MFFSAFHVLVLSIVIAILYRPTYSGDPFKRESTRPQRVLLVTAHPDDECLFFAPTIFGLANGSQLNDASQDGSIGQNN # ENELFSLCLSVGDADGLGHIRKEEYEKSLDVMGIKDTNRIALDDPCALFCLSTALRTLNLEADTFRIAWKYHGTRPHCALLVQILSFDQGGVSDHPNH # KIIPFGIQRMISAYPVYPPPKFYVLITVPLSIKYVGILAPLVAKFDLYAMNMLHSAEDRLSWSMEYFGYPYTTSAEGAKRNREETMPFFVAGISDYLA # ALQAMRQHWSQLVWFRWLNVMFSRYMWVNEWAEVRMQAPDSYAIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 Scaffold_7 AUGUSTUS gene 2971053 2972258 0.92 + . g607 Scaffold_7 AUGUSTUS transcript 2971053 2972258 0.92 + . g607.t1 Scaffold_7 AUGUSTUS start_codon 2971053 2971055 . + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_7 AUGUSTUS CDS 2971053 2972258 0.92 + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_7 AUGUSTUS stop_codon 2972256 2972258 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MRFHVVGLGAVGTLIANHLRRSLPEGHSVSLIHKNVNRARQALWHNSIALEENGLPFVLKNFTHGTADVDVVSATAKL # PNVTSDSRYIESLFVTLKAHQTLPALRRIAGRLSPNSTIVLLQNGMGIYERLLQEVFVNPKQRPHFILASNTHGVYSRGLLDVVHTGRGEIRFGIVPD # FEGRNFETSLHDLSKPLEERRGDLADITQSEKLDPMFGRYRSLRNTVAALQLMEALNPTWLTMEEMQIAMRRKLAVNAVINPLTALMGCKNGEIFQTR # EAHSMLFRICQEASDVFKAEMVAEAKGFMNIADTEAGVDVLLDRIPEVLTRESLMQECLRVAKATKNNISSMLADIRSGASSGTEIDYINGRLIELGH # AYNVPVPVNTALARLVRMRSKLVSGKVDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 Scaffold_7 AUGUSTUS gene 2983435 2984428 0.83 - . g608 Scaffold_7 AUGUSTUS transcript 2983435 2984428 0.83 - . g608.t1 Scaffold_7 AUGUSTUS stop_codon 2983435 2983437 . - 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_7 AUGUSTUS CDS 2983435 2983853 0.83 - 2 transcript_id "g608.t1"; gene_id "g608"; Scaffold_7 AUGUSTUS CDS 2983996 2984428 0.83 - 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_7 AUGUSTUS start_codon 2984426 2984428 . - 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MDDALEIRLEPSLDIDDAFSDTEDQDFEFQFSPDSIRNDLARNAQSWGVENEDDEKPRNGFFESTMESFSTLTIDSDE # RSNEDNASSSRFVSIPLSNPHDGFPVNSEPHEEHPPDATETGTAYPSVFIDLSSHKVTVSVDNTQTTSTSTSVLPASSIPAMTTASVSDTPTSTLKPS # PPTHRLTRSVGPSALEKFVSKTRPSFLPPKTRQEDDKHMADWEAMMKQSRAAGKVPISILLHRYIHALSSGKTKKGIAGAPVSSGEENRRVITSLGER # NCSGLEGGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 Scaffold_7 AUGUSTUS gene 2985061 2985474 0.69 + . g609 Scaffold_7 AUGUSTUS transcript 2985061 2985474 0.69 + . g609.t1 Scaffold_7 AUGUSTUS start_codon 2985061 2985063 . + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_7 AUGUSTUS CDS 2985061 2985474 0.69 + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_7 AUGUSTUS stop_codon 2985472 2985474 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MNPLVSDTYTFLDGSLPSCITSQSRDSIIYVGRAISTVKAAKWQKQLPTDLAIEHANALESVMPDDQPNFDRVISQIR # TSVSEWLWMNVLTLQAVEEAVDSLCVMACISSLKQTDMITVPTTSPTKRRIWVVSYSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 Scaffold_7 AUGUSTUS gene 2987497 2987964 0.77 + . g610 Scaffold_7 AUGUSTUS transcript 2987497 2987964 0.77 + . g610.t1 Scaffold_7 AUGUSTUS start_codon 2987497 2987499 . + 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_7 AUGUSTUS CDS 2987497 2987601 0.79 + 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_7 AUGUSTUS CDS 2987716 2987964 0.96 + 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_7 AUGUSTUS stop_codon 2987962 2987964 . + 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MIVEVPRWTNAKMEISKEEPFNPIKQDVKKNRLRFTWEDPSQQHAETKAKGDNDPLDVCEIGEQVGYVGQVKQVKVLG # IMALLDEGETDWKVIVVDVQDPLASKLNDIEDVERHLPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 Scaffold_7 AUGUSTUS gene 2994196 2994591 0.62 + . g611 Scaffold_7 AUGUSTUS transcript 2994196 2994591 0.62 + . g611.t1 Scaffold_7 AUGUSTUS start_codon 2994196 2994198 . + 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_7 AUGUSTUS CDS 2994196 2994591 0.62 + 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_7 AUGUSTUS stop_codon 2994589 2994591 . + 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MSAVNNWIAPLIDPNAALLPDFISASNSSSSQTSQQTSPQSQHSSSRPPQYTAPPPPLGNPPPIPPDYPPAGSSSMGA # AALLTLATINQTAVQKGVNIQYQGDSSGPAHDPTWTVHCLSKFGESSKYMDGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 Scaffold_7 AUGUSTUS gene 2996025 2997971 0.18 - . g612 Scaffold_7 AUGUSTUS transcript 2996025 2997971 0.18 - . g612.t1 Scaffold_7 AUGUSTUS stop_codon 2996025 2996027 . - 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_7 AUGUSTUS CDS 2996025 2996572 0.3 - 2 transcript_id "g612.t1"; gene_id "g612"; Scaffold_7 AUGUSTUS CDS 2996695 2997039 0.18 - 2 transcript_id "g612.t1"; gene_id "g612"; Scaffold_7 AUGUSTUS CDS 2997305 2997336 0.76 - 1 transcript_id "g612.t1"; gene_id "g612"; Scaffold_7 AUGUSTUS CDS 2997403 2997971 0.82 - 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_7 AUGUSTUS start_codon 2997969 2997971 . - 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MSFSDSVVPPQILPQADCTTTPERRPCSILDPLGPPSPILAPAVLTATMTSEEVPMFLFNSESNDDIASRRASTVSSL # DSYGLTSSRSSDTIQTARTCSTYGTFGQFRRSQLYNTQIQTLSSPYPTRLVSDNAGHTVMHDGPTKSLTSYSLQGYRRESTSGSLITTVTLLSTTPIV # SPPSPSPSVFYNVLGPPFDVKFARRYSTNTRSLDSSKKVIEGGAAQFVPISRQTFNFHYAPFDGQPILRRISINGSSRDHVSRQATMCLKSNGVYIVR # GSETSIIPAKEVSGDSSTEAPKLRWKLDYFVDDRRGSGRREEKMELPNATSCRSSSPLLCEAAPSSPPPLTRTDPSKAHLWNLHRRFQSHGHSRTLER # SESYGAKASSPLGSNRMNGTYNRAQQPVSQRHRRASSAGEICVTDLNQGYQNIDEKKGIKARNGDPVFVLSSNRLESPYDRHILPPSKLSELLENIEN # VKPMLQKVEVFTSLSPAPRNPKVSALK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 Scaffold_7 AUGUSTUS gene 2998780 2999238 0.82 - . g613 Scaffold_7 AUGUSTUS transcript 2998780 2999238 0.82 - . g613.t1 Scaffold_7 AUGUSTUS stop_codon 2998780 2998782 . - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_7 AUGUSTUS CDS 2998780 2999238 0.82 - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_7 AUGUSTUS start_codon 2999236 2999238 . - 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MAAFTTKSVTQNSPFTPPHMRHKSSGYGAYGSRHARAIDSNIVLSTLGSIVADPMDLSLDQDLAESESRIGYGMDFST # AIGGDDGEPIPMAEHSSELISRDDLSDRDSPSIKTPAPTYRTLEMGFRPARAPSLTERGVGGIRVEVEKATATM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 Scaffold_7 AUGUSTUS gene 3006045 3006251 0.11 + . g614 Scaffold_7 AUGUSTUS transcript 3006045 3006251 0.11 + . g614.t1 Scaffold_7 AUGUSTUS start_codon 3006045 3006047 . + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_7 AUGUSTUS CDS 3006045 3006251 0.11 + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_7 AUGUSTUS stop_codon 3006249 3006251 . + 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MAKRDRAFAAMEEGSSKRRKAEEAGYGSDVDMEAAEQYDVADEEEREDETLEKKAMKLWQTVKDAMKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 Scaffold_7 AUGUSTUS gene 3007220 3008476 0.74 + . g615 Scaffold_7 AUGUSTUS transcript 3007220 3008476 0.74 + . g615.t1 Scaffold_7 AUGUSTUS start_codon 3007220 3007222 . + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_7 AUGUSTUS CDS 3007220 3008476 0.74 + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_7 AUGUSTUS stop_codon 3008474 3008476 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MSAAQPSAPEPPIVEEPASSSTPHPPLALRVPTKPAISPEMEAQFSKPPLPAAPVTAPSPSVPIAPTQVPAAPNIHLP # EPEPVPEGKPSIPRSDANQLPVARLTPKPPTAQPVVAQPIPQPSIAQSTPKPSIAQPAAKPPIVPPTTKPPIAQPAPKPFAAHLTAKPHPAIKATKSS # SRTPQSRTPQPILQLHPTMSVYGNTTVTKAKYPSYMQPTPPPIPPAAAITPSYIASIVPKVSTPAPVLATPPPPSPVIPSSHQIRHIMIRTKPRGRLL # KLDHRDGVTSWAMPLERDEKSLSVGEIVFMAELGDSSGEEDEGDDDAAEMDVDSAPEPLKKRRGRPPKVVKTAAVISKPKVPVSPKKKKPKKRGEMLI # KINGTIVKEDEERSGNWDVELSVGSNVVEVGEQGGLIWKVYAQRIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 Scaffold_7 AUGUSTUS gene 3008909 3009916 0.17 + . g616 Scaffold_7 AUGUSTUS transcript 3008909 3009916 0.17 + . g616.t1 Scaffold_7 AUGUSTUS start_codon 3008909 3008911 . + 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_7 AUGUSTUS CDS 3008909 3009916 0.17 + 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_7 AUGUSTUS stop_codon 3009914 3009916 . + 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MEKQMDRERDRDRDYAGRDRDYAGRDRDDRDRERDWKRERERDRDRDRDKEHRYSRTRDRTPEYSKSSRKDGGFDRDD # HWSSRRRSESQPSASSIGHGWGFEDKAAYTSGSTGSSKVNDRGWGTGSGTGQDSNEKTGGVSPWGSGNAGTWGTENNQTAWGAGKPSGWDSVEKAADT # GAWKPLEASVSLFQKQKAKESTNAPPPATSPPPPLPSPPTWNDTSTSKWESVSRKARVPPSPSSASPFPLSMSAMPDIAAGEPVHTNSTPKAPRAFTQ # RITGPSYRKDSNGRRHHQIFGMLLLLPLNTRIYRFLLLERLSKADVFANSWGKLLRVSICK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 Scaffold_7 AUGUSTUS gene 3010144 3010719 0.39 + . g617 Scaffold_7 AUGUSTUS transcript 3010144 3010719 0.39 + . g617.t1 Scaffold_7 AUGUSTUS start_codon 3010144 3010146 . + 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_7 AUGUSTUS CDS 3010144 3010719 0.39 + 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_7 AUGUSTUS stop_codon 3010717 3010719 . + 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MIKPSPSSPSQSSNVDIDELKNRVRARLDELSAYILDLKHILEEQKKAEDAAKEAAKAREAKEREATAAALSAAASSR # AQEITLENLKTRIAELEVRSFEILDVQEEDRARFLSAEFIEEALEVEEEDSIYDELEDLEERIEKTGEQVSNQGMEVSKLSSPERKEKEDALQKQLHR # NARLKKEVRSFVWDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 Scaffold_7 AUGUSTUS gene 3013819 3014535 0.87 + . g618 Scaffold_7 AUGUSTUS transcript 3013819 3014535 0.87 + . g618.t1 Scaffold_7 AUGUSTUS start_codon 3013819 3013821 . + 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_7 AUGUSTUS CDS 3013819 3014535 0.87 + 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_7 AUGUSTUS stop_codon 3014533 3014535 . + 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MKQTVRSPSRPRNVNGRSWTPEGGNKVAGRVNTTHRVARNAGAGNQKISKFSRKEQDEERSSTAESNVEDDEDAEVYL # DDTVIGGVSLLAPRPGQPAQLWYESIIKQNREPDGPRVIYPDIDIAADLHDLFGVDSAQHRNIMVSNLGALNRGLLRPAVKKGKVDYQVRKVMRRYGG # DYSHLQPNLVPTELRKKMRPSQLARLTMSRRNEASATQRKTFDALISSTLKDVDTVEQPIRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 Scaffold_7 AUGUSTUS gene 3014760 3015647 1 - . g619 Scaffold_7 AUGUSTUS transcript 3014760 3015647 1 - . g619.t1 Scaffold_7 AUGUSTUS stop_codon 3014760 3014762 . - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_7 AUGUSTUS CDS 3014760 3015647 1 - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_7 AUGUSTUS start_codon 3015645 3015647 . - 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MSPSDVVPDGSAEALIDELATPTPETPLPVSQPVRKKRRTTVAVDESSAVFPDKESGSMPPPPHPDAAIWGESISAPV # ARRSLSRAPPRIKKECGLVLAAQNYEKGSSRIRRQRHNIAWGFKVPSDVTDMEMDFELPLWLLHDDTFQLRFSLHIGFEEDPRYTQQINPSFKLNPRF # VNGERVCTPENERLVNALETSHREHSEESQSEDSGSEYEDGEGMKKAIVIGGDKLFEIEQQEDEVEPGNIGGEEEEMMTRQKDEGGELSEDRNNDVEG # MIVDREEADREARMAMNKKLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 Scaffold_7 AUGUSTUS gene 3015769 3016635 0.54 - . g620 Scaffold_7 AUGUSTUS transcript 3015769 3016635 0.54 - . g620.t1 Scaffold_7 AUGUSTUS stop_codon 3015769 3015771 . - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_7 AUGUSTUS CDS 3015769 3016499 0.74 - 2 transcript_id "g620.t1"; gene_id "g620"; Scaffold_7 AUGUSTUS CDS 3016569 3016635 0.58 - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_7 AUGUSTUS start_codon 3016633 3016635 . - 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MIETPVFEAIGEGEGVVSRFRPLDTSDEAYLQRHRKYEKFEKRQRLREKEKLQHEQYKLRERVEQLRAMDYSAFLALP # ASSFALFSDGQELDASGQLLNGSSVTEGERRKKEMLAVAESLEERYKILLPPSQKWRKYLSASAEGDEQAELSTTASTSKRYPLPDDGESEIEEKEEL # EEDSLSKQPIKLKLNFSKSVEPPVKRSRPTKKEKKHKNDTLVPSPPAERFEPLSPPTGTPERFLHYLLPPPLLCIPKSLHYLYPILTRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 Scaffold_7 AUGUSTUS gene 3018155 3018613 0.83 + . g621 Scaffold_7 AUGUSTUS transcript 3018155 3018613 0.83 + . g621.t1 Scaffold_7 AUGUSTUS start_codon 3018155 3018157 . + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_7 AUGUSTUS CDS 3018155 3018613 0.83 + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_7 AUGUSTUS stop_codon 3018611 3018613 . + 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MDSDHDTECPWTTYKKSWKKPLKGCLKSPSTSSSPMHSPGSDSPINHTDDTFASFAQACADLQTLRLQPSELNLAIPG # STSSNSSSGSSSPTSNSYESSGTSSPVTDGSLTPRTRARKNVSFCSEEDGLEEVFIADVWDRTPTEPAGHLSYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 Scaffold_7 AUGUSTUS gene 3018992 3019390 0.85 + . g622 Scaffold_7 AUGUSTUS transcript 3018992 3019390 0.85 + . g622.t1 Scaffold_7 AUGUSTUS start_codon 3018992 3018994 . + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_7 AUGUSTUS CDS 3018992 3019390 0.85 + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_7 AUGUSTUS stop_codon 3019388 3019390 . + 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MSPLTASALAAAFASKNAEKRVYPANPIPSNLGPKFVPPTNPPVTVARNNTPTPSPTVDSPSTPKPSLTPTATSSPVP # FTAPAILSPSPSDPFSLSHLLPSKTPTPMRRKPNFAFLPLLDTPRVPVTLLPPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 Scaffold_7 AUGUSTUS gene 3019890 3020237 0.77 + . g623 Scaffold_7 AUGUSTUS transcript 3019890 3020237 0.77 + . g623.t1 Scaffold_7 AUGUSTUS start_codon 3019890 3019892 . + 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_7 AUGUSTUS CDS 3019890 3020237 0.77 + 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_7 AUGUSTUS stop_codon 3020235 3020237 . + 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MQERLERVELERSLAKDVLEDTEPITRTLLSSSPLSNSQTDSSSVSGAASPDAECGQEHADKTTDWEEVERFRRERLG # NKWTPPSSRGPSRTSSRAPSRERNVVEINGVEIELDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 Scaffold_7 AUGUSTUS gene 3020462 3021282 0.87 - . g624 Scaffold_7 AUGUSTUS transcript 3020462 3021282 0.87 - . g624.t1 Scaffold_7 AUGUSTUS stop_codon 3020462 3020464 . - 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_7 AUGUSTUS CDS 3020462 3020930 1 - 1 transcript_id "g624.t1"; gene_id "g624"; Scaffold_7 AUGUSTUS CDS 3021059 3021282 0.87 - 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_7 AUGUSTUS start_codon 3021280 3021282 . - 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MVNEDYFMNNNAYDEIGPYDLNYDTPISRPAPIPYDDPYADEFEVPSASTSIASSISTPFTFHGNDASSLRPQRRSSI # THNEFEWHSKHGPNVSFSSGNGVIPSSLEPQSQFYQQTPVSPIDQWPFQTQTQGMPNYGMPYSPQQQFVQPHINPLFAHHLGMSGMGGGMGMNGGSYG # NMPLANTQPQSPQASGYSGAYASTDGSSYWSSSDQWRVPTQAEGAESPTSTQNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 Scaffold_7 AUGUSTUS gene 3021408 3022485 0.46 - . g625 Scaffold_7 AUGUSTUS transcript 3021408 3022485 0.46 - . g625.t1 Scaffold_7 AUGUSTUS stop_codon 3021408 3021410 . - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_7 AUGUSTUS CDS 3021408 3022143 0.67 - 1 transcript_id "g625.t1"; gene_id "g625"; Scaffold_7 AUGUSTUS CDS 3022211 3022485 0.46 - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_7 AUGUSTUS start_codon 3022483 3022485 . - 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MDAFKLPLGIAQDLLLIQSLVGTTETPPLRIQETTLPEDDIDSSGSEPDSEDEIEAALVGKTDLDGSGYVCNCAFGFY # NSMKSSSSNGTSQITAQVPQESSSSDDHDTSSNSDSDSDSSDSEEVLRKNEAGAKVEDDEEAMMDEEDPGPSATTASYYATKNEIADATITVPDVEEI # GSDEYLELVGKIMNIIGNVVIIEGLQTELARGGSDRALDVDTLLVFEDRKVLGYVSFCSPKFDHCSKKSSQIYETFGPTTQPMYQVKFNSTTYPLDSE # KVCISRQVYHVPQRSNFVFMRQIQAMKGSDASNMNDEEPADHELDFSDDEAEAEHRRNLKKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 Scaffold_7 AUGUSTUS gene 3022605 3023567 0.51 + . g626 Scaffold_7 AUGUSTUS transcript 3022605 3023567 0.51 + . g626.t1 Scaffold_7 AUGUSTUS start_codon 3022605 3022607 . + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_7 AUGUSTUS CDS 3022605 3023567 0.51 + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_7 AUGUSTUS stop_codon 3023565 3023567 . + 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MLKFTRPAQCGRRLAFRRLYSSALTKSRVQLVAELRKISNAPIIKARQALDESNGDFEAAVRWLEEDMRQSGAAKAEK # VKDRVTSEGLISISVLEGGMGSHIGSGSGQVKASIIELNCESDFVSRTDEFTRLASEISNIVAQSQTQQQHTTSPFTSLLVENLLQLSHESGTVGSLI # TDLIARIGENISLRRAMLLTSPNNSNSTYRVASYLHQGRVGALDLIALRPSQSSLFNDDSFVGDLEKLERALARQTAGFMTLGINEKRNPEDELETVL # YQQPFMMLGGENASMPVRKVLDRWQEKWGLEEFGVSDFVRWEVGRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 Scaffold_7 AUGUSTUS gene 3024157 3024609 0.4 + . g627 Scaffold_7 AUGUSTUS transcript 3024157 3024609 0.4 + . g627.t1 Scaffold_7 AUGUSTUS start_codon 3024157 3024159 . + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_7 AUGUSTUS CDS 3024157 3024609 0.4 + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_7 AUGUSTUS stop_codon 3024607 3024609 . + 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MSFTIIGSSYTNDVYTYSFEGDSLGLKSSVEVGFHPSWIAFHPEDRSLIFAGLEQDEGKIIAIKYDAEFKGTVVAESS # SGGKDPCSVVVVKDELLIANVGSLSSTRTFYLFLTMPVVFQWIDICSPGVPERAIHTCGYTYQHDHVERIRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 Scaffold_7 AUGUSTUS gene 3030771 3031178 0.49 - . g628 Scaffold_7 AUGUSTUS transcript 3030771 3031178 0.49 - . g628.t1 Scaffold_7 AUGUSTUS stop_codon 3030771 3030773 . - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_7 AUGUSTUS CDS 3030771 3031178 0.49 - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_7 AUGUSTUS start_codon 3031176 3031178 . - 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MDAQDIQRKGASWMDQGIPGAYYYFRMGDDEVFKFSSEFDTYSPEEFILASGSTPGLEHMMKETSAVSVSSADHSSHR # DTFAEECDLELIQFEQRLADLETKQKERIVQRQLCLWRSVILWRNRCIPSQTKKSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 Scaffold_7 AUGUSTUS gene 3032317 3033075 0.87 + . g629 Scaffold_7 AUGUSTUS transcript 3032317 3033075 0.87 + . g629.t1 Scaffold_7 AUGUSTUS start_codon 3032317 3032319 . + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_7 AUGUSTUS CDS 3032317 3033075 0.87 + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_7 AUGUSTUS stop_codon 3033073 3033075 . + 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MYLDDAHKRSAESIVRKVAQGHKLFGAGSSELGFSWDADPVHKLAQLDMSKPIKFSVVPLSPVGSCIGNLYIVMGQKN # PGKDYEAYVLHNDIDAYLPFENEERVLISKEGDRKLFFFTIRRSLIIPTNFNAAIKNNIPQNFALRIRFLNLHGQNKDDSIKKSVQDLIQHEESHDPV # LTSPPSFPTDGWDFSSSSRDLTKPIHFIVEHEYVIGHPESIFDVVMSSADHRGNYVFREMVTDKNGVIYARKGDRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 Scaffold_7 AUGUSTUS gene 3038808 3039200 0.98 + . g630 Scaffold_7 AUGUSTUS transcript 3038808 3039200 0.98 + . g630.t1 Scaffold_7 AUGUSTUS start_codon 3038808 3038810 . + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_7 AUGUSTUS CDS 3038808 3039200 0.98 + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_7 AUGUSTUS stop_codon 3039198 3039200 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MPSFESIKARYEAAGQDHILKFWPELTDSEKASLLEQLGSLDIERVNRIYKKAVSAESTNSSATSDLIEPLPKGASES # ITHVELANEWRRIGLEAVSRGEVGALLMAGGQGTRLGSNAPKGCYDIGLLPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 Scaffold_7 AUGUSTUS gene 3040025 3040336 0.95 + . g631 Scaffold_7 AUGUSTUS transcript 3040025 3040336 0.95 + . g631.t1 Scaffold_7 AUGUSTUS start_codon 3040025 3040027 . + 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_7 AUGUSTUS CDS 3040025 3040336 0.95 + 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_7 AUGUSTUS stop_codon 3040334 3040336 . + 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MFVFDVFPYTERFAVLEVERKQEFSPLKNAPGTGSDDPETSRRDLLAQHKYFLEKAGAKVKDSVEIEMSPIVSYAGEG # LESTKGKIFSKSGIVSSLEELDALV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 Scaffold_7 AUGUSTUS gene 3041391 3041840 0.91 - . g632 Scaffold_7 AUGUSTUS transcript 3041391 3041840 0.91 - . g632.t1 Scaffold_7 AUGUSTUS stop_codon 3041391 3041393 . - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_7 AUGUSTUS CDS 3041391 3041840 0.91 - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_7 AUGUSTUS start_codon 3041838 3041840 . - 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MKADIAKRTSKAQLLDNKYREKPDILVKVSCRYRAELFFKISRKTKLSKLFGAWTERMERTGHGVTGVLKKVDGVAPA # SGTNVDHGSEDVVPPSFTVPAMQFVFTHNGRSVDADMTPEEAGMEDGDEILAVELMDLTESTGGDDLYVRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 Scaffold_7 AUGUSTUS gene 3043620 3045128 0.97 + . g633 Scaffold_7 AUGUSTUS transcript 3043620 3045128 0.97 + . g633.t1 Scaffold_7 AUGUSTUS start_codon 3043620 3043622 . + 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_7 AUGUSTUS CDS 3043620 3045128 0.97 + 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_7 AUGUSTUS stop_codon 3045126 3045128 . + 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MSSPSRKRQKTILSSPVYPEMDLSQDDLLALDEIERKLSQSAHSSSQTQPGSPSKPPRLPLSDSAENPFQVSSTKLPV # HLFSGFKAASAMTVTHEDLDRFSPDPPEEKDYSTWFEPTGILPSGGFQTANSASTIASFTSASALGHTSLFSTASSLVDKEQLPVSGFRTAGKGGGLL # APSAAALAKAQEKIRTWQEEEPRPCFVSTSEDTFSRSPLRAVQNSVLESEAPCPPVYGSGFASASQLSNNFTSASGFTPETSSNKPSTFVSPLIDRSK # SQNVDPNRPKPFKSPLTSTPKTTMTPTKPVASTSSSARLQHPLAAPPSNASFRTPVRSTNDNISFQQIASSSSTASSSAQKPTSSTSRHHPNHAATVD # TLRSFTTPARRVLHSGNLPSPHVAGRIRSTPAKFVTPFKTGMKPGEAGRLELEAQQRSQQRSRAPAISATNTTGKLMDSLRASSVFDMSECSALEYVV # PLTNLPNSCSADSNIIIGVGPPSSTVYCTRND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 Scaffold_7 AUGUSTUS gene 3055595 3056892 0.37 + . g634 Scaffold_7 AUGUSTUS transcript 3055595 3056892 0.37 + . g634.t1 Scaffold_7 AUGUSTUS start_codon 3055595 3055597 . + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_7 AUGUSTUS CDS 3055595 3056416 0.48 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_7 AUGUSTUS CDS 3056461 3056892 0.75 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_7 AUGUSTUS stop_codon 3056890 3056892 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MDRRNRSLLVQFWLTVETFKNPLEAVDSSSEDDEDEPVQDALTAITVKEDISMIHDLYFSGTIHPVLSSIPKKYVESI # RAFVRNEVENSRVAQGRVRKNVLLAQRQVERDMEHDFEDFGSSELWFRVMSDADFTLRVPPPPKEKRSSNVRTGSSHDSDTPKSYRPSLLPRSGSAPG # PFPKTEMPGSTQSLRSVDSVASAKISSMAHPTKSNIEILMSPVTDASSDSERAPLFDDPDDRAQRAEEHRMDAIHAALTDIMALDEAHYGSEEDIDDR # SDAFSQEVDDHIVEPDEDVPDEMEEGRGSFQLAGPGDLQLSYEIARLADKILSVQTQEIMLDNLIKKAELTGDNQELRLLNRSKSSMNRELRELNFQK # VQYEQQESANRLVSDRTKISIVSSAAGEEEGKSVVRYLIEVQQLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 Scaffold_7 AUGUSTUS gene 3057260 3057592 0.63 + . g635 Scaffold_7 AUGUSTUS transcript 3057260 3057592 0.63 + . g635.t1 Scaffold_7 AUGUSTUS start_codon 3057260 3057262 . + 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_7 AUGUSTUS CDS 3057260 3057592 0.63 + 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_7 AUGUSTUS stop_codon 3057590 3057592 . + 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MLFGQSMLDVMIQRLTRQAAEFAGIVGSGVTDENFVAQALNASGKTAPAALMQLSADLKPLEGESSTSTFSAPICDLL # LAIFELNKQNNWLRRQAVVIILQQVLGGTIER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 Scaffold_7 AUGUSTUS gene 3060438 3062051 0.9 + . g636 Scaffold_7 AUGUSTUS transcript 3060438 3062051 0.9 + . g636.t1 Scaffold_7 AUGUSTUS start_codon 3060438 3060440 . + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_7 AUGUSTUS CDS 3060438 3062051 0.9 + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_7 AUGUSTUS stop_codon 3062049 3062051 . + 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MNSRCTSRICSVRLVEYKTSRATLSSQASQWLESKSRTTQASLRAAVAIALIKLKKGSIADSVAENFNDASSTKGKNV # DDGLAEVMKKLVIDGTEKSSLADAVEGLAYLSTDPAIKEELSKDSQFLKRLFSLTPKRKSTAISESTSTVLYGVLIIVSNICAYRPQLSEEQKQMEKL # RKMAKSSGTPSDTSDSLNDDGRVKERIKRLLTAGVLDVLATALPSTDTSGIRIAIGNALLDIITDKDNRGKVLQHGGGKLLVLLIGKAMSELNGTAEL # DVAYLAPIQALAKLAITSSPIAVFGPNQGALYDAIRPFSLLLRHSSAKQLQRFEALMALTNLASASPDVSSRIANADGLLDHVELLLLDDHPMVQRAS # VELLCNLIAGSDKVFDRYSDADGAGKSKLHIILALSDAEDLQTRLAASGALATLTSAPSACRALLQIQRDRHRVLLILTLLIDPSAAPQDDQLDGEGH # PGLVHRGVVCACNFLLSIEAEESQKIIREEATEIGLIQALQNTVKYNGTPQIVQLASEALKFLLDTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 Scaffold_7 AUGUSTUS gene 3063136 3064464 0.22 + . g637 Scaffold_7 AUGUSTUS transcript 3063136 3064464 0.22 + . g637.t1 Scaffold_7 AUGUSTUS start_codon 3063136 3063138 . + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_7 AUGUSTUS CDS 3063136 3063798 0.44 + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_7 AUGUSTUS CDS 3063976 3064464 0.69 + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_7 AUGUSTUS stop_codon 3064462 3064464 . + 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MRGTSTYSISSQKLQALNNEVCRKTLTCEQLLMHAYQRCLVCKALKRMRTQVLAIALMFRTLTTTKILQTPSLDHILS # YSVLGCSLTYHQNAMRIIGLSDHEQSEIFRMLATILWLGNVQFVEDDSGNSTIADAGVTDFVAYLLEVDSALVQKVMTIRVMETQRGGRRGSVYDVPL # NPAQATSGRDALAKAIYNNLFEWIVSRINVSMKPRSAHAQIIGILLQQIFIELTLKTEQEEYVREQIKWTPIKYFNNKIVCDLIEERRPPGIFAALND # ACATAHADPTAADNSFMQRSAGLASNPHFESRGAQFLVKHYAGDVMYNVSGMTDKNKDSLLKDLLDLIASSGNQFLQTIFPDRPDPNSKKRPPTAGDR # IKVSTWFKENS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 Scaffold_7 AUGUSTUS gene 3065513 3066785 0.13 + . g638 Scaffold_7 AUGUSTUS transcript 3065513 3066785 0.13 + . g638.t1 Scaffold_7 AUGUSTUS start_codon 3065513 3065515 . + 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_7 AUGUSTUS CDS 3065513 3065515 0.18 + 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_7 AUGUSTUS CDS 3065562 3065683 0.51 + 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_7 AUGUSTUS CDS 3065738 3065948 0.5 + 1 transcript_id "g638.t1"; gene_id "g638"; Scaffold_7 AUGUSTUS CDS 3065997 3066785 0.94 + 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_7 AUGUSTUS stop_codon 3066783 3066785 . + 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MALNVNASEEGDPVFHCYFKTELASNLITLTNSSISLMIGPTIEYAKKKEKRAQIKAVKDETIQKDDLYKSHAIHVQS # GEAPNSLSRPAAKRKPGTVRPITQGKLLRPGGPTKSKPASKPKPVAQKLPGQTTTPAAQSIVPKPTPASTNGVARTAPAPSRASVPPPPPPPPVHPAA # ELYKAKYAFNGEEGEMSLKKDDIVEVISKEGDNGWWLVKKDGVEGWAPINYLELVPPAAPPAAPKPPPHRTKPAPAAPVAAKPPVATAKTVAHSLTAN # ASAKPVSVFPGMVPANGSTAPWKKTSAITPDDSPASSRPSSVIGHKPPPPSVASKPKPPAPPIGVKPSPNIPGKPPIPSAPRPSVGGAQRLLITLSLL # LL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 Scaffold_7 AUGUSTUS gene 3068187 3068645 0.67 + . g639 Scaffold_7 AUGUSTUS transcript 3068187 3068645 0.67 + . g639.t1 Scaffold_7 AUGUSTUS start_codon 3068187 3068189 . + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_7 AUGUSTUS CDS 3068187 3068645 0.67 + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_7 AUGUSTUS stop_codon 3068643 3068645 . + 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MDIGVLDISTCQPLPNAMVEIWSSKSLLSFNLVAGRPFHLSPSSAANAQGEYSPTALRGAYPSAANGIAEIQTIFPGF # NSDGANHMNIAVHSGNSMNSSTSHNGRVFFTDGWTNIISMSSPPYQNNPNIRTLDLDDPVYVEANSNGYTAVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 Scaffold_7 AUGUSTUS gene 3071473 3071973 0.76 + . g640 Scaffold_7 AUGUSTUS transcript 3071473 3071973 0.76 + . g640.t1 Scaffold_7 AUGUSTUS start_codon 3071473 3071475 . + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_7 AUGUSTUS CDS 3071473 3071973 0.76 + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_7 AUGUSTUS stop_codon 3071971 3071973 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MGTHARFGGHFVQVNSPQMTCIVLLLKRTKGHVDTTATIVERTPDGDSIRLKFQLPEPTPTRPSLLRYLISKGFVAID # GASLTLTEVNDSDRTFGVMLIQHTQEKITLGKKQLGAKVNIEVDMVSKYLEKSVTAALEGEGAEGGLGIRTMVEKIVEEVLVKKGLAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 Scaffold_7 AUGUSTUS gene 3072354 3072932 0.37 + . g641 Scaffold_7 AUGUSTUS transcript 3072354 3072932 0.37 + . g641.t1 Scaffold_7 AUGUSTUS start_codon 3072354 3072356 . + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_7 AUGUSTUS CDS 3072354 3072932 0.37 + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_7 AUGUSTUS stop_codon 3072930 3072932 . + 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MPLRLAISKVTSKLSYNDRPTNRVPSPYRPPSPMKSTVSLSMTPTTMIRPKAKVNSSATPASARAKVTRPLSAVSPIG # TRPPASAIPRPASPTKSHTKYSPAVSHKPRIARNDARPHSSHSTPGTPTSTYLSIESPESENKSKYGGSLSVRQTSPPLGLGLSNGTLGANSIFSPPS # DEQADPPLKIKSKSRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 Scaffold_7 AUGUSTUS gene 3073543 3074193 0.66 + . g642 Scaffold_7 AUGUSTUS transcript 3073543 3074193 0.66 + . g642.t1 Scaffold_7 AUGUSTUS start_codon 3073543 3073545 . + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_7 AUGUSTUS CDS 3073543 3074193 0.66 + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_7 AUGUSTUS stop_codon 3074191 3074193 . + 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MLHFHSSRLNSLLTDLQFQIADLEITNRSLLAINSTLEATKHRQAKEIRELRRKLRESRLILPPHTYRAVTSNDTETL # ALPEDDDEEEDEEEEETHGNDQTYMRIRIRLDEMIQSAQKALTTKHTDFAEMKGPTKVLSEQEVRDWRGSEDVGDVSLVLEDEDERNEVLLMRAPSWN # GEMGIQDNDSDGTTSEDEVEAMTMLRDSPSPPPIVVTSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 Scaffold_7 AUGUSTUS gene 3075108 3075583 0.11 + . g643 Scaffold_7 AUGUSTUS transcript 3075108 3075583 0.11 + . g643.t1 Scaffold_7 AUGUSTUS start_codon 3075108 3075110 . + 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_7 AUGUSTUS CDS 3075108 3075355 0.62 + 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_7 AUGUSTUS CDS 3075406 3075583 0.18 + 1 transcript_id "g643.t1"; gene_id "g643"; Scaffold_7 AUGUSTUS stop_codon 3075581 3075583 . + 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MASIEKFGDEIKEFDQMKKKLESRRCVTFVHLNIRKQLMTWIWLRLSYDAAISKVEKLKNGKKDKEKERKEAEEELES # AQARYEETAEDLRAQMHLIQENEIDQTREMTAFLDLELNYVEQYLEVLKDVKSEWSISRYLYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 Scaffold_7 AUGUSTUS gene 3075635 3077143 0.21 + . g644 Scaffold_7 AUGUSTUS transcript 3075635 3077143 0.21 + . g644.t1 Scaffold_7 AUGUSTUS start_codon 3075635 3075637 . + 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_7 AUGUSTUS CDS 3075635 3077143 0.21 + 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_7 AUGUSTUS stop_codon 3077141 3077143 . + 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MNSIRRPSTISRSTSVKTKSPKIPPAPHKRTPSVKSHGTQDATSSDLTDDDDEEASRTLASRSRRSSMHRADGTTGTS # ISRPSSRASRKRSDSSGAPGDTDKNSRKMSVAGWASTAMGSFSGRSKKSRDKEQFSTLDDSSGGASRGSLDDVDWNPASAPMSSSLNKSSSLGKKSLS # NLRGTKSNSGSPQIPPRILRPPSLQGKKVMRALYDFDGAADELSFKVGDEIVVISEVLDGWWTGELHGKQGLFPTPYTEVVPAKPPLPNRPDLSGMGG # KKSANGSKVFGSRESVSSGDNVLDEDNILDVHPLSASNSPFFGGLVSPTAAHQNNADTESILSSLVSEGEDESDFLVRSRQATSVTAARSILSSLPSL # SHRSSSDVSSSTSTSSGVYGVYGNGGITKKAPPPPPPPRRMTAAPIATPPIPSRKFTGSNRSQSFGAGSGSGSQFIPTPGSSVSSHGYDTSPFESATE # LQSSAGQGSGCGQFKQNPFKPKGMCSNCFEYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 Scaffold_7 AUGUSTUS gene 3078694 3079449 0.86 + . g645 Scaffold_7 AUGUSTUS transcript 3078694 3079449 0.86 + . g645.t1 Scaffold_7 AUGUSTUS start_codon 3078694 3078696 . + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_7 AUGUSTUS CDS 3078694 3079449 0.86 + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_7 AUGUSTUS stop_codon 3079447 3079449 . + 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MPCSSTNPKGKSAEKHLPFLPPPTPPAKDSTSFLSPSRVSLPSPALSASTTSSKLKKERKDKVKSKKKKFSIGEDNDD # DAIEVLAVPPPPFPLSHAHYVSDPLPQSSSTTAVYDLSLDHDPPTTVIPIPNDKKLPYPPRPPLIRRHDGTTETDGHTSEHTIASSSQHASSSSSIEA # RTQRRWTLALAMTSDELTDEVFVEKVERLRRDSVRVPFEHETAESKSRSVEGVGGFRGWEFGYLDPDSGWFRRGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 Scaffold_7 AUGUSTUS gene 3079698 3080801 0.59 + . g646 Scaffold_7 AUGUSTUS transcript 3079698 3080801 0.59 + . g646.t1 Scaffold_7 AUGUSTUS start_codon 3079698 3079700 . + 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_7 AUGUSTUS CDS 3079698 3080801 0.59 + 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_7 AUGUSTUS stop_codon 3080799 3080801 . + 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MLITRDLLRTEKNYLNQLRVLLSSSPCVMTPAAQAVAETSFLWGIPGDSLLSSSGVASTTGMLNLATVDSERSTSAAL # PWPKYPPPSLMHTYLLSLIALSLSLLSEWEKDPTIAGAGRVLVEKEEEIERVFVGWCGVVGGWFTHNDDGSGKKVKLTREEPGLKRSRKLSKTKVSPS # TLSSLSSLTSQPVSAVVSTISMLPSLPSTAASSSPSTVNRHSVARSSTMSIKMAKWRKSMPNVPALSDLTINPDAARSNAASAPSPPKSAEPRVNGFD # QQRQQELPPLPRSAYKSKECASVRRASTFLSLKILRKIMNSVGGGERKRNSCRLLNEGKFLAVEATGSFPGSTGLRRARIRLALVLSSSLAMV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 Scaffold_7 AUGUSTUS gene 3084053 3084529 0.13 - . g647 Scaffold_7 AUGUSTUS transcript 3084053 3084529 0.13 - . g647.t1 Scaffold_7 AUGUSTUS stop_codon 3084053 3084055 . - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_7 AUGUSTUS CDS 3084053 3084529 0.13 - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_7 AUGUSTUS start_codon 3084527 3084529 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MQQPGRLLSLFRDIGSHDPESLSLSGDPAVDEVLRTLSGSDLTRLLRYTRDWKQNAKTSEVAQRVLFAIFKLRTAEDV # MKTFTDEVVELSLVSGELADSSANIKSGNALKELIDSLVPYTERHLTRMDKLLQESYTVDYILGEMDNGMFDDDGDLDMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 Scaffold_7 AUGUSTUS gene 3085924 3087214 0.74 - . g648 Scaffold_7 AUGUSTUS transcript 3085924 3087214 0.74 - . g648.t1 Scaffold_7 AUGUSTUS stop_codon 3085924 3085926 . - 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_7 AUGUSTUS CDS 3085924 3086720 0.91 - 2 transcript_id "g648.t1"; gene_id "g648"; Scaffold_7 AUGUSTUS CDS 3087025 3087214 0.85 - 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_7 AUGUSTUS start_codon 3087212 3087214 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MRPQRAHNYESRLLRFDSFQKPDMSEFAQNQSVKCYSVKWRKISALALKFLWRYQLVVLNCEPLFTSSLSLRIFELPK # SIKPSSHSISPVRVVARAHDAPIHVCESDPTSTYLASGSADGVVKVWDILRGFITHVFKGHGGVVSALKFNYPQHSDSLRQQNSMQLVTASVDTRIRI # FELSQNRIGGLKPISVLEGHSSVPRGLDVSSDGRWLVSGGRDSVVLVWDLSPLSSASTTESSKKGKNKASVPKLVKTLPILERVEALGLLLSDEESSS # SAVGLNDLRFFTGGESGLIKIWEAKEGTTLFSLGDEQTRISDDSEEQRQIVQGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 Scaffold_7 AUGUSTUS gene 3087436 3088705 0.3 - . g649 Scaffold_7 AUGUSTUS transcript 3087436 3088705 0.3 - . g649.t1 Scaffold_7 AUGUSTUS stop_codon 3087436 3087438 . - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_7 AUGUSTUS CDS 3087436 3088066 0.84 - 1 transcript_id "g649.t1"; gene_id "g649"; Scaffold_7 AUGUSTUS CDS 3088164 3088705 0.3 - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_7 AUGUSTUS start_codon 3088703 3088705 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MENNESMCENLEDYISTSWSYNNPLTACFSPLFHSFHSMASLRDLLNPIEVRKKTVKCALFITLCLVGGTLIKAVQRL # LLNHNVTPENERPSSPESNISDNTAIDYHHEEVPERVDHEPHPNCPDSLDCLPDTDGRPQHTLPVILRCAILGSPRKRLTIREIYAAMEGKYHYYRTS # GPHGRQPRPATDPGFGSYWTVNLSAPPGTKRPRKRGRGNKAVPKVDATVASGSSSNANSNPVVEAPAPAPVSRRGRPRKELSLSPVKCEDMEGQDELM # ACDEGAKTPRDEEMYDESDEDLLHPFDRRSSLIGLTNYPTNVPSSQSPLPPLDESNSKTIERLESESAELRRQASDAVQLSIRLSDQLAQAHTEASRA # QSALRSVEALLEKETTSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 Scaffold_7 AUGUSTUS gene 3095148 3095728 0.36 - . g650 Scaffold_7 AUGUSTUS transcript 3095148 3095728 0.36 - . g650.t1 Scaffold_7 AUGUSTUS stop_codon 3095148 3095150 . - 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_7 AUGUSTUS CDS 3095148 3095546 0.77 - 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_7 AUGUSTUS CDS 3095597 3095728 0.36 - 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_7 AUGUSTUS start_codon 3095726 3095728 . - 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MADNYYALLANVYPEVWFDQGIELGGGQAFTQGAEGDERNNKHIAQAAKYLDEIINCTSTLCIRQLVPFTSLDDQMLS # SVYRAPCVGSQCLLETNISLLPSTQIDVDSANQILEIEKINRNSFKSNDTKDFLLHPPSHAVDGNPQTGFCIPKGRSSVNSVYCVLPNINRRQERGHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 Scaffold_7 AUGUSTUS gene 3097309 3097731 0.82 + . g651 Scaffold_7 AUGUSTUS transcript 3097309 3097731 0.82 + . g651.t1 Scaffold_7 AUGUSTUS start_codon 3097309 3097311 . + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_7 AUGUSTUS CDS 3097309 3097731 0.82 + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_7 AUGUSTUS stop_codon 3097729 3097731 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MVNSSKSKARLHSYVPRGNRVNLAGSLDTLDPFKFEFMTKRSGLEAVLKTLKVALESPHLQKVKLNVVVVKGLNDNEV # LDFVEMTKDRPISVRFIEFMPFTGTLHPSSSLNHDRCCSISRSVQGTNGTSSRWYLHPTCFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 Scaffold_7 AUGUSTUS gene 3098356 3098880 0.49 + . g652 Scaffold_7 AUGUSTUS transcript 3098356 3098880 0.49 + . g652.t1 Scaffold_7 AUGUSTUS start_codon 3098356 3098358 . + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_7 AUGUSTUS CDS 3098356 3098880 0.49 + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_7 AUGUSTUS stop_codon 3098878 3098880 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MVDVSEKSVTKRSATAKGRIVITERAYDLINKSYSSESESKMGKNSSSMDEAQKKVLRKGDTLTVAQLAAIMGSKKTS # DLIPLCHPLPLTDVKVKLTCEAFEETQGIWKYSVVCQATVACEGKTGVEMEALTAVSVGLLTIWDMLKAVAGKEMVIGEIMVSEKSGGRSGEFHRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 Scaffold_7 AUGUSTUS gene 3102475 3102900 0.32 - . g653 Scaffold_7 AUGUSTUS transcript 3102475 3102900 0.32 - . g653.t1 Scaffold_7 AUGUSTUS stop_codon 3102475 3102477 . - 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_7 AUGUSTUS CDS 3102475 3102543 0.35 - 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_7 AUGUSTUS CDS 3102613 3102900 0.45 - 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_7 AUGUSTUS start_codon 3102898 3102900 . - 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MKSTILGLSLVSAAAAQISVNGVSMVPAMTAYNNYASATAAASSSAPASYATAAPSSSDFYSVMPYSSYSSGGYKSLA # CGYGYSKQSDGSCQAESWFSGCYETIIIKCAQSLLSFHKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 Scaffold_7 AUGUSTUS gene 3113188 3114831 0.6 - . g654 Scaffold_7 AUGUSTUS transcript 3113188 3114831 0.6 - . g654.t1 Scaffold_7 AUGUSTUS stop_codon 3113188 3113190 . - 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_7 AUGUSTUS CDS 3113188 3113907 0.6 - 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_7 AUGUSTUS CDS 3113962 3114831 0.63 - 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_7 AUGUSTUS start_codon 3114829 3114831 . - 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MAVHPAGHFFAVGYADGSIAFWAIEDEDQPLLVRTLNDLDVQNVNAEQLEAHLAHKGEKTAAFSGEPIFKLSWCSFPN # SSDPRGGETALVILGGLSLEDPPGITVHWLPAFNPTDPPASQSTTPALHPYIRSSMRTSVEPMNTYFYEIHGTVHDYILIPRESPHFTGSFDVVSILV # VKESVAGTRVVEAYEFPPPAFAEHAHDDPHPVEEGRDTLDDLANTLQDLQINNDPRRLQLPGYLSNGTSGLLGGVIRTLTKDAYSFLVQTDAPAHALS # LKAGYAWSDPVDHISKYQPPRITITWHADLSVQIWDVSAQLVQKFKPDPIDCEFPNSLPNLTIDTNVVLMAPFVASKLPVQDHTIQYVRMAAESFECA # VVLSSGMVILYQFTSPPDPLPPFEELLDPELLSLRHVFPSPDSTSRFSPFFALSPNRGQVSACALADVGRLSSNQKRWCTHTEKCPGFLAVAYADGCL # FVIDMRGPTVILRHGVKAKSRHSIGLHVGTDTDPITSLEWTISPIDKGMDISATTCFHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 Scaffold_7 AUGUSTUS gene 3117340 3119259 0.74 - . g655 Scaffold_7 AUGUSTUS transcript 3117340 3119259 0.74 - . g655.t1 Scaffold_7 AUGUSTUS stop_codon 3117340 3117342 . - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_7 AUGUSTUS CDS 3117340 3119259 0.74 - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_7 AUGUSTUS start_codon 3119257 3119259 . - 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MSRLSALDMEWRTKLDDANIGQQESRNEVDHLNASVVRISKMLETVTSERDSLSVQVTNLDSEIASARQELTEAESRY # TQLQFHQLSDMPSTQATKTLRSQIEELEGRVMRRTEQIGIHQHDIRRLETNLRLHEERLAEMTTEMEMIVAQKDAMVEDCADARDQRDEAILKIEKLE # EDVERLENLLEDRNQEQEAIIEVMFLNSARTKEKMTVENGRIEEMRARMQSLLEEHDNTLHNVQTLNQALEDVKQRLQSSEQDAKRTAESLASSQAEL # TRSLMSTEDLVQMKIDLSGQVRELEDQLGSRVTEVSTLTSQLENLQQESSSTIKQRADTIALLESQLENARSSLSLKETEHRVALEDLQQQIIQKDRD # LALNDLEGDLVQLKMKHVEELGQLQSRLVEVTTAFDELQARHCSSQVTHEQSLADSAESKAQVEKQLREAIRELSLLKEIKESLETASQKHLDEARQL # EERVAAANLELTLTREKLNKSDESVQRNIDELVKARLEHEKVLAEARDTLAETQTRLEEESTAANQSREQASALQKKLEEEAHGRLQDRSFYEEALQS # AKECQEQAELRVDELGQNVSALETQIRKAVAQIQTLQDEKKTAEREMTTLEAKNQRSLSLNRHLESQIRER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 Scaffold_7 AUGUSTUS gene 3130005 3130520 0.54 + . g656 Scaffold_7 AUGUSTUS transcript 3130005 3130520 0.54 + . g656.t1 Scaffold_7 AUGUSTUS start_codon 3130005 3130007 . + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_7 AUGUSTUS CDS 3130005 3130520 0.54 + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_7 AUGUSTUS stop_codon 3130518 3130520 . + 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MEEHSPEECTEVMKRCHLDSVIVHKENDCNALLNMPVNQGSLSGGERQLVALSRAILRGTNVIIMDEATSQIDAQLDE # NVCPFLDILGSTLMYVTCSQIQKTIREELGGAIVITIAHRLKTIIDYDRILVLDDGEIAEFGTPKELLNKDGGVFKEMCRKSPDWTNFKSLIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 Scaffold_7 AUGUSTUS gene 3136900 3138276 0.85 - . g657 Scaffold_7 AUGUSTUS transcript 3136900 3138276 0.85 - . g657.t1 Scaffold_7 AUGUSTUS stop_codon 3136900 3136902 . - 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_7 AUGUSTUS CDS 3136900 3138276 0.85 - 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_7 AUGUSTUS start_codon 3138274 3138276 . - 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MDWMYNADPFAARKQVDERQARAAEKRAQTVSSAESGENSRKGAASASGEFSQAPEVRMALALRDQVEEAVKQVRVGT # TDIMEDTLTIYLQGLSMFSGYDTTRTEEPLTIDPDNAENIMQQLTHLRFKSAQARKTVEFLSKPSPMTERLLSMLSPLDASIEYLVLHLPEEALPERF # LPSINSSNPFVTGVHSGRDNLKARWTAERAIKEAGWPVHLVKEFMDAQYIDDWNSLIAMLGKKLIGDDSPVDKADENDECFPIDAQEAEAFGGHFEDP # NHLVMPMFSAPVTLHVLFLSGSYPRCAYAPMYITGPSIPGYVRLHLLSCLLLAVKDPEFLQDDEGFCSAAMRCLEDVWAKVEDQGPPDLLEVLQHVIP # SPITSSKPTAVPANTPVRTKKEIEHNTKKRDTRSSEQIKVDFDQICQSEKVTFVCLFGSPSHTFPSIAKYFLNEKNCPLSQSKRNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 Scaffold_7 AUGUSTUS gene 3139303 3140650 0.26 + . g658 Scaffold_7 AUGUSTUS transcript 3139303 3140650 0.26 + . g658.t1 Scaffold_7 AUGUSTUS start_codon 3139303 3139305 . + 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_7 AUGUSTUS CDS 3139303 3139726 0.36 + 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_7 AUGUSTUS CDS 3139776 3140650 0.61 + 2 transcript_id "g658.t1"; gene_id "g658"; Scaffold_7 AUGUSTUS stop_codon 3140648 3140650 . + 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MHPKHKKKVSSDGEAVPKGDGELTEQEKKKRMFPGLSMKDHEQEAVSDDVFLKELGDLVSGKKRPSQLERSPKRQKRD # RSPPPRRRTPSPVRGRDYDRRGRNGRPSQDERPILFKIYSGRVSGLKDFGAFVTLEGVAGRVEGMVHVSNIQTGARANSASDLLSRGQNVQVKVMSVA # GSRISLSMKDVDQATGRDLTPHLRIKSEAEIEEERTRAARISSSGANALPLNSKILEGPVRSAKRLTSPERWEIKQLISSGALDASEYPDLDEDFSNP # MAHAEIEEELDVEIREDEPPFLAGQTKKTLELSPVKIVKAPDGSMNRAALAGASLAKERRELRQQEANDQADSEARDFSSPWLDPMAKEGERVFAQDM # RGHLKGQKAGEVPSWKQETFNKATTYGEITTLSIQDQRKRLPIFKLRDPLLKAIEEVRDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 Scaffold_7 AUGUSTUS gene 3141289 3142704 0.47 + . g659 Scaffold_7 AUGUSTUS transcript 3141289 3142704 0.47 + . g659.t1 Scaffold_7 AUGUSTUS start_codon 3141289 3141291 . + 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_7 AUGUSTUS CDS 3141289 3142704 0.47 + 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_7 AUGUSTUS stop_codon 3142702 3142704 . + 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MQIHLSEPPGDILLFLTGQEEIDTACEILYERMKALGPKVPELLILPIYSALPSEVQSRVFDTTPPGARKVVIATNVA # ETSLTIPAIYYVIDPGFSKQSAYDPRLGMDSLVVMPISQAQARQRSGRAGRTGPGKCYRLYTEAAFRNEMLPNSIPDIQRTNLASTILQLKAMGINDL # LSFDFMDPPPAPTMLTALESLYALSALDDEGLLTRLGRKMADFPGDPPLAKMLIASVELGCSEEILSIVAMLSVQSVFYRPKEKQGQADSKKAKFHQP # EGDHLTLLTVYNGWKNANFSNPWCYENFIQARSMRRAQDVRKQLLGIMDRYKHDILSAGRDFNKVRRAICSGFFRHAAKKDPQEGYKTLVEGTPVYIH # PSSALFNRNPEWLIYHELVLTTREYCHNVTAVEPKWLVEVAPQFFKVADANKISKRKRQEKIEPLYNKYEKEDEWRLSKVKRSARSVCYLLTVPLGML # Y] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 Scaffold_7 AUGUSTUS gene 3143656 3143970 0.75 + . g660 Scaffold_7 AUGUSTUS transcript 3143656 3143970 0.75 + . g660.t1 Scaffold_7 AUGUSTUS start_codon 3143656 3143658 . + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_7 AUGUSTUS CDS 3143656 3143970 0.75 + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_7 AUGUSTUS stop_codon 3143968 3143970 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MTVTADPKEDLNGKEPSQVIEDNDDGEDDVAEIDPAGTGSNLFLLPIHPMILTEPYKGDAKKKKKKKKPKKKKAEQSD # PPRIGLSKLFPTNVYPEGELQPYKDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 Scaffold_7 AUGUSTUS gene 3147072 3147389 0.58 + . g661 Scaffold_7 AUGUSTUS transcript 3147072 3147389 0.58 + . g661.t1 Scaffold_7 AUGUSTUS start_codon 3147072 3147074 . + 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_7 AUGUSTUS CDS 3147072 3147389 0.58 + 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_7 AUGUSTUS stop_codon 3147387 3147389 . + 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MSCESWDSNEPYDIIPMPAPDDHLNPVALYLGDNMEQYMTHPYASPLFGDFTGLPPLLIQAGDSEVLRDEITLLAHKA # SLAGVEVRHELYQDAVSIGSVFNRCDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 Scaffold_7 AUGUSTUS gene 3150069 3150830 0.57 + . g662 Scaffold_7 AUGUSTUS transcript 3150069 3150830 0.57 + . g662.t1 Scaffold_7 AUGUSTUS start_codon 3150069 3150071 . + 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_7 AUGUSTUS CDS 3150069 3150600 0.57 + 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_7 AUGUSTUS CDS 3150721 3150830 0.66 + 2 transcript_id "g662.t1"; gene_id "g662"; Scaffold_7 AUGUSTUS stop_codon 3150828 3150830 . + 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MSGSALGSLCAQDIAQAWLTDFSRSLSTGDCQTATSAFLKDGWLRDILVFTWNNRSLFGTSKIMKYLEENLERDTLSD # FRLNDESHLAPYNNQSLPTAVSSGFTFRTPIAFGQGFVNLSQDESGNWKALTVLMMMKDLIGHEESGPEEGVYEGHTRAWVDVNEERRKAVEETPHVI # IYENPKYSFRTRRQNRGSLAKTVPDFEFTYPKESSFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 Scaffold_7 AUGUSTUS gene 3152538 3154115 0.32 - . g663 Scaffold_7 AUGUSTUS transcript 3152538 3154115 0.32 - . g663.t1 Scaffold_7 AUGUSTUS stop_codon 3152538 3152540 . - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_7 AUGUSTUS CDS 3152538 3153002 1 - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_7 AUGUSTUS CDS 3153102 3154115 0.32 - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_7 AUGUSTUS start_codon 3154113 3154115 . - 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MLRTSPPITLPPIQSKPLVHESIRTPSPLWKHTPYARPRSPFIIPGEYMSESQRAPARSPSPERTCDYPVMAPSGVDY # NTISSQNSPDWGRVHGNGNPFLVRIPSHPSSNISRREHSPIHVLPPVPSSTVASGFWPENFQEIRHLMDDEPSFSRDLRRSMAQSTGSGIPAEESSIV # GGREPLLSRPASSNSLSESERSVRSLASILSGIKMPATNPFITAMESKEALIGTPSAPVPPVVSLPSTPSTLNTLNAEFVADRNIVDGQVVAPGAEFL # KAWVMRNGGSRPWPEGTELVFVAGESFAKDNTTIQPQSVGVVQPNEQIELWTGELKAPENPGRYHAYGLFLVSITVSEAFQRDSPETLASSDYLSSSS # IIIMPTAASTPSSAVANNDANRNGAPEGLHRNSSIPGSPVTALSAPSVSDYVETSDNDSETSGSLLDVTDSDSDEELWQDSRTSVLVEGHGAESQATI # RATTLPDEYVVLYDEATSSEEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 Scaffold_7 AUGUSTUS gene 3155043 3156490 0.43 - . g664 Scaffold_7 AUGUSTUS transcript 3155043 3156490 0.43 - . g664.t1 Scaffold_7 AUGUSTUS stop_codon 3155043 3155045 . - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_7 AUGUSTUS CDS 3155043 3155831 0.79 - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_7 AUGUSTUS CDS 3155987 3156490 0.43 - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_7 AUGUSTUS start_codon 3156488 3156490 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MGPSLRVSVSDETPHKLPSSPHTWQPQASNPQKPVVSNPFPVVEPSFGRISYSHIPPPPIIFSSRPCPQEPMDVGKPE # TNDPPTVPQHDIASCCAVAQTRKDVQELITSFKVDLDRVIASLEPSPQNDIPMPLNQVPHYEDSIQLPKIPLQVPPSNVPESSSTLSLPSCVTCLETT # SISDCFFGSPHVWKKQTCSYCAPNSTPTPTPSPLQPASWGSVPLTFGSLLLPSVPTMAPVLREDVAPEMPVPHTVPFALPVGENESARNENGRVVHHG # VSCDSCRSIIEGVRHKCLDCPGWCLQSVRVPKYCPLTLGFIDYDLCSSCIANGAAARHTPFHEFFEISEPGRVVVHNVFSGSGEREAAPPMRHNGSPV # QSSQPVVHNAVCDLCESRIRGDRYVRHLLPQSLCIYSNFYLVEMHQLPGIGTAVVSHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 Scaffold_7 AUGUSTUS gene 3156973 3157281 0.83 + . g665 Scaffold_7 AUGUSTUS transcript 3156973 3157281 0.83 + . g665.t1 Scaffold_7 AUGUSTUS start_codon 3156973 3156975 . + 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_7 AUGUSTUS CDS 3156973 3157281 0.83 + 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_7 AUGUSTUS stop_codon 3157279 3157281 . + 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MVDATNVEDEYDLFDDFSDLTEEQLAQIDAATSSASASTPKSIPHVQVELEGTDISTETCNDPNCDTHRPNESERVSP # LQQFRKNNILSVTDLVSPSWYKNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 Scaffold_7 AUGUSTUS gene 3159814 3160296 0.98 + . g666 Scaffold_7 AUGUSTUS transcript 3159814 3160296 0.98 + . g666.t1 Scaffold_7 AUGUSTUS start_codon 3159814 3159816 . + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_7 AUGUSTUS CDS 3159814 3159890 0.98 + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_7 AUGUSTUS CDS 3159954 3160296 1 + 1 transcript_id "g666.t1"; gene_id "g666"; Scaffold_7 AUGUSTUS stop_codon 3160294 3160296 . + 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MKVTSLAVAHLLIEVRKDIQSSDTRGAYSSIEQPFHDDTPNHHLPSVRLRSKSKPNGIFIHPQHSNLARADAAALQLG # LGGPTERVSGSVYQLKEEASWKTGTGKDVARALLGGSHQQLNTNRHSFDVGSDSDCSDSEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 Scaffold_7 AUGUSTUS gene 3160602 3162012 0.72 - . g667 Scaffold_7 AUGUSTUS transcript 3160602 3162012 0.72 - . g667.t1 Scaffold_7 AUGUSTUS stop_codon 3160602 3160604 . - 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_7 AUGUSTUS CDS 3160602 3161879 0.72 - 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_7 AUGUSTUS CDS 3161950 3162012 0.72 - 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_7 AUGUSTUS start_codon 3162010 3162012 . - 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MDALKATKTPSSSNSISRGNSISSSQNARFVRGCTSTPSRPSQRDWLTGDDISEFSSPATRTVETPQPVLRDSPSKRA # SYIEKSHIPIHQAVAVTPESLPPESPSRRAHRVFPDLETAAEPARTERLTENWSPVTPSAPQQLKESYTSSSADEGPEDVTRSINVSPDTKKRRKGRQ # SSVHDLVDLWGGGGGGGDRVSPEKKRETRKDSARATVTPLPKSEGLSKHRSLATPVIPTTPHQRSISPQLVSSPSPSRPAGNLIGQQSNVTNPPPVKS # NITSPASSSRSRPQSMFIFPSKSTDGYAPPSAGLTPPEVPQTRTARRTSISDMVQRFEAIDAVAKTGIPTASSRIVSQKVPVPVTENKSSSQASALSQ # RDGPINPPSTDTDDTHFPSKNRPTSRATPRPSPNKRYTTSNEPPELATPRAHRISTKADAQIPFPQKRKTYVST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 Scaffold_7 AUGUSTUS gene 3162502 3163320 0.45 - . g668 Scaffold_7 AUGUSTUS transcript 3162502 3163320 0.45 - . g668.t1 Scaffold_7 AUGUSTUS stop_codon 3162502 3162504 . - 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_7 AUGUSTUS CDS 3162502 3163320 0.45 - 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_7 AUGUSTUS start_codon 3163318 3163320 . - 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MPEFISCFIASMLREHGTQRPSVFELLVQVHRLRGTKSQFQYSIPQPQPLAPRIQPQQKSPSLNPVHSTISYRQDPAM # TVTVNGANPSVSPAPSVPRNAGVQARDKVLEAIAPMRRGRPAVSKESSRSSSPTKATETTKEKNWLEDEEKAWQAVTAQSARTSKPQKDVWSVGSDYV # GPKAGQRGFGDDFGEQLWKSSNLNSQVMKPTVSPSPGLKVAERPPLSHRISDQPLKPATRIQEKDAFDGLGLSSNNKPAPTLAEARKLRDRSSYIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 Scaffold_7 AUGUSTUS gene 3173419 3174128 0.49 - . g669 Scaffold_7 AUGUSTUS transcript 3173419 3174128 0.49 - . g669.t1 Scaffold_7 AUGUSTUS stop_codon 3173419 3173421 . - 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_7 AUGUSTUS CDS 3173419 3173840 0.83 - 2 transcript_id "g669.t1"; gene_id "g669"; Scaffold_7 AUGUSTUS CDS 3173888 3174128 0.49 - 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_7 AUGUSTUS start_codon 3174126 3174128 . - 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MPCQALEPQIERMSLKNTPKSDHKSSSELELEQLEANLRTVQLALEILTGVCATLPDPSAGIEGETEIDDEDEDMADD # DEVLDETNIEDPGHNNDSANPTVLPSLVPSLLSLIQPTSLSFPPLATSSIHPPTTTALSAIHISAMECLNNIFLSLATSPNPSVSADAEGGRKVWNEV # WASLGVVGTELGLGQERRKEMWEIGVGVLWGLALVWKGTLVSGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 Scaffold_7 AUGUSTUS gene 3176730 3178265 0.97 - . g670 Scaffold_7 AUGUSTUS transcript 3176730 3178265 0.97 - . g670.t1 Scaffold_7 AUGUSTUS stop_codon 3176730 3176732 . - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_7 AUGUSTUS CDS 3176730 3178265 0.97 - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_7 AUGUSTUS start_codon 3178263 3178265 . - 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MPTADADDSVNTGAVSATTTTSTAAASTTSADDFMDSLPPGWKPIVNHDNTAKTLSISLSLAFFICITMIFCVIWRRG # KRRLKDVEKPVRKSKANSSDDLEVMIEKEVESKRRVLARATARWKANARYTFRQRRGKRRAVPHTEGDADVPPTNTTLTESSPSSPAHSRRSSVDSVL # TPKADSFVDQIPLSTSGERPSLLSPPVSSPPAYLHHSLSSNHHNIAPSGNITPTASYVQSRRTSMSSLTPDVHCINQPAPYTSSHHMAHVATDDKALL # ERLNQLVSAPDVSGLSTRHDTTTFAPVWQDEELSDYTELEEPRRESTSTEPVDNTRHAYQYPSHNGGTMVFPPPPVLSFSLNEKGKGVEVYPYEYSYH # PDRSYGSSFEYEQAILDVEPEAGPSAPPFESTSGVFDTTPSAPPFEPSENHISEHPSAPNLQASDDLNGGFLDEGSTVVETYDQNTLTGKFAVLSEDS # IRPLRTCVSVVSPEESSLDGLLASHNDRDPDGRTFESSPSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 Scaffold_7 AUGUSTUS gene 3179949 3181136 0.62 - . g671 Scaffold_7 AUGUSTUS transcript 3179949 3181136 0.62 - . g671.t1 Scaffold_7 AUGUSTUS stop_codon 3179949 3179951 . - 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_7 AUGUSTUS CDS 3179949 3181136 0.62 - 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_7 AUGUSTUS start_codon 3181134 3181136 . - 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MTRTIALLEPLNERIEAMTADERSLYRLPPGLGGLSKGIYTRIIKKVYGRDNGAEIIQALQECPGVAIPVVLSRLKQK # DDEWRRVHREWSRTWREVDCKNFYKSLDHQGISFKQNDKKAITAKHFVADIESIQARQLEEIDDLNARFQSGDEKGKQKAWTSPFARGSLPAQLEFQI # QDTAVLHDCLKLVYSFLDRSQGQYSVLERRSVEKFLRVFVPTLLMYPVTEFNLACEPQHEGVGTNTGGADDLNGMTESNAMDSSAGSKGGRKVSGQSN # GIVAGDLRKKLLKTAKERRRKREERGGSTSAAVSRAGSPPFLESHRSPLVPASRQEEDPVATVHEDIWIRESSAAGATTMDFINSEESRNGNFERPFF # ANTTFYTLFRLLQVRTSIIAEGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 Scaffold_7 AUGUSTUS gene 3181271 3183161 0.18 - . g672 Scaffold_7 AUGUSTUS transcript 3181271 3183161 0.18 - . g672.t1 Scaffold_7 AUGUSTUS stop_codon 3181271 3181273 . - 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_7 AUGUSTUS CDS 3181271 3181873 0.61 - 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_7 AUGUSTUS CDS 3181926 3182069 0.54 - 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_7 AUGUSTUS CDS 3182193 3183161 0.45 - 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_7 AUGUSTUS start_codon 3183159 3183161 . - 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MPRTPKALTPRPQAEQNIIPGPSSAQSFEMSRPLNVTDALSYLDDVKHQFAEKPEVYNRFLDIMKDFKSQQCVISRLT # IFLTANSYYFLLRIDTPGVIGRVSKLFHGNPPLIQGFNTFLPVGYRIDVSGDPLDPNTITVTTPQGTTTQTTTQSSTAHVPRTISHPPRDIPGFGPNL # AQSFPFPGINTPNGASPLTPLNTISRSMTPQQPFHIPHQSLIFDLPFSPGIQQTQTTAAASLLGNLNNKNLIEKQPQGEEFNHAIQYLNKIKNRYSDD # ANTYKQFLDILQAYQKEQRHLQDVSYFFSSLFIPTDSITVASLRPSTNFPWSNPNDSAPVSPEKASKKPVAPGVKRKKRVIEKEPTPAPPSKPAPGRA # KKPKITHKGDPGSPSFSPFPLPKSPQLPTSHSAPSLPPIQHSQVPSTPSFVPAPPIPTTPSKLKFFDRLKKTLENREIYEEFLKLLGLYSKDIIDVKT # LISRAAVFLGEGDLMDEFKEVLGYDPKQDDVENGPPGSIRTGPPEALAAQPSDDGQGPSYRKLPWSVSHFFFVFLLSLCSLNSFRRCALPVQAAMNFA # VPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 Scaffold_7 AUGUSTUS gene 3186021 3186937 0.46 + . g673 Scaffold_7 AUGUSTUS transcript 3186021 3186937 0.46 + . g673.t1 Scaffold_7 AUGUSTUS start_codon 3186021 3186023 . + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_7 AUGUSTUS CDS 3186021 3186572 0.48 + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_7 AUGUSTUS CDS 3186635 3186937 0.95 + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_7 AUGUSTUS stop_codon 3186935 3186937 . + 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MDAVKAEADRKAHQKEVGLPAFSETQPLTARVDGDNVYAEPYEDRSPLPTTQPGYGRQTTPGAGYTGGGYVQAPVGTR # AVDEYYNPTRDNYTAAAMAPNSYPPQPNPQRQGSSHTYAPSNYAPSAYSNGPSRITSPSNNSQFLAPAFAHDRASSAASAQNYGHTAGGTTCKFYALC # QPLNKSVNPQTDPYGANQPNYNQPAYYANTAPDRSYATGYGANSVPPLPERSGSVPALPEHPPTAGYVPYSTGTPSTSLPGAIPGPQRTTSPQNTRIA # HLCTMQELVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 Scaffold_7 AUGUSTUS gene 3188631 3188972 0.87 - . g674 Scaffold_7 AUGUSTUS transcript 3188631 3188972 0.87 - . g674.t1 Scaffold_7 AUGUSTUS stop_codon 3188631 3188633 . - 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_7 AUGUSTUS CDS 3188631 3188972 0.87 - 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_7 AUGUSTUS start_codon 3188970 3188972 . - 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MSYSTSLLILGILLFSVTSIAHDHSPEQNAFKLEEFQESLKESTWLEKYGPQIDQSFSGPLSFSHLPYTRCLENEETK # FDIAILGMPFDTAVTYRPGFGQLIVILLLRLTLGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 Scaffold_7 AUGUSTUS gene 3189185 3189433 0.4 - . g675 Scaffold_7 AUGUSTUS transcript 3189185 3189433 0.4 - . g675.t1 Scaffold_7 AUGUSTUS stop_codon 3189185 3189187 . - 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_7 AUGUSTUS CDS 3189185 3189433 0.4 - 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_7 AUGUSTUS start_codon 3189431 3189433 . - 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MHAYLAYPSEESPSESSSPHPQPEVHNTNTANTTNSTNSPNEPLPPNEPIRQMEQRIYMLEQMLRHADHAELALYAGS # PPPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 Scaffold_7 AUGUSTUS gene 3190177 3190988 0.39 - . g676 Scaffold_7 AUGUSTUS transcript 3190177 3190988 0.39 - . g676.t1 Scaffold_7 AUGUSTUS stop_codon 3190177 3190179 . - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_7 AUGUSTUS CDS 3190177 3190867 0.97 - 1 transcript_id "g676.t1"; gene_id "g676"; Scaffold_7 AUGUSTUS CDS 3190981 3190988 0.39 - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_7 AUGUSTUS start_codon 3190986 3190988 . - 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MIRHSFITCIRVTATLLAWFTSYPVCLTVQAATTTTTVDDADSSAFTFISAWNAITPSDPCDGCATKLDSTQVLDGTW # HDGSVAGSTASFKFEGTIFDEFLFSCGQFSQAHSVYNPTYHLSGSGVTLYGVTNADQTCALTFVLDGGSPVNLDLSSIPQSPTKVYNYQFFSASGLAS # GSHTLSWTIETSVSNAVALIDYAIVTSDVASSSTSTTSSSGSESSQSQAGTSTSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 Scaffold_7 AUGUSTUS gene 3192593 3192919 0.69 - . g677 Scaffold_7 AUGUSTUS transcript 3192593 3192919 0.69 - . g677.t1 Scaffold_7 AUGUSTUS stop_codon 3192593 3192595 . - 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_7 AUGUSTUS CDS 3192593 3192919 0.69 - 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_7 AUGUSTUS start_codon 3192917 3192919 . - 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MPREFITSNFASPLVSFFQGGTDTHATPEQVASSGVELAEDEVLEEDRGEEAEVDDSLDLKRDVKMLTIAKRNPADDH # TDWNLTEKANLRRKFECVSLRAVNRRTGGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 Scaffold_7 AUGUSTUS gene 3195319 3196072 0.39 + . g678 Scaffold_7 AUGUSTUS transcript 3195319 3196072 0.39 + . g678.t1 Scaffold_7 AUGUSTUS start_codon 3195319 3195321 . + 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_7 AUGUSTUS CDS 3195319 3195350 0.39 + 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_7 AUGUSTUS CDS 3195475 3196072 0.41 + 1 transcript_id "g678.t1"; gene_id "g678"; Scaffold_7 AUGUSTUS stop_codon 3196070 3196072 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MGVPDDEAREKILRVLSSKLRLEGNFDFTALAKATPGYVGADLSSLTAAAGINAVKRIFKQLGDIPLNGIPDVALPVI # TTVVEEGEEVATAEVEMSTDESNEVMMQIDIDQPVEGGDAVASQPEPESSSLSSSSKSNISFPPTFGPIALFLNAHPTPLTPSQLSPLCITSSDFHLA # LTQIQPSSKREGFATVPDVTWSDVGALHTSGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 Scaffold_7 AUGUSTUS gene 3196486 3197055 0.61 + . g679 Scaffold_7 AUGUSTUS transcript 3196486 3197055 0.61 + . g679.t1 Scaffold_7 AUGUSTUS start_codon 3196486 3196488 . + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_7 AUGUSTUS CDS 3196486 3197055 0.61 + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_7 AUGUSTUS stop_codon 3197053 3197055 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MIDPAMVRPGRLDKLLYVDLPTGEERVEIVRTLVRGVPLEVGGNISGAPRLDEADITAGEGLNSGGSRERALGFIEDF # IRGGKCDGYSGADLKALVREAGVIALKRTLGLLNNLGMKGVLAEPVTSPTVFVQDTDFIQAQEKVYPSVSLAQRRKYEILRSKMSGLPVLPARVGRVE # NEGDGNGGNGSLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 Scaffold_7 AUGUSTUS gene 3202450 3204081 0.53 - . g680 Scaffold_7 AUGUSTUS transcript 3202450 3204081 0.53 - . g680.t1 Scaffold_7 AUGUSTUS stop_codon 3202450 3202452 . - 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_7 AUGUSTUS CDS 3202450 3203393 0.6 - 2 transcript_id "g680.t1"; gene_id "g680"; Scaffold_7 AUGUSTUS CDS 3203518 3204013 0.59 - 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_7 AUGUSTUS CDS 3204064 3204081 0.89 - 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_7 AUGUSTUS start_codon 3204079 3204081 . - 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MSETPKADAILNNNRAARNEVSLLAISELLDVEEDIWSPTYGLKGKLDATVQTTISQKTDPARLSFSKITPTQGPKPL # EIKTGRATSGMEHRAQTMLYTLLAQERYGIDVTSGLLYYTQSDEIVQVPASRNELRGLIIGRNELAMYMMRRQKNSTEPFLPPTIDDERTCKRYAYSL # RTSHLTPSQTAFFKNWEHLLSLEEQDVGRFRKELWTMGAAQREQHGRCFGSMILDSSFVPPPVKRPGARDKIHTYTYRFIRDPKSVSTGSFLNGFLDV # NDAVTISVEPHLLALARGFILELTSTDVVVGVDHDLSLDIISSRLAVFESSKVFTTNPVIFRIDKDEMLGGMSRIRDNLAQLFYADGDARKLKQIVDL # EEPRFDDTSSINIPPSAAHHLAHLNPNQGQAVDKILSAQDYALVLGMPGTGKTTVIAAMIQALVAMNKTVLLTSYTHSAVDTILAKLKDTDFTILRLG # NIDKVLIHHMVMYLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 Scaffold_7 AUGUSTUS gene 3208030 3208579 0.66 + . g681 Scaffold_7 AUGUSTUS transcript 3208030 3208579 0.66 + . g681.t1 Scaffold_7 AUGUSTUS start_codon 3208030 3208032 . + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_7 AUGUSTUS CDS 3208030 3208332 0.68 + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_7 AUGUSTUS CDS 3208442 3208579 0.94 + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_7 AUGUSTUS stop_codon 3208577 3208579 . + 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MGDSRIYAATAMANLLSADHDLDLEGELGTDDEEDADYLDEDEDEVMEDDGDEYYATPRTVFTYPPATTPQAAGVHLI # KSGEFGRVGPKIKARKNNRNLAANIVPNSNGVIVANYDANIYTAQYSNGKTLILTWYHEQLIADPEFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 Scaffold_7 AUGUSTUS gene 3210684 3211667 0.46 + . g682 Scaffold_7 AUGUSTUS transcript 3210684 3211667 0.46 + . g682.t1 Scaffold_7 AUGUSTUS start_codon 3210684 3210686 . + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_7 AUGUSTUS CDS 3210684 3210887 0.49 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_7 AUGUSTUS CDS 3210966 3211205 0.97 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_7 AUGUSTUS CDS 3211623 3211667 0.96 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_7 AUGUSTUS stop_codon 3211665 3211667 . + 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MVSFFAAVYLQELLELFVVDFVRIQMKEWLDWRFGTRMTFAKLMANDEFYRVTPISQPLTPPSSSPMTADKIVALTTA # AGVELEPIWASLLAKALEGKNVKDLLSNVGGGGGAPAAVAPSAGGAGAAAAEAPKEEEKEEEKEESDDDMHFDPQAQLQARSQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 Scaffold_7 AUGUSTUS gene 3213523 3213798 0.79 + . g683 Scaffold_7 AUGUSTUS transcript 3213523 3213798 0.79 + . g683.t1 Scaffold_7 AUGUSTUS start_codon 3213523 3213525 . + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_7 AUGUSTUS CDS 3213523 3213798 0.79 + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_7 AUGUSTUS stop_codon 3213796 3213798 . + 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MIPRNLLISSRSSSAATALFHTSARRAAAQPKHTSETYNKDDSDMSPPPDSKIHRVDPNSDSQKPHEVSSYLREGLLD # TYQSLVLGSFRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 Scaffold_7 AUGUSTUS gene 3216203 3217242 0.89 + . g684 Scaffold_7 AUGUSTUS transcript 3216203 3217242 0.89 + . g684.t1 Scaffold_7 AUGUSTUS start_codon 3216203 3216205 . + 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_7 AUGUSTUS CDS 3216203 3216320 0.9 + 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_7 AUGUSTUS CDS 3216374 3217242 0.98 + 2 transcript_id "g684.t1"; gene_id "g684"; Scaffold_7 AUGUSTUS stop_codon 3217240 3217242 . + 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MVAKKLETKIRDALITASRSHSSSLFSQDATGLSNLQRPLLLILDRNVDLVSTISHGWTYQALVSDCLEIKLNRVVVT # EPQKRTYDLDAKDFFWARNAANPFPSVAEDIDTELTKYKQDAAEITRSTGVSDVNDIAQLDLSTNAAHLKTAITQLPELTARKATLDTHMNIATALLE # QIKKRGLDELFSTEEAIGKQVCNSLFVGYTHCSDNFVSSKTTQTILEILRSSRTDGNFTPLDKLRLVLVFYLSSPDISKDDVAELEKELKSAGAEVAA # FDYVRRTREISKMAVSNTLGGTSTPVAGAVGQGAQLFTGFSVFGNKVSILDVAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 Scaffold_7 AUGUSTUS gene 3223621 3225165 0.6 + . g685 Scaffold_7 AUGUSTUS transcript 3223621 3225165 0.6 + . g685.t1 Scaffold_7 AUGUSTUS start_codon 3223621 3223623 . + 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_7 AUGUSTUS CDS 3223621 3224141 0.6 + 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_7 AUGUSTUS CDS 3224184 3225165 0.67 + 1 transcript_id "g685.t1"; gene_id "g685"; Scaffold_7 AUGUSTUS stop_codon 3225163 3225165 . + 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MAWLSARKAPGFVGWGEKHLKDFILRTGLSSSLDRNGNGGNGNGSRSATQHRITSRNSEREPLDDSEKANLEVDIQSL # FSIWYVLRFQFDAIDFNLIIYTISDTQAIALLIEERDEILENLEIAETRYINSFRLTTPDPSLADWEPPAPEDSSRPYISRPRPLGLNKSVFSFPVRG # KRSKNPAFAASSLAPTSFVAPSQYYRLKGVSGVSGGRFADSLYGKDPSFSESLNSRTGGSHFQETVTNRDSNAYGRLLLGSQVRLDEGGAFVPVTGAG # SSTSLPYPDPRRYGPNHALESSNENDQDGLRTLEEEPEWMELSEATPDIASVDNGAAPAGPSSFKRPQPEKVPSVRRETFPFRNKSNTAADAVPPPHL # RLQPSQPYVRPMEGINYEALGNIYSSITEWRSKLKAINLEISNAQRDSYNDIADGARIKGWLLIGRGLRFIPGVELIEGRAKEDIRWDVLQNERTMLD # SAAMWVCTFLAAIVVATGCTKNPYLPEGRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 Scaffold_7 AUGUSTUS gene 3244030 3244641 0.5 - . g686 Scaffold_7 AUGUSTUS transcript 3244030 3244641 0.5 - . g686.t1 Scaffold_7 AUGUSTUS stop_codon 3244030 3244032 . - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_7 AUGUSTUS CDS 3244030 3244641 0.5 - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_7 AUGUSTUS start_codon 3244639 3244641 . - 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MGFPSFPSFPPNLPPPPPPPMSQPPPGFFPRREKSTSAMQDPLSSIPHQTYQAHRANHLAGHPSLPAKPGSVGPPRAS # TQISSTALTAAATISAEPQLRDLKKEATAFVPSALKRKRGGASSASTSKVNAAPGVGNDDDNTDSSNALAPVRPDLLVLSEIKFGPALAVANSEEPRK # KPKVEPVKKNDDYERFVEEIGDILNPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 Scaffold_7 AUGUSTUS gene 3246858 3247856 0.27 + . g687 Scaffold_7 AUGUSTUS transcript 3246858 3247856 0.27 + . g687.t1 Scaffold_7 AUGUSTUS start_codon 3246858 3246860 . + 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_7 AUGUSTUS CDS 3246858 3247856 0.27 + 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_7 AUGUSTUS stop_codon 3247854 3247856 . + 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MSMRLVQRPQITTLALPRSLTWPSDLLPPHQAPFHFLPDVFDFSKFMLATPSQLIADLTGDLDELIVERRILAGMNDD # LGVWFIDAAQQKVQNQIDKASALDTPFLRNQIEKAHKDYQEIQKRAKLDERTRQVEGNHDSNASDVPQEFLALKTSNLIQSPPISNSNSHNPRSAPKQ # RRNVNPPPPSTSTYYYYQAASGLPLYLHPLDIRILLSHFGEYASFPDNITIRVDAFSEGTVNDDLRKRCKYLAHLPEGADVIFVEADLEGAVGVEGLK # NFEHALKMRKSRRKEKSRKDDRARARAEEREGQRDTTSYIPLGKRHRVDWSYPPNLLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 Scaffold_7 AUGUSTUS gene 3250595 3251230 1 - . g688 Scaffold_7 AUGUSTUS transcript 3250595 3251230 1 - . g688.t1 Scaffold_7 AUGUSTUS stop_codon 3250595 3250597 . - 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_7 AUGUSTUS CDS 3250595 3251230 1 - 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_7 AUGUSTUS start_codon 3251228 3251230 . - 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MHRFQISVFGAVAIVFAVNGVQAGIFTGIGSLDAMSVGWLILAMVDIVWVLYFTSEEDSLALHIFNSMGTGGLTPPSR # RRRTRAQSVHNVTNGYGGYASGGGIGAHDVPYNGKMVSGMGSGTLASPIGMGNTALRSTKSFEPSPDAATRSLGGGSITNVPGGGGPGSSSGGDNGPS # SPLMAGAGASAPQATPTDPAVAEYIYKAKALYTCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 Scaffold_7 AUGUSTUS gene 3254822 3256684 0.68 + . g689 Scaffold_7 AUGUSTUS transcript 3254822 3256684 0.68 + . g689.t1 Scaffold_7 AUGUSTUS start_codon 3254822 3254824 . + 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_7 AUGUSTUS CDS 3254822 3255089 0.68 + 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_7 AUGUSTUS CDS 3255150 3256684 1 + 2 transcript_id "g689.t1"; gene_id "g689"; Scaffold_7 AUGUSTUS stop_codon 3256682 3256684 . + 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MVGIFNDPIANGVCLMFNFFFAVDHGKSTLTDSLVSKAGIIASAKAGDMRFTDTREDEKERGITIKSTAISMYFEVDK # EELPSIKQKTDGNEFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALTERIKPVVIINKVDRALLELQVDKESLYQSFQRT # VESVNVIVSTYHDEALGDVQVYPDRGTVAFGSGLHGWAFTLRQFATRYAKKFGVDKEKMMAKLWGDNFFNPKTKKWSNKNTDADGKPLERAFNSFVLD # PIFKIFDAVMNFKKDAIGPMLEKLDIKLAQDERDLEGKALLKVVMRKFLPAGDSMLEMIVINLPSPATAQRYRVETLYEGPMDDESAIGIRDCDPKGP # LVLYVSKMVPTSDKGRFYAFGRVFSGTVRSGPKIRIQGPNYLPGKKDDLFVKSIQRTVLMMGRYIEPIEDCPAGNIVGLVGIDQFLLKNGTLTTSETA # HNMKVMRFSVSPVVQVSVEVKNAADLPKLVEGLKRLSKSDPCVQAWISETGEHIVAGAGELHLEICLKVQHNSILHTPDTNNVISRIFKKTMLASPSK # SLNLSYLTVKLSRPNPPLLLCPNHRTNTIVFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 Scaffold_7 AUGUSTUS gene 3258827 3259219 0.9 + . g690 Scaffold_7 AUGUSTUS transcript 3258827 3259219 0.9 + . g690.t1 Scaffold_7 AUGUSTUS start_codon 3258827 3258829 . + 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_7 AUGUSTUS CDS 3258827 3259219 0.9 + 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_7 AUGUSTUS stop_codon 3259217 3259219 . + 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MGDFWPGNILLSFDSHTGVVKKINVIDWELSKTGLPGLDLGQFTAEVDLLRRFCPSFKTAGTKMLSAFYGSYSAEEDI # TRMAMFHWGAHLIAWTPRVPWGSSEETREMVAKGIKLIVAGPKKLIYDLLRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 Scaffold_7 AUGUSTUS gene 3259821 3260207 0.62 + . g691 Scaffold_7 AUGUSTUS transcript 3259821 3260207 0.62 + . g691.t1 Scaffold_7 AUGUSTUS start_codon 3259821 3259823 . + 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_7 AUGUSTUS CDS 3259821 3260207 0.62 + 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_7 AUGUSTUS stop_codon 3260205 3260207 . + 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MTHSASGPTVSLEEAQRIERETARRLLKDRKLSLIVDLDQTIVHATVDPTVGEWIAEGEAWEARRAAKGSEDNHDPDD # HCNPNWDALKDVKKFRLGPETLGSASRAKGKLLSNKGVENDGCIYYIKPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 Scaffold_7 AUGUSTUS gene 3260818 3262515 0.36 + . g692 Scaffold_7 AUGUSTUS transcript 3260818 3262515 0.36 + . g692.t1 Scaffold_7 AUGUSTUS start_codon 3260818 3260820 . + 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_7 AUGUSTUS CDS 3260818 3261555 0.49 + 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_7 AUGUSTUS CDS 3261627 3262066 0.54 + 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_7 AUGUSTUS CDS 3262116 3262515 0.98 + 1 transcript_id "g692.t1"; gene_id "g692"; Scaffold_7 AUGUSTUS stop_codon 3262513 3262515 . + 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MLSKNSETLNAQVQERPLAKMQEELKQFTAADGSLSKTETISSDKPGVEEKQPKEVENGNEKEQDSKKDQQKKSEDKM # DSHDTDSKQLTKPEKAPPRKALLENNDTELIRVNEVQFQTSFFQLYSNRDDLCQILSEIHYKFYNAYDAHSKKSGDPPQKRKSGSSKSNKPLYDVTVG # PINIGYLYVLIFVAQRIIPEIRANVLQGVNLLFSSVIPLDTRPESTEIWRMALMFGAKCSTELSPDTTHVRGTVKVDAARRRGNIKVVWLQWFTDSVA # LWQRQDETRYLLDLPPAAGPSTSPPTASSDLDIDIDDEDWDLDSPPTSGGVALGVSQNAGFHANEINWNDINDEVEAAMMESDDEEEEEANSVKSDRS # GIRSENVSEEEWSDESNSVASTNNTPKSKRKRLRSLTPSETPGINGDADGLRSPLSKRKKVAADRSKMSKLKVAIHADDLRADNLRRTASREPSASPV # VRVAGSRANSPENDSDMEEVTGPLGDEGENENYDESGAESAEEDFLAKEMENEWG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 Scaffold_7 AUGUSTUS gene 3263374 3265186 0.43 - . g693 Scaffold_7 AUGUSTUS transcript 3263374 3265186 0.43 - . g693.t1 Scaffold_7 AUGUSTUS stop_codon 3263374 3263376 . - 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_7 AUGUSTUS CDS 3263374 3263813 0.66 - 2 transcript_id "g693.t1"; gene_id "g693"; Scaffold_7 AUGUSTUS CDS 3264445 3265186 0.43 - 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_7 AUGUSTUS start_codon 3265184 3265186 . - 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MAPNGSPTKLSQDVRQTMTAIQAMQKHAAKYGHNGVILLTRVLRLRQLVSSGLWDQVSEALAETEEALELEFSSEQDP # STDQPAGQSLRKGLRVTDLNTVHMNPPSPTKHSINTKPSDTTEVRPSSESASAPAPPLKMFNTYFERSMALHTLIIGVVFCTYVGRVSDASQRLAHLH # ALLDAGALRFDKKPSNPVSTSTITSPEASPSADGSNSANTTNIEATLQETRKAMTLRAELCELPCLDRRCLSRAGRACLKIGLIRDKECSKKEREEEA # KQTKRKTRAKSRERKVGDENAMEVDEDAAVVEPETPVEEFEDVQKLAEDVVEACRGMGGTMWSVGRVIEACLTDEILKSKFDIFSCSSCFQLNCGFGT # GNTSSLPYHSRLRQAIITSVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 Scaffold_7 AUGUSTUS gene 3273036 3276064 0.54 - . g694 Scaffold_7 AUGUSTUS transcript 3273036 3276064 0.54 - . g694.t1 Scaffold_7 AUGUSTUS stop_codon 3273036 3273038 . - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_7 AUGUSTUS CDS 3273036 3275389 0.55 - 2 transcript_id "g694.t1"; gene_id "g694"; Scaffold_7 AUGUSTUS CDS 3275470 3276064 0.54 - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_7 AUGUSTUS start_codon 3276062 3276064 . - 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MTFKIQPLHEPTDILYNKILASALSEEEALKQYYGDFYYANDPVTVYTDGSCLGGGTDSAQAGAGICYGLNSRRNQSV # RVPGPGRQTNNRAESYSVYLVLFEMDPKRPLIIYTDSEYIIRQCCYWAGRHLATGWNIPNGDILKDIALLLKERAASTRFVWVKGHSGNQNNDEADNL # AKKGATMDLPGNYRPLKEVPWKSGVEDVRQGEVSHRGRSKVAKIQEDNLKKLQNCKTIAQFWSLYINWMDGKAKEMEVTMEQLLREFRSRMQSPVIIP # PNLDAKYLALWKQWEAMIPEKNVDTTEQKFFSRAIQEEEIEEAKAHIAMKNLDSSVGVDQVDYKLIMKIPNENCVKLLNHCIENRTAPSAWLVALVVG # ILKRGKEADDPSSYRLVVLECCFLKMLTLIIDRRLREYAEHQDLLPSTQNGFRPGYRTTNNPFILKTMVDTAKAIGKPLYVAYMDWTHAFPLTNRPMM # WMKLNKMGIRGPLIDWLRLMYQKLGNVVQVADSFSEAFTSNIGAWTGDPGTPMLFNLAIADFRLSEHPGDVVLYDKVVNHTEQADDVLMTTMCPTSFQ # SKLNQFGEYSAQTGFIASVPKCVYAVYGKEETEGLPFTLYGKRLKKKKEMKYMGIWHQTTGVDMYQQQYKESAEKAKKTAGAVLHAKVFVGKNIPIWD # LWLLYMGRVDPYLKNGAEVIVDIYDVRRKQLESVQHYFIRRMLGLNDKSMVALLFSETGLWPIRYRRIILFLKNLKYLVQLKRDHLAWKACRQAYELA # EQGKNSVFMEMVQVLDRLPHRVVWNIPRFKDLTVQHIDGVMERVKKSMEKDIQEKVDTSNKTRDVLRDRREYDKKTKKMVIKTMAFRHYLRIPIGEHR # RSLIDMVTSNHKLAVERLRWAERNKPMVQHDKRLCRMCREKVEDGAHVLFECSNSCKVIQLRKAFMQRVIQEIPHFARHYGDGWELFRELLADKRVVG # LLAKYVHEVLEVFYAVEIYRLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 Scaffold_7 AUGUSTUS gene 3281423 3281794 0.75 - . g695 Scaffold_7 AUGUSTUS transcript 3281423 3281794 0.75 - . g695.t1 Scaffold_7 AUGUSTUS stop_codon 3281423 3281425 . - 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_7 AUGUSTUS CDS 3281423 3281794 0.75 - 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_7 AUGUSTUS start_codon 3281792 3281794 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MLMRCVDDVWFGFIPWSFIHSQYVLRLRRAVLHPNLVFTKNDERALSPSGDGIVDVNEMIKKFAENEEQSNVFAETVL # ADLDDQAEGASECPICLDVMEIPMIVPECLHRWCVAYHTKLKGEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 Scaffold_7 AUGUSTUS gene 3284194 3284952 0.99 - . g696 Scaffold_7 AUGUSTUS transcript 3284194 3284952 0.99 - . g696.t1 Scaffold_7 AUGUSTUS stop_codon 3284194 3284196 . - 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_7 AUGUSTUS CDS 3284194 3284952 0.99 - 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_7 AUGUSTUS start_codon 3284950 3284952 . - 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MTDSDEPPALFFAGSDDEDAEMAVESTELKATESSISSQVEHRQLFLPTDSDDEEEDIPIIPQKRGSSPDIHHEDIDE # MDLDTIDIPRATSVSASSMSEYISISSDSEEEAVTRPMKNKKQVSPPAKKRRLSPSFALPSPTDIIQFPIYVGEFLVPNAWSSISGSGYVTTNDNVRI # ERDVDYSKTSEVSTKRKGKGKEKANEKNGGKKQVSIKSMINAQPVKAPNKRTTDTIVRLVTTRGVGRRALIIPLPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 Scaffold_7 AUGUSTUS gene 3286551 3286943 0.54 + . g697 Scaffold_7 AUGUSTUS transcript 3286551 3286943 0.54 + . g697.t1 Scaffold_7 AUGUSTUS start_codon 3286551 3286553 . + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_7 AUGUSTUS CDS 3286551 3286943 0.54 + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_7 AUGUSTUS stop_codon 3286941 3286943 . + 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MDISAHIRKHALEIPGKLQLIMTAFAKALEIIPRQICDNAGLDSTDILNKLRMKHAQGEKWFGVDVDGASGVRDNMDA # FVWEPALVKLNAISSAAEAASLILSVDETVRNPQSEQVCETTCPHGSELTFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 Scaffold_7 AUGUSTUS gene 3293161 3294519 0.28 - . g698 Scaffold_7 AUGUSTUS transcript 3293161 3294519 0.28 - . g698.t1 Scaffold_7 AUGUSTUS stop_codon 3293161 3293163 . - 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_7 AUGUSTUS CDS 3293161 3293947 0.7 - 1 transcript_id "g698.t1"; gene_id "g698"; Scaffold_7 AUGUSTUS CDS 3294212 3294519 0.3 - 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_7 AUGUSTUS start_codon 3294517 3294519 . - 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MPEVYVQSFTHLKDRKSADKALEMLRRVASLVKPIMRKHSWVLPVLAEFFPDNPNLLGEDYAFHVCQAKFMQTGRFEC # VPNSFARILGGSLTKPDVNMGIRYXLGTNISHNIPPHLARAQAVAAAEKRRNLSQTLGGGGRRLGGGTEDRALSLRERAKRVSIIYIPSVAIASCSSF # FQAAERRLLDERSCGQGEFAQREADKAAKESVGNKVIDLTLDSDDEPDVPTVHNASAPGPSKIAVQPPKPVSPSSLPPRTNRAAPSSSSLRTGSQSKP # PPFVNLTTKPLRDRWECPACTLMNAAMSLQCEACLATKPSSELAGWTCLTCGESGCLMSSGLAHFVYYQSSELDSLFILRIHIIVENIYM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 Scaffold_7 AUGUSTUS gene 3296087 3297427 0.4 - . g699 Scaffold_7 AUGUSTUS transcript 3296087 3297427 0.4 - . g699.t1 Scaffold_7 AUGUSTUS stop_codon 3296087 3296089 . - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_7 AUGUSTUS CDS 3296087 3297427 0.4 - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_7 AUGUSTUS start_codon 3297425 3297427 . - 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MLTLHGLKRVSLDSTWLMLYFLKFAITNDFISSAETCASFFISSVICFSYVFPSIRYPLPFPHSSFDLIRVANLSLAI # PTERWNFVLSEIHRVLQVGGRLELIDDAFCFPYGKETVTPSPRVRTFATAPNRRRRSSSKQKSSAFDLSDDDDDDYDAGSSIDDHHTGDGIKDGQGQL # GENSGDIEAQDQGTSLDVDSVEQPSPTVDDGSSDCPSSPETAGDGLFLDVEDYQSSTSSLHDLDQEDSKLSSLDPLSFPTSRQSVRPLPPPRRPLPPL # PTSPSFMNTTFTPPAKPCDDEDNLVTPTKLDITLPTPALVLNSAELSNSFPESPEEEQNVVPSPETPLSIPANPPSDEDTSEWANSANDGKALEAIFY # NMLETKYGIHTRTPKGVTTFMKDIFGPDNVRKLRSMHLKLAPSELEELIPHTKRPKFRVRSLSKGTELDTRPRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 Scaffold_7 AUGUSTUS gene 3297619 3298311 0.52 - . g700 Scaffold_7 AUGUSTUS transcript 3297619 3298311 0.52 - . g700.t1 Scaffold_7 AUGUSTUS stop_codon 3297619 3297621 . - 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_7 AUGUSTUS CDS 3297619 3298311 0.52 - 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_7 AUGUSTUS start_codon 3298309 3298311 . - 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MAASTTSNNSLDHFLSPLPPSTISSLSPRPQNLAAHYRPISTIIYPPADSAAVLDLSPPKSRRTSALNRPLSTAFHTM # GFLKSTKSKGKEKEERPIMLQKDSFFNRTLKPKKSLNSLMVLHEEIPHLSSTPPALYTPSLSSTFAESSTAGYSNASTPTATSASASSSSTLTPVTGS # SENSSVVLDDYEYTHGDKYEAKENWITRKHRLKLHPYGADAPYMQSYDSVSLSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 Scaffold_7 AUGUSTUS gene 3301499 3301936 0.3 - . g701 Scaffold_7 AUGUSTUS transcript 3301499 3301936 0.3 - . g701.t1 Scaffold_7 AUGUSTUS stop_codon 3301499 3301501 . - 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_7 AUGUSTUS CDS 3301499 3301936 0.3 - 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_7 AUGUSTUS start_codon 3301934 3301936 . - 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MAHDKEGEMKNDQIAQQGRLETTRGMEQMSGRPRNVNTTANYDTTTADPSLANHTATNPATSDYPQHHRDNEVYNDSQ # ANAVRNPGSNAPSQSGYNTSGGVQPSGNAGYGIQRGNEYGGAGVDNANVNPSYNSDNAQYDTGNPRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 Scaffold_7 AUGUSTUS gene 3302487 3303755 0.28 - . g702 Scaffold_7 AUGUSTUS transcript 3302487 3303755 0.28 - . g702.t1 Scaffold_7 AUGUSTUS stop_codon 3302487 3302489 . - 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_7 AUGUSTUS CDS 3302487 3303755 0.28 - 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_7 AUGUSTUS start_codon 3303753 3303755 . - 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MYCPRVTKLDMNRCHNMDAEGVKRLAAAVKARGELLQLTELRISGIKNIDDSTMSLLGQVAPFLEVLDLSYARHLHNS # ALDAFVALDDDEEAYKSVLLTAREAGRDPSDFRRYRRRITRLRHLSLSSCMLLTDIACSHLAYTIPRLEFLELGGIGEELGDDGLIRLLNTTPLIRRL # DLEDASEITDAVLDAITPTSSSTSSSQQPAELEPGHALEHLVISYAAGVTDDALLALVQACTNLKVLEADNTRMGASVLRKFCELQRPGSKIVAVDCR # SITESAVKELAPLVRPRRGWRGYDARKLRFLDGRDFGVNSKERDKEKEAIMKVALGQDELDEKRVVLKTFYSWQTVDAVWSARDKRRKGISRRKANES # LDSDTEDIEGGIRVGGTRWWTPGGRRSRSASGSNSPLIITDPTADTCVIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 Scaffold_7 AUGUSTUS gene 3304160 3305464 0.57 - . g703 Scaffold_7 AUGUSTUS transcript 3304160 3305464 0.57 - . g703.t1 Scaffold_7 AUGUSTUS stop_codon 3304160 3304162 . - 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_7 AUGUSTUS CDS 3304160 3305464 0.57 - 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_7 AUGUSTUS start_codon 3305462 3305464 . - 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MSTTHGFGDEAFLQFDPYEGPDSVVVSPTMNLLSSDIDSLVLDDNDSSILIKGSEVAAGSDDPRDKGKKALRSLPIMI # APLATDLDDFVMSPTWSACSSYPNTPDAMSALSSPEASGSSSFPSFSLGSFSTVWASSVSASNSDELGGLSVDRSVVDLQDRKGKGKAAWDDEIPSTS # PPLPLSPVVVHGFPSQVASSSSSNEPLIEQSSASVEFSVAQSASSFSSIHRVLPPSRRHSFSHSHTLIRSKHPSSLTRLKAKFSSPNRTHTRRVLSKK # IITPPAQLAIPQLTPASNVHVHSPASLSLEVELPLEHDEALANYASVHTVLKAKGRSYSSPLPISALDYIPAPPEDLFVPIVRASRNLFDEVLPKELK # LEVLLSLVAIHENDRRKVLGHADWSVTKSISSKNRWLGKDRAVRELVKLSRVSKLLRLSYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 Scaffold_7 AUGUSTUS gene 3314175 3315504 0.05 - . g704 Scaffold_7 AUGUSTUS transcript 3314175 3315504 0.05 - . g704.t1 Scaffold_7 AUGUSTUS stop_codon 3314175 3314177 . - 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_7 AUGUSTUS CDS 3314175 3314857 0.33 - 2 transcript_id "g704.t1"; gene_id "g704"; Scaffold_7 AUGUSTUS CDS 3315177 3315504 0.23 - 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_7 AUGUSTUS start_codon 3315502 3315504 . - 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MSWQDDHVESPFPAALLASSIRRTSGHSNADISVLELETPRKRRSSLSSTASTVHMTSPLSPERDGYASPAEEEHAYP # RSQQQKEVYHGLVARATEDTTLAVIPAEAFRLTSSPASVSSKSLSNEGVPKSTEETNSVKKVNLADSSRPALPKKSTSTSTSFPFKSHNSRHAVQAGD # LLTSTDNPDEPLHRGPINRSNSVVNTPYPTRKTLSFIENRRAANMSGDDFDLREEVMSCIAKSIGLLQPPISGGESGEASPAVKATDDFRSGSDRLFT # SFSSLSLLDLNDDVSSATGGSSTLPSPGGYMVGLDNEVEILFFAAGSTLVKAGEMNKGALSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 Scaffold_7 AUGUSTUS gene 3319924 3320631 0.78 - . g705 Scaffold_7 AUGUSTUS transcript 3319924 3320631 0.78 - . g705.t1 Scaffold_7 AUGUSTUS stop_codon 3319924 3319926 . - 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_7 AUGUSTUS CDS 3319924 3320631 0.78 - 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_7 AUGUSTUS start_codon 3320629 3320631 . - 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MLALLKRMADSELTVSALLEARYVPSKGQGIEQWMWEESEIEWEKGTGGKLERAPPLYEYFKKLSKQSEAFLAGASRL # METEENPEEIIRAISLCGDIIAARDDIERAISVLGVSSDTNFSSKEDKDTSKGKGKADSVELEQAYSLACERLAFRHIPLDSSDSGKGKATGLHYDTF # NYATAVTSSQNGTRNPKDRLHLVKELAVLATSLPPGIWVRVDEVRNDVMYVSLHLQGST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 Scaffold_7 AUGUSTUS gene 3321277 3321804 0.55 - . g706 Scaffold_7 AUGUSTUS transcript 3321277 3321804 0.55 - . g706.t1 Scaffold_7 AUGUSTUS stop_codon 3321277 3321279 . - 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_7 AUGUSTUS CDS 3321277 3321804 0.55 - 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_7 AUGUSTUS start_codon 3321802 3321804 . - 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MPSQNDKRDLSPSREAVQNSKKRIHLSSPEPIIIDDDSDDDDDLTEILAQIKQQEDSEKLAKQLQDQYATGSSSGNAI # LIEDDPDEQLFMRLASNRVAADAIEQTSEAVPPESSGKPRMKSQMSLRFLAQGKTPTESLSPYRIVFTAERPCTKCGETVKSPRGYVCPCSSEHLPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 Scaffold_7 AUGUSTUS gene 3327125 3328254 0.67 + . g707 Scaffold_7 AUGUSTUS transcript 3327125 3328254 0.67 + . g707.t1 Scaffold_7 AUGUSTUS start_codon 3327125 3327127 . + 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_7 AUGUSTUS CDS 3327125 3327309 0.82 + 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_7 AUGUSTUS CDS 3327390 3328254 0.8 + 1 transcript_id "g707.t1"; gene_id "g707"; Scaffold_7 AUGUSTUS stop_codon 3328252 3328254 . + 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MSSVKRRKRPRKKVTPVITPADRLEAFMDKLSMWQLMGDLDDSNEKERVTVNPKDELDWTQRFRLTLPNFCDLLRSKV # FPNSPFSDDEDEQQEQTHESQQTSTESASLSPEPPLKRNRTATSDGASDPQARYPSPALSTTSTSFVREPKRAPSHQRSRQRPALQRDRSRSLSVSLA # EEAEERQKAKTTGSGANKGRVLSREVSMSFKSKSKAPEIKHIAAAPSFLESDTRRREPETRPIKREPSMNDAATVLVEATPMKPIRTVSLSQTRTQGP # SLATTLFPRMPSMLSSVNEEEIWNPPGSSSPDVLSLTPTKDAGSTGSTEGHFMDGMEGDWPVSTPTRAGRRREYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 Scaffold_7 AUGUSTUS gene 3330835 3332418 0.33 - . g708 Scaffold_7 AUGUSTUS transcript 3330835 3332418 0.33 - . g708.t1 Scaffold_7 AUGUSTUS stop_codon 3330835 3330837 . - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_7 AUGUSTUS CDS 3330835 3330952 0.6 - 1 transcript_id "g708.t1"; gene_id "g708"; Scaffold_7 AUGUSTUS CDS 3331507 3331819 0.55 - 2 transcript_id "g708.t1"; gene_id "g708"; Scaffold_7 AUGUSTUS CDS 3331863 3332418 0.5 - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_7 AUGUSTUS start_codon 3332416 3332418 . - 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MLRRTSQHFPGGSLNFERFETDNIHECVEFIQSLIERSAKVNDVSIEDMRKSVKIMATGGGAHKFYELFKDTLCVEVR # REDEMECLIEGLKFITLIPDEAYYFSDELIQSVSHPLPSASAQPSLLPPTGSNGILERPLERPGPNPPKFAVTFESNPTFQLPCLLVNIGSGVSIIKV # DEDGQFERVIFLPQLLLLTVRHPHGYALFIQSMELIHNLCEMLKLSEQGDNATVDMLVGDIYGQDYSKLGLKSTMIASSFGKVFKKGKGKGTFSPEDI # SKSLLYAVSNNIGQIARPQYSRNLKAWLHPALIPQLPESTGVIELKRDLSDAHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 Scaffold_7 AUGUSTUS gene 3334092 3335209 0.36 - . g709 Scaffold_7 AUGUSTUS transcript 3334092 3335209 0.36 - . g709.t1 Scaffold_7 AUGUSTUS stop_codon 3334092 3334094 . - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_7 AUGUSTUS CDS 3334092 3334876 0.4 - 2 transcript_id "g709.t1"; gene_id "g709"; Scaffold_7 AUGUSTUS CDS 3334969 3335209 0.47 - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_7 AUGUSTUS start_codon 3335207 3335209 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MSLRVITPLVVPPPLSDLSNSAAERATTLQTPSKVQISPKQIDIQTETSAEDINDSVPKIPRVCLDMDVIPDMMAARL # ATTLSLSYLAFLAERHVLKITLNFDLTNTSEVQSNTRAAKLKHDLIDSFDTLSSHLDTTFTALSTAFARCSPTGASASGDSNADEQSPGSQAYLAILV # GPSIGTAKSKVIFAVDGLETKIWGVRDDLPRKVEAHEEVEDESDSDAEEGLEETYETFDDDDEENSHSEPEDSDSEDDSDVCSTSSRPDSPISQPPPS # PPRRVHPSTSSQTSPTHLLQDHAREQQKIRAADQLLSRTLAMADAEGRGMASELGDLSTLNIILCHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 Scaffold_7 AUGUSTUS gene 3338452 3340138 0.96 - . g710 Scaffold_7 AUGUSTUS transcript 3338452 3340138 0.96 - . g710.t1 Scaffold_7 AUGUSTUS stop_codon 3338452 3338454 . - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_7 AUGUSTUS CDS 3338452 3340000 1 - 1 transcript_id "g710.t1"; gene_id "g710"; Scaffold_7 AUGUSTUS CDS 3340050 3340138 0.96 - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_7 AUGUSTUS start_codon 3340136 3340138 . - 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MNSDILPPTPNTVNFNESPTRPRRGSNATSTSPARAQWPAVPYSVLTEEEEDTPGPIRRSRAESTSVSPPRLAINGVS # TFAPNAFKRQDSLSGSSDISAETMKRRREAEEEQNLYPALNSLSNVETSSQNSSPIIPLSPDPFGRFSSTPEPPEGTRHSVKVWDKVPFGGSVEQLIQ # NSKQRRTTSISGTGVTEAPSRNSEASSRFSADSTKDNIEVPASIAKNLSGSSTGGKDSVKEKTGNRTTVMSMKGIKKLWRKSNKTSVSMAVPPTPIPE # SPMFPPGHPTDEPLKSPPISTLPSTRAPSPQSLQNLPQSSSVPIRPSRPSKEELDIPDIPDQLAIPLQPENGRPAPMPIIAAQMQVGLRLRSSTNGDR # MQFDQESPYPMPARRPQQRKMSVSTNSVHSAPQLPSRTPSPTSSTGGSIGAAAGASMMGENRQANVRKSILKWKAAAAAHQNNEQTNSNSDSRSNPER # IASNSTVRPRAPSLNNGSHRSSVSTSEIPPSPKIPEHFLSSRAPPEHLRTGSHLTNSSTDSRLTNTTSFILPIAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 Scaffold_7 AUGUSTUS gene 3340595 3341110 0.92 - . g711 Scaffold_7 AUGUSTUS transcript 3340595 3341110 0.92 - . g711.t1 Scaffold_7 AUGUSTUS stop_codon 3340595 3340597 . - 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_7 AUGUSTUS CDS 3340595 3341110 0.92 - 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_7 AUGUSTUS start_codon 3341108 3341110 . - 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MLSGFTDPDNWAVGSRSRKNLHDLSLDDDDSESDDDGVEQGELTRGAEEISEIMAQMGQKPSRSNSLSRKRIPPPLVL # HPAGGAASKELKVPSPLNSATFTPPGSSSSSGSTSLPYLKGVSPNDGRERYMNHPEGSDFSELLDDEVERYRTKSPMETEKRTGGVYDDLIWI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 Scaffold_7 AUGUSTUS gene 3346045 3346665 1 - . g712 Scaffold_7 AUGUSTUS transcript 3346045 3346665 1 - . g712.t1 Scaffold_7 AUGUSTUS stop_codon 3346045 3346047 . - 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_7 AUGUSTUS CDS 3346045 3346665 1 - 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_7 AUGUSTUS start_codon 3346663 3346665 . - 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MAYQQQNHDPYYPQQQQQNSYVNYNTSTPHLNQSNEGYYNEYDHNSNWDARSNKSYASTHYGSQVHLNPHEMSQAVPD # VPSIPYGAQNGYSNYPPARPGPHYAQSTGAYSVARDKVLKGRAVKQVELFQGNLVLDVPVSSHIIPAGRQNVEEMSKMRYTAATCDPDDFLKSRYSLR # PYLLGRQTELFIVMTMYNEDEVLFTKTMNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 Scaffold_7 AUGUSTUS gene 3348536 3349105 0.98 + . g713 Scaffold_7 AUGUSTUS transcript 3348536 3349105 0.98 + . g713.t1 Scaffold_7 AUGUSTUS start_codon 3348536 3348538 . + 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_7 AUGUSTUS CDS 3348536 3349105 0.98 + 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_7 AUGUSTUS stop_codon 3349103 3349105 . + 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MGIGKRGNQVNVIDFGLAKKFRDPKTHLHIPYRENKNLTGTARYTSINTHLGVEQARRDDLESLAYVLMYFLRGALPW # QGLKAATKKQKYDRIMEKKMTTPTDLLCRGFPNEFGIFLNYTRALRFDDKPDYSYLRKLFRDLFVREGYQYDYVFDWSVQRTQEESNGGKATAGRRKV # VQEDDEHRQSDRM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 Scaffold_7 AUGUSTUS gene 3351773 3353249 0.07 + . g714 Scaffold_7 AUGUSTUS transcript 3351773 3353249 0.07 + . g714.t1 Scaffold_7 AUGUSTUS start_codon 3351773 3351775 . + 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_7 AUGUSTUS CDS 3351773 3352286 0.34 + 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_7 AUGUSTUS CDS 3352508 3352645 0.41 + 2 transcript_id "g714.t1"; gene_id "g714"; Scaffold_7 AUGUSTUS CDS 3352813 3353249 0.75 + 2 transcript_id "g714.t1"; gene_id "g714"; Scaffold_7 AUGUSTUS stop_codon 3353247 3353249 . + 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MIIDEANCIPGQTGNEASVDRLIKQITGFMTDISDEFKVIIVDAVRSLCLKFPSKHASMLTFLSGVLRDEGGYDFKRA # VVEAMFDMIKFIKDCKEQALAHLCEFIEDCEFTKLSVRILHLLGMEGPKSPQPTKYIRFIYNRVVLENATVRAAAVTSLAKFGINSSDPGLQKKSVFS # LAALESRLVAYVQDPSASSQPLDLSSVPRLAVSRLLKKLPVQVPEFVSYGPALNSSASPIQLTESETEYQVTCVKHIFKEHVVFQVCFILLRLRNSNT # EPFAQYNVSNTLPDTVLEGVTIIMQPSEETDSLVEDFIIPIPSLSPANSPGTVYVSFTRTSPEEFAIASFSSFAQIREQRGRPIYGRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 Scaffold_7 AUGUSTUS gene 3354593 3354991 0.73 - . g715 Scaffold_7 AUGUSTUS transcript 3354593 3354991 0.73 - . g715.t1 Scaffold_7 AUGUSTUS stop_codon 3354593 3354595 . - 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_7 AUGUSTUS CDS 3354593 3354991 0.73 - 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_7 AUGUSTUS start_codon 3354989 3354991 . - 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MSVRVLTGTDVRKITAELSVEFLQSLMEDVFALISSPESGTAYLPHRISIPMENHTALFMPARISTMGTAIKVVSVPS # SSDDKRGLPASTLVLDKHTGAVKAIVNARSLTALRNAAGSFSVCMRTGCYTVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 Scaffold_7 AUGUSTUS gene 3356606 3357895 0.91 + . g716 Scaffold_7 AUGUSTUS transcript 3356606 3357895 0.91 + . g716.t1 Scaffold_7 AUGUSTUS start_codon 3356606 3356608 . + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_7 AUGUSTUS CDS 3356606 3357895 0.91 + 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_7 AUGUSTUS stop_codon 3357893 3357895 . + 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MSDSESAASEISQGSSSENETSNILLTSSPSKRQRKPGMVQQSREMIVQTAFDAYFTHLASRAQTSTNIFSSLIPPLS # ADEYAEASSSFGSQRIKSDLLTSETERKSLFQRLLLELQEGFNVICYGYGSKRVLLNDFAINSCSKLGHVVVVNAFQPHFGLKELLSCIENVPGIDSL # PLPSSSAENQARRICDFFSRSTSKQHLYLVIHNIDSPALRSIKAQSSLSLLALNPKIHIVASVDHINSPLLWSSAELSTRKDNQGTGVGAGRGFAWLW # HDMTTLTPYDFELSQADRSSILGASGGMRKRDVTQNGTSMVSETAALHVLASVTAKAKKLFTLMAERQLEAIEAAKSSGHADDLQQYAVAYDKLYHSA # RTDFIATNDTALRALLGEFRDHDLVVGAQQGSSGEVLWIPMRKERLAKVLSTLKVNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 Scaffold_7 AUGUSTUS gene 3358216 3359131 0.16 + . g717 Scaffold_7 AUGUSTUS transcript 3358216 3359131 0.16 + . g717.t1 Scaffold_7 AUGUSTUS start_codon 3358216 3358218 . + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_7 AUGUSTUS CDS 3358216 3358374 0.99 + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_7 AUGUSTUS CDS 3358433 3358831 0.16 + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_7 AUGUSTUS CDS 3358883 3359131 0.6 + 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_7 AUGUSTUS stop_codon 3359129 3359131 . + 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MTSTASQPTQTQTDSTQSKDAKNATTSTKFDVPVPVEQILDDNETVVGTDEVNSPETENKFRSSVEKLRDAIEGYNTA # IAQNADEKTIEMHEQKVIQALKETAESSPNPKVKEYYKEKALEFMKVGRTAKKVLTNDIIKGALFILASPVALLSSVVVKFHFLLTITSSHCANVSWK # VSTGGLVYGLGSVVKGVGDLMSGMTFSGTVLGSKDEPKAEKKDAGVQNEEQEEDKEEEDKQEDTAVGEEKEDEAEGENTTEDTTTDKADRAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 Scaffold_7 AUGUSTUS gene 3363586 3363849 0.59 + . g718 Scaffold_7 AUGUSTUS transcript 3363586 3363849 0.59 + . g718.t1 Scaffold_7 AUGUSTUS start_codon 3363586 3363588 . + 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_7 AUGUSTUS CDS 3363586 3363849 0.59 + 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_7 AUGUSTUS stop_codon 3363847 3363849 . + 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MGGSDEKMNEAEELQQESKAYNFNPDDIAPPDVQKRLLEMLAWRDGVFRWITAKIEMIPGLSSLIDELMNALNACVYH # LTVSNSKEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 Scaffold_7 AUGUSTUS gene 3364631 3365609 0.35 + . g719 Scaffold_7 AUGUSTUS transcript 3364631 3365609 0.35 + . g719.t1 Scaffold_7 AUGUSTUS start_codon 3364631 3364633 . + 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_7 AUGUSTUS CDS 3364631 3364715 0.35 + 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_7 AUGUSTUS CDS 3364780 3365609 0.82 + 2 transcript_id "g719.t1"; gene_id "g719"; Scaffold_7 AUGUSTUS stop_codon 3365607 3365609 . + 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MIDISYGGEESYGGQYQQQSQYNIGYNTDSRGSSHEYDSRDNIQQYPDIDNKQGTYGREDAYDLGRSQYSSTIGYAGS # QHYEGYDPNQSRRNPHGSGPGFSNYGRPTGSSYGYNREQQDPYGSDEYRSLPRHRSSGYGEDSREPRRSQYGELEDSYNSQSLEQSTHHRDETYGNKQ # SERSPYRTEHKPPTHHGHRHNYERDEHENDDSYRNEGYQSFEQRGDYGSGALDDRRFDEGYGRREDFREEEFGGREVRRESGNREIRHGGQHGSHKLN # RGYQGGYGEQENETFGVERLNIDNEYGFRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 Scaffold_7 AUGUSTUS gene 3366059 3366382 0.58 + . g720 Scaffold_7 AUGUSTUS transcript 3366059 3366382 0.58 + . g720.t1 Scaffold_7 AUGUSTUS start_codon 3366059 3366061 . + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_7 AUGUSTUS CDS 3366059 3366382 0.58 + 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_7 AUGUSTUS stop_codon 3366380 3366382 . + 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MFADLHTLQSIQTAIRSSLAHIRHSRIAPSAINAPPPGFLPPSLGVALPPEPQAPSDPQSSQTTRTTRGLQEERLDRD # AWKGILNALTRLKREMDSSKSRSEDTDMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 Scaffold_7 AUGUSTUS gene 3369274 3370519 0.38 + . g721 Scaffold_7 AUGUSTUS transcript 3369274 3370519 0.38 + . g721.t1 Scaffold_7 AUGUSTUS start_codon 3369274 3369276 . + 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_7 AUGUSTUS CDS 3369274 3369548 0.42 + 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_7 AUGUSTUS CDS 3369670 3370519 0.89 + 1 transcript_id "g721.t1"; gene_id "g721"; Scaffold_7 AUGUSTUS stop_codon 3370517 3370519 . + 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MFSKSPSNFSEAEFSSSEESEPESDSEWYGRELSQMVTLRSALPPNFPHTVKTESARPDSMVGSVYGGSSPASSFSST # LPSPQLDPISSRRRPPPRTSIPADFGFFPEDVGEAAFPDEEEDDEEDCDNILTYYVEAESSTLSGSSDSFYSQPSHTERFSISDLNGEFQFAIDTEID # RPMMLPLSLPNSPIDLESDIANGLAELRMRPEADAPVDEIADDLPILTKPSTSVTRSASLLARRQMRRNDRVGSFGNRLEFVGEEEIAADEARDEIAV # QNAVYSAPAPSIAVCSPEEAPPAEDDEPAYEDHELRLNHSNPQLRSRWSSSTLSSIREEQQNRGWRSSKLRLYFSSSKKRSTSTSSGFVISYHSDYPV # KA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 Scaffold_7 AUGUSTUS gene 3380845 3381234 1 + . g722 Scaffold_7 AUGUSTUS transcript 3380845 3381234 1 + . g722.t1 Scaffold_7 AUGUSTUS start_codon 3380845 3380847 . + 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_7 AUGUSTUS CDS 3380845 3381234 1 + 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_7 AUGUSTUS stop_codon 3381232 3381234 . + 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MTFHTVPLSSLGEYGYAPVSFSPRPYTPADNASISPPTLTYSLSNADASSDDQHSGRHSRGSNPSPPPSVPYAATVPR # SHRFNPIGVPPPTRTSARTAATKRRNSKTANEDSDDPEEEEYQQSTGSVDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 Scaffold_7 AUGUSTUS gene 3387562 3388020 0.53 + . g723 Scaffold_7 AUGUSTUS transcript 3387562 3388020 0.53 + . g723.t1 Scaffold_7 AUGUSTUS start_codon 3387562 3387564 . + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_7 AUGUSTUS CDS 3387562 3388020 0.53 + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_7 AUGUSTUS stop_codon 3388018 3388020 . + 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MSLSQLGNAYLQSSGLNKALMSSDPTRTAQVLSRALNLIYVLSALVEPYMPATADAMLVQLNAPKRAVPEVLSTDLLA # GHEIGKPAHLFKKIEEGMAEKFREQFGGDEAKVVSTTKSASATGSSKPKSKSKSKKQDAAAPVYTAPSDVKRGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 Scaffold_7 AUGUSTUS gene 3389954 3390325 0.79 - . g724 Scaffold_7 AUGUSTUS transcript 3389954 3390325 0.79 - . g724.t1 Scaffold_7 AUGUSTUS stop_codon 3389954 3389956 . - 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_7 AUGUSTUS CDS 3389954 3390325 0.79 - 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_7 AUGUSTUS start_codon 3390323 3390325 . - 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MLKQYNDEEEDEDDEASFLSDEDNDEAPQLITSREDFGSMMDEFLNDYEILGRKMKPKLDGDTGAEKLDTLRRAMGQD # ERIRGSLADAEDRDNDDDNEFLRIDEEKKDRWDCETILSMVLQSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 Scaffold_7 AUGUSTUS gene 3390383 3391296 0.71 - . g725 Scaffold_7 AUGUSTUS transcript 3390383 3391296 0.71 - . g725.t1 Scaffold_7 AUGUSTUS stop_codon 3390383 3390385 . - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_7 AUGUSTUS CDS 3390383 3391186 0.78 - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_7 AUGUSTUS CDS 3391282 3391296 0.71 - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_7 AUGUSTUS start_codon 3391294 3391296 . - 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MIPTLGKSRADLEATLDYAEIARDAEARVGEAATYGIYYNDTEYDYMQHLRPVGVQEAGVESVLIEAPSTKKLNKKAE # GSKTKPGILLRDLPQEVLPSTSELPRTYESQQDIPQSISGFQPDMDPHLRQTLEALEDDAFVDDDLADDFFGDLIEGGARDSDEGVEFEFYEHGPPED # RQNVLPEKEPDTWEERFAQFKAARKASPLSSTSDDEHDFASEGGDTVSGLPAISVIGGKGKRRHKGGSDASGYSMSSSSMYRNEALQTLDERFDQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 Scaffold_7 AUGUSTUS gene 3393766 3394107 1 + . g726 Scaffold_7 AUGUSTUS transcript 3393766 3394107 1 + . g726.t1 Scaffold_7 AUGUSTUS start_codon 3393766 3393768 . + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_7 AUGUSTUS CDS 3393766 3394107 1 + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_7 AUGUSTUS stop_codon 3394105 3394107 . + 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MTIRIHEADGTPYEHVLDIRTPFKRYEVPFNTKYKRVRRNTKRYLARQAAAQAAAEGDTEAAEAIGMIDMGFGLEVWE # NEQERENWKVADWTEEDEGLMSGATYEWIRMGRGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 Scaffold_7 AUGUSTUS gene 3395287 3395640 0.36 + . g727 Scaffold_7 AUGUSTUS transcript 3395287 3395640 0.36 + . g727.t1 Scaffold_7 AUGUSTUS start_codon 3395287 3395289 . + 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_7 AUGUSTUS CDS 3395287 3395640 0.36 + 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_7 AUGUSTUS stop_codon 3395638 3395640 . + 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MANDSSRIVRRHVARSATQSLALLVQMGEMKSNSKDSESLLIEEDGSHPEKLKESKKTEMDAMIKVLRKDREVGKNEN # FRDFAVPIALCVVLLFKIESIFISPLVLLMSITKSGGVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 Scaffold_7 AUGUSTUS gene 3398739 3399548 1 + . g728 Scaffold_7 AUGUSTUS transcript 3398739 3399548 1 + . g728.t1 Scaffold_7 AUGUSTUS start_codon 3398739 3398741 . + 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_7 AUGUSTUS CDS 3398739 3399548 1 + 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_7 AUGUSTUS stop_codon 3399546 3399548 . + 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MASPQVTSPAQASFSSPLSGSRSSTRLGDDVTSLTSFNPFSEEDENDQSSYTLVTSIFSRMKNSLAAPLSSAAATTSI # VNNNGLNVNGTPAGAQDQKRPSLQSQSAGPARQSSIDRPNTLSSHANPAPPLVSLTPAQSEAPTYSVEYERSPSRSGMFYSESGDGGLFGTSIPGFPI # PDDARSIKTTGSLHRSGSVSKVIRRIRGEGAYIIASHGYTHLLVTQVYLEITGWMMRMQRSAMIARAYLPPGGGSTTVGYVVSDTFPQISDVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 Scaffold_7 AUGUSTUS gene 3401470 3402195 0.51 + . g729 Scaffold_7 AUGUSTUS transcript 3401470 3402195 0.51 + . g729.t1 Scaffold_7 AUGUSTUS start_codon 3401470 3401472 . + 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_7 AUGUSTUS CDS 3401470 3402195 0.51 + 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_7 AUGUSTUS stop_codon 3402193 3402195 . + 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MELIDAKRRWEDEIIRREERYHSGINSLHTRDGTITAYSSTDMNSPAVEESKYDDINAQIEALPTMDLGRSPSLSTAV # SPLKMDDASSYFSDANIVNFSTPQPTSASTITSPNTEEIREPMKTADDIAAESYYGLVKWKHEEFRRIWEWYLRKNKDDFIVEKYQCISLLQYTIPIT # EVELQQACFAPRLQYITFYGENDCTLGQYIEKSVTDTLVQCLDPKSICTGKACATTSSTLSSLCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 Scaffold_7 AUGUSTUS gene 3403009 3403635 1 + . g730 Scaffold_7 AUGUSTUS transcript 3403009 3403635 1 + . g730.t1 Scaffold_7 AUGUSTUS start_codon 3403009 3403011 . + 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_7 AUGUSTUS CDS 3403009 3403269 1 + 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_7 AUGUSTUS CDS 3403318 3403635 1 + 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_7 AUGUSTUS stop_codon 3403633 3403635 . + 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MRRATGDSFTSSASEASEPEPDPDSIPSPIPEGSVLASDSDAKSEPEPEQRKNSSHDNQIVAKSDPESDSTIEAVREQ # GISSEAPTLEGQSGQHRPSRLPRRSANQPSVADLVKKYQDFLPPQGVQELTKTAFAPRIVVSESDQEYNSPLQHLPLCGTKASIDCPEKGPYLILSRD # MLPILPLAISLDHGDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 Scaffold_7 AUGUSTUS gene 3403941 3404915 0.5 + . g731 Scaffold_7 AUGUSTUS transcript 3403941 3404915 0.5 + . g731.t1 Scaffold_7 AUGUSTUS start_codon 3403941 3403943 . + 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_7 AUGUSTUS CDS 3403941 3404557 0.5 + 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_7 AUGUSTUS CDS 3404657 3404915 0.99 + 1 transcript_id "g731.t1"; gene_id "g731"; Scaffold_7 AUGUSTUS stop_codon 3404913 3404915 . + 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MAKHFERLGRDAERSRSRYNVIRAGRRARPVASARAKVEVLESVQDAIKDDDESSSSDSSSEADDEGGEDQDEGKTVA # ELVEQTESPEEVTRVEVVKTAPPDSTFPESTQTDKHITPGSESTESSATLPPSTISLPPSPFLRTDHSVSVTPPHSDLEAPVPGTERNSILKALSGLW # LQPPPLTRSSLDNDDLMVDPSTSSETLPWCSPQYRDMLAKSRAEKRTAREARLTESGGEAFMPDDRSVAESTSTWGVVNMDTTESVDPTEDLKVPSSK # LPWAISRCPSLTFNIGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 Scaffold_7 AUGUSTUS gene 3406381 3407307 0.95 + . g732 Scaffold_7 AUGUSTUS transcript 3406381 3407307 0.95 + . g732.t1 Scaffold_7 AUGUSTUS start_codon 3406381 3406383 . + 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_7 AUGUSTUS CDS 3406381 3407307 0.95 + 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_7 AUGUSTUS stop_codon 3407305 3407307 . + 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MSLKIIFYVYILGGFTLVPLLLCALVAYTIYTSEPVSEDSKAKSIVTEEDVGKDVPDVQDMPKTRKGWLTVRRTFEES # TFDGGYVTLVRSFLDARSKDPKRSRPKDMWYVVLKGQILYLYEDETMTDCEAAIQLGSHDVVIYPEGLLDGELFTKRNSICLKPKSDVKVMPSLTREM # KLNENDDGERTKEGEKAKKVAESAAQAMAREQALDQQSPWFIFVRSTVEMEDWYFALVHASQHPAQTPTLDALQTVFSPSDMNLLVSTLDEQPDIIPM # RWFNAIFGRIFYSFYKTQHLETFIIGRLMKNSPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 Scaffold_7 AUGUSTUS gene 3407385 3408580 0.51 + . g733 Scaffold_7 AUGUSTUS transcript 3407385 3408580 0.51 + . g733.t1 Scaffold_7 AUGUSTUS start_codon 3407385 3407387 . + 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_7 AUGUSTUS CDS 3407385 3407996 0.71 + 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_7 AUGUSTUS CDS 3408098 3408580 0.67 + 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_7 AUGUSTUS stop_codon 3408578 3408580 . + 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MLKELTREGDASMEVHVAFKGEVRITLQATATINLGARFKPYVVKLVLAAVLRELEGNLLIKVKRPPSNRIWYAFTQM # PKMVLNVEPIVSDRQITWNMILSTIESSLKTIVGVYLLVYISTLNAIGNAQIQESIVMPNMDDIAFFDTSRRGGMTRGGIWADAAQKHSDIVIPSENQ # PIASDAGPPPEPFLSNDGSTSTDSFPPSTQTWFSSVRNTHTDAEYSSDNNMENESRGRTLDVDTRKTPTVRSQSTPNADILENENDEEGATTSSSLAA # PLVKQRSASQSSSGTVNELSNELSTASASDNTRIGQNIDGSSLAVPAPTTDTPPSPNNFLTTLKSRAADKQALSNTAKETMRKWGMKWVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 Scaffold_7 AUGUSTUS gene 3408685 3410082 0.63 + . g734 Scaffold_7 AUGUSTUS transcript 3408685 3410082 0.63 + . g734.t1 Scaffold_7 AUGUSTUS start_codon 3408685 3408687 . + 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_7 AUGUSTUS CDS 3408685 3409342 0.63 + 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_7 AUGUSTUS CDS 3409442 3410082 0.68 + 2 transcript_id "g734.t1"; gene_id "g734"; Scaffold_7 AUGUSTUS stop_codon 3410080 3410082 . + 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MSALGGASSNSQKTRASYAEVRAAVAERKGRVEHSQELSPSRSLTPSATSTPIAIPPNKNLSSQNTEFSDNSLVSSSG # SSVSSSSVRGSSSYPNKPILDSDGGASDMHNQIMSVSSSASNSSSTTSTKSSVDEAKLSSRSHVNPDVSIDEVAPAHAPIHVQPQAKTMSIPGIHASH # RGEVMSLGYVPPSLQEDKTKDKQRGRTTSQGSSTLSNLSSLGATEDAAASSTLLSPETDLASTSNGTLSQPDPSVIQAAPVLPASMTSLSKRVPPPPL # PPRPSPVTISPSRPPPLPARTPSSAGLASLTNSSSISQHSPNPSSQSLMPPQPTMSSAQDVLKGIATKDDHTRKRTSLTLSSTPPSPTIGRRVSLTGP # RSPRAPPLTLDDPARAMSDTSKANNSDALANSQLEVDATRAWGLDDEDLFSEGTAEPNVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 Scaffold_7 AUGUSTUS gene 3422592 3424044 0.59 - . g735 Scaffold_7 AUGUSTUS transcript 3422592 3424044 0.59 - . g735.t1 Scaffold_7 AUGUSTUS stop_codon 3422592 3422594 . - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_7 AUGUSTUS CDS 3422592 3423704 1 - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_7 AUGUSTUS CDS 3423766 3424044 0.59 - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_7 AUGUSTUS start_codon 3424042 3424044 . - 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MQLPPTSNNLDPLSRADLVRKSRKLAQVFGQTPNGASLLPTTSGMADTYPMRRSFLDITSPTSSRHHISNSVATFRKN # SVGDTKQKVKENMDRAEDTLLHSDDFDFLNELHLQEPISSIQTDREASSIFGNGEDGNLIEIGDAQQVEGDSASFIDWDDELPGPNGTKNKHPAELQT # QSPPGSQNSSRRSSVSSLAFASPSAYPGGAPRNSFTREDYIGTELPAAPFDDTDDEGGQKRDLQQHLARQPSLISLVTPSLMSPEERAEAEKRRKREK # LAKLHRFLGSRVPTGLVLGLGQAEEDSESGLPGLSVSSMGEETDAEGSSEEKRSWKKGMVRVTRRRSGSESGVSSDWSDIRDRRKDDMGEDERLRMVK # RAIRLEKVNNIEKFIEPLLIFLFLGIRSCATTNTLRIWSWTCSALPFPFEPRRNHTFSWSDDDPIVFYRYYGGNFDFEPPPTQERSYKTCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 Scaffold_7 AUGUSTUS gene 3426339 3428862 0.27 - . g736 Scaffold_7 AUGUSTUS transcript 3426339 3428862 0.27 - . g736.t1 Scaffold_7 AUGUSTUS stop_codon 3426339 3426341 . - 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_7 AUGUSTUS CDS 3426339 3427414 0.7 - 2 transcript_id "g736.t1"; gene_id "g736"; Scaffold_7 AUGUSTUS CDS 3427881 3428862 0.32 - 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_7 AUGUSTUS start_codon 3428860 3428862 . - 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MKLQRMKTLMNFHNHTSQEPSSSLKYPKRCTRSTSSSLSFFALHKRKCTIDVEPGAKKTKGDTEIVCTPTQVPAFLKY # ACISPSQAPSKKDLSLPLFSSSFPVNMPSPPASSQQSHTRKLKSLVISSDLNALLNHEENSERYTNRPPSPLSDEANITPESSQVAAGTTSRPVHPSF # SRSPPISPSLPTCSPTSRPSTSSSPSSSASSNFHTGPFGSLIHGGNHTRGHTPDTSLTSLASIVEGADGEPLLKSLPPPPRPGNKIVPTKVARARPGV # IPGPSASLTSRPVVNPDKDSSAAVHWQISRVLAGEDAVATTKTKILDKTSEQHGRPLSASKDSDFKSSKSASPSISSIQTAQTIPPPYNNSHSLLPLT # SYAPLIRNRTSCTSNSSHSAISSSSSDSTSTVTPGRLEMEVKSTRPNVRLLPSLPPVAPFSNRAHSIRHSKSAHNFNHHSAPPGTVYASAGDISKRKA # SRRVKVLSAEDVLGELFRKEDALDSLRILARTGTGITFQEEVPLPVSPSSSRHSRTSAKSRSTQGLEERVGTSFLRMAFEEDDEEGGSDREDATQIHS # SDLPTAGTSIPTTPRLRPSHSSEVSVMHLNEGHVFEKLHPYSGHYSGSGPVRPSASSAKSVSSRSSSSASVLSYAYAPTGDERYSKVLKMGSKSGSTE # VSTICRTLYAFGAIRTVFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 Scaffold_7 AUGUSTUS gene 3432948 3433261 0.16 - . g737 Scaffold_7 AUGUSTUS transcript 3432948 3433261 0.16 - . g737.t1 Scaffold_7 AUGUSTUS stop_codon 3432948 3432950 . - 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_7 AUGUSTUS CDS 3432948 3433165 0.92 - 2 transcript_id "g737.t1"; gene_id "g737"; Scaffold_7 AUGUSTUS CDS 3433219 3433261 0.17 - 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_7 AUGUSTUS start_codon 3433259 3433261 . - 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MLNSQIEQLISERAELRKTADSSKSENETLKTELARSGAVNSGMQSEIQMLKAELEGAKNAKSGESTHFNSTYLNAKL # LINRLGQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 Scaffold_7 AUGUSTUS gene 3442176 3442454 0.52 - . g738 Scaffold_7 AUGUSTUS transcript 3442176 3442454 0.52 - . g738.t1 Scaffold_7 AUGUSTUS stop_codon 3442176 3442178 . - 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_7 AUGUSTUS CDS 3442176 3442454 0.52 - 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_7 AUGUSTUS start_codon 3442452 3442454 . - 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MKVSFKLASKHVPKHVPRMAPTINHNDNALTDVERPNKRARVDANDKNGFELEHTRGSDLHEKEEDEIDEVPDIREEV # KASDLHLDTVCSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 Scaffold_7 AUGUSTUS gene 3444074 3444640 0.84 + . g739 Scaffold_7 AUGUSTUS transcript 3444074 3444640 0.84 + . g739.t1 Scaffold_7 AUGUSTUS start_codon 3444074 3444076 . + 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_7 AUGUSTUS CDS 3444074 3444640 0.84 + 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_7 AUGUSTUS stop_codon 3444638 3444640 . + 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MKELRLHDENNVGEMPPDAPHAVELSNPLRVPLDYELQTELRKEAYSWPRLVFPPLKKSGHIILDACTPEGTSSIRPI # ALNAHNFKGKIMRLTVPRSQGKQPYYDARKSSWGDLFPHEPKNPPQERYQPRRAKRDGSIGPVRGADIGKRRTVEEQTRISYEALSENIKENRKKSRR # DRISQGLENDSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 Scaffold_7 AUGUSTUS gene 3446587 3447318 0.88 + . g740 Scaffold_7 AUGUSTUS transcript 3446587 3447318 0.88 + . g740.t1 Scaffold_7 AUGUSTUS start_codon 3446587 3446589 . + 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_7 AUGUSTUS CDS 3446587 3446656 0.97 + 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_7 AUGUSTUS CDS 3446750 3447318 0.88 + 2 transcript_id "g740.t1"; gene_id "g740"; Scaffold_7 AUGUSTUS stop_codon 3447316 3447318 . + 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MGEAEYQRAVGDLGGAVLDIMGLNDEGTQLQRDKATLWIVLTIEVLELETVADSSSIEISDNPQRRDFYIASPDSMKR # IHELIYAGGTGQFACTYMAWTFVLSSVCAKAMEMKEIPVSYRGFFELVLPQFNRTYSKDREAVHVLMSRTCLEPKSGLLGLMETLLTNSPLFVTSVAW # KTGSTVTDPNAIAFRSVFKGASILPVSTSFFKFNMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 Scaffold_7 AUGUSTUS gene 3447560 3449671 0.85 + . g741 Scaffold_7 AUGUSTUS transcript 3447560 3449671 0.85 + . g741.t1 Scaffold_7 AUGUSTUS start_codon 3447560 3447562 . + 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_7 AUGUSTUS CDS 3447560 3449671 0.85 + 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_7 AUGUSTUS stop_codon 3449669 3449671 . + 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MTAAGFLDTDSLSTADHSSDADGLTEDRELCARHVFYFLDKLPTYSQVIPASGQTGVHALYERQIEAGSTVGMAYANV # RPIILPGGSILPVGSKGRLLNGDGGDLLVVIWHHEHSGWKLLLEVLMAYAFKLRSGSSSGFKSNSFGQMGHGSAITLSLKDIGLEIDGATDETLITDI # LDLVRSVIHNNPAQGEQLMQSLEAEFSPMSTPSTPDLVQLTVSILEEALARYNAHPMASPPSQLITSAISVLSAILAIPNYAIRVWIYIRSTTALFGS # EKNPGFSSAALSTERVTGRYTMTLAILKLVEQLCEEASLLLVPDDLQVRKLKDEVLMRAARFVHTEVWLEHLGWKYAQLGDRYEIGRRISSFYLKVLQ # YTPPIAEDAPFPKLSQAILDLLLYKASVLAINPLMSAVSAGTQMLQALYLSRRFGDARRLIYLLESHLQLIRLVLQRKCASEVAHQTCLLEQALCAQI # TGGAASHDPYRSKVNPIDALTFYVKERDAGPIVPLEAIKILSIICSSLSMSRSNSSTLVGHLSDPEGMVASFVRVVQHPYDDLSLRYSTWNFITVAMD # TEPALASLFVSGQFRSLGVAAERDVKGKGTGPLEMTSALPKIPNAVDVARDALANWEQLWESNPQLLACVLRFLVVVWRHGLEHKPLLEDLRLDPKVW # DHITMLACSELGPIPDFETELRFRGWKAKIECARRRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 Scaffold_7 AUGUSTUS gene 3450118 3451299 0.89 + . g742 Scaffold_7 AUGUSTUS transcript 3450118 3451299 0.89 + . g742.t1 Scaffold_7 AUGUSTUS start_codon 3450118 3450120 . + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_7 AUGUSTUS CDS 3450118 3451299 0.89 + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_7 AUGUSTUS stop_codon 3451297 3451299 . + 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MLGVSFWHQITPLSADVVQRSILLTIAASVSFDINKENRLGDMVAIVHGTRIAFLVSILELAWFNSSEKASEVQPFIE # LLENVRGIVLNEYQSPMKSIQGIFSMPFHRPLLQLLYFCAKNARSLTRRPKALSAEQRLKVLSIVEAAVKFVIDALRLTFMAARTKVGIDLDKDMELL # IAVFEQCTRLDVNPSSTVWLTQCQEADIVKASIELYAHIDLVGVSDPTFLLSTRRPLYTPHLLTFHMALASIPSAAERLASEGLLSAYCNNSISKAAS # TGLIDEVLPELPGHRSPAHHVYCCMLSIVSAIIVALGRNNHYFDAEACGLVQLYGDQIARALSWTVGESITFALLEEMDQVVNVFSALARNAPSTLNA # KSIIEDVLHVSLPLHFVFFNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 Scaffold_7 AUGUSTUS gene 3456907 3457419 0.82 - . g743 Scaffold_7 AUGUSTUS transcript 3456907 3457419 0.82 - . g743.t1 Scaffold_7 AUGUSTUS stop_codon 3456907 3456909 . - 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_7 AUGUSTUS CDS 3456907 3457419 0.82 - 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_7 AUGUSTUS start_codon 3457417 3457419 . - 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MDIVFAWDVNEGGAQGSQRSICAFFTSYFDDVLIFNHRRGNRGGGGDGDYNEWDDGGRRGRGARGGRGRGRGRGNYED # DFDRGGSRDRDQRGRGRYDDDYGARRSGGGGGPNNSYNDRYDRGTGYGPGAETGGGYSVPTFSQPPPPTPPAGMAAASPAVSRHSTIPGTQN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 Scaffold_7 AUGUSTUS gene 3458553 3458960 1 - . g744 Scaffold_7 AUGUSTUS transcript 3458553 3458960 1 - . g744.t1 Scaffold_7 AUGUSTUS stop_codon 3458553 3458555 . - 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_7 AUGUSTUS CDS 3458553 3458960 1 - 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_7 AUGUSTUS start_codon 3458958 3458960 . - 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MNRHHPYGSYESHRGGPQGGPGPDRSHRGGNRGRGGFSRGRGGGGGYYNGAGGGGGYDGNMSYNAYDQAPDAAASYSG # YEQQNANYFNNNGYGTTSSSQYGAGGFNQGYSKFEGAQEIETKTSEPSDVRHAETSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 Scaffold_7 AUGUSTUS gene 3464460 3464771 0.71 + . g745 Scaffold_7 AUGUSTUS transcript 3464460 3464771 0.71 + . g745.t1 Scaffold_7 AUGUSTUS start_codon 3464460 3464462 . + 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_7 AUGUSTUS CDS 3464460 3464771 0.71 + 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_7 AUGUSTUS stop_codon 3464769 3464771 . + 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MIEIVVVLYFSSLAKLHWYSINIPYIQEAAAQSDMVLPDIEAKAASTISTTPKLPDIPPTEDENKKTGSAKEETHDES # TKIQPTQPEDDFDLLTKRFAALKRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 Scaffold_7 AUGUSTUS gene 3467867 3468415 0.68 + . g746 Scaffold_7 AUGUSTUS transcript 3467867 3468415 0.68 + . g746.t1 Scaffold_7 AUGUSTUS start_codon 3467867 3467869 . + 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_7 AUGUSTUS CDS 3467867 3468415 0.68 + 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_7 AUGUSTUS stop_codon 3468413 3468415 . + 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MVTHLAPSNSRLYDPPFDWDSSMDFPSDTEDSDACSLSSSSVFSSPPSPSTPRTSYVPSARSASPAPSVWSITSSMRA # QAFKHEYGRGLNNYSEVYRLPADDEELERLGASFGAFLLIFIHHSRSDAQHLLFMEIMGKYPPCMEEVMADDVPGETKAVLDLGCGSGSWLVHLAYSH # NLSNVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 Scaffold_7 AUGUSTUS gene 3473553 3474142 0.36 + . g747 Scaffold_7 AUGUSTUS transcript 3473553 3474142 0.36 + . g747.t1 Scaffold_7 AUGUSTUS start_codon 3473553 3473555 . + 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_7 AUGUSTUS CDS 3473553 3473657 0.36 + 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_7 AUGUSTUS CDS 3473738 3474142 0.99 + 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_7 AUGUSTUS stop_codon 3474140 3474142 . + 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MLKEAISDQNLELIPDYEQRVGVLQELKFIDENSTINSANELVLTELILENTLAGYEPEEVVALLSCFVFQEKTDVEP # VIPPRLEQGRDAILAISDRVGRIQDSYKVASEDFQTKLKFGLIEVVYEWAKGMVSVFYLHTSRNTINCKKLSSHSSKSQHSQMLQKELLSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 Scaffold_7 AUGUSTUS gene 3475222 3475620 0.72 - . g748 Scaffold_7 AUGUSTUS transcript 3475222 3475620 0.72 - . g748.t1 Scaffold_7 AUGUSTUS stop_codon 3475222 3475224 . - 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_7 AUGUSTUS CDS 3475222 3475620 0.72 - 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_7 AUGUSTUS start_codon 3475618 3475620 . - 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MTGDYRQPYNEYVYSHHYPNSGMSTTQSSFLPVASTSYSPITPQFEAQSVTSSTISSSFMHATGQPPSYDSPSLSYSC # AEEVKSNIMFADTSCDDMIPDDAETAHDVNDSPGGVWMPEMNQNFVQSNPFPKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 Scaffold_7 AUGUSTUS gene 3477205 3478080 1 - . g749 Scaffold_7 AUGUSTUS transcript 3477205 3478080 1 - . g749.t1 Scaffold_7 AUGUSTUS stop_codon 3477205 3477207 . - 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_7 AUGUSTUS CDS 3477205 3478080 1 - 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_7 AUGUSTUS start_codon 3478078 3478080 . - 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MASLTGLSASVTRILYLTGFPKELKTKDIQSAFSEWENVNGGFKIKWKDDTSLLIVFQDASTGEYQSEQNISYRILTL # PVASAKRAYLHTLAFPPAILTSAAGVPASIRPYDGEDAQSVIQTVNSRGQHPNPTRHNSRSASISVFPAARSVSGPMPTNGFRHNGTGSIAQHVVIPE # YQPNGREPSPTLPNIPSHPTLNSLISSSLGEAVSNPSPPSDPAILATSLSSDFSSLVGGPRIGDPGKRMLGAALGVRHPSLGPRAINGSGSPTPGGVD # QAMNAVQRAMGGLVVAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 Scaffold_7 AUGUSTUS gene 3480504 3481546 0.98 + . g750 Scaffold_7 AUGUSTUS transcript 3480504 3481546 0.98 + . g750.t1 Scaffold_7 AUGUSTUS start_codon 3480504 3480506 . + 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_7 AUGUSTUS CDS 3480504 3480527 0.98 + 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_7 AUGUSTUS CDS 3480593 3481546 0.98 + 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_7 AUGUSTUS stop_codon 3481544 3481546 . + 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MVKFRNHALAAQQHESTLSRHYETLLLARETQDSSSDLTSTANMTQSLQRISRYIRDLLLAMAGEEVDLNHRLTEHEG # FVDPAELSALIDALAGPSGTSDQDKNSHYQELNVRADWTLERECEIARLEKENEQLRKVLGIDPESIAASGIDMEAEIRRMDRARHPELRNRRRDAPN # HMSTGSGDQWERGFSNINNGNGNGNINNNPVYMWDATKNPGNLGNQPPQQYTQEMSMAGGAPLQRSMELPTLRTGAQSAGPRMGQRFVQQPQQQQQPR # GTWVSGAGRTGGPPPSQQSTLWTNQPHSPSPQIMNDRPWPIQGGNGMDMGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 Scaffold_7 AUGUSTUS gene 3481866 3483552 0.95 - . g751 Scaffold_7 AUGUSTUS transcript 3481866 3483552 0.95 - . g751.t1 Scaffold_7 AUGUSTUS stop_codon 3481866 3481868 . - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_7 AUGUSTUS CDS 3481866 3482554 0.95 - 2 transcript_id "g751.t1"; gene_id "g751"; Scaffold_7 AUGUSTUS CDS 3482601 3483552 0.95 - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_7 AUGUSTUS start_codon 3483550 3483552 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MSSSNPVPAPDKPNSQDSLEQSNSFADSSPKSNSTLPKAKLSAFARFKTFTTSGLKSTPDPPFPPATWELSGSPLSGS # GSSDWNQKAEQYKAVLEKWREEVKAITLRERVEKKNDSDSTQAPREGSGSAEVDGSGDQDVQDAPDTRTLAMKIKALIDEKFTFSGGKTTQSAPPTPG # LVTDSPFIPISVESHNTNSSVPSTPPAGGTPSTTSGSMFGSLDATLARFLSSESIMNGEVGKGLEKGRESVWAMLDKLGAIAGATDPVDSKSSVDKGK # GRATEPSEPLMAAEGEEESIHDMYSSAAHKRSRTRNRRIGDRIQPVVESDTSAASLKPAPKPAPKTKSRRTFYPSSTKLSLEVTWWGYRLFLPPPILA # QLSSAHIAAAKRGAMITAALKWLIDQVPLMVVPPQMRASVLMLKRVSPYLGYVGAFVAWSWGRIQMKDQGNGVVLTATWLLPIAILPAAWDFEVHGRP # RDAEHGVAHVATADAATRSDIPTGTSTPIDTDNRTFGEGAGVKPTTPSADRPSFLSSATHRWNTLRRATTNKEKPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 Scaffold_7 AUGUSTUS gene 3490221 3490436 0.66 + . g752 Scaffold_7 AUGUSTUS transcript 3490221 3490436 0.66 + . g752.t1 Scaffold_7 AUGUSTUS start_codon 3490221 3490223 . + 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_7 AUGUSTUS CDS 3490221 3490436 0.66 + 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_7 AUGUSTUS stop_codon 3490434 3490436 . + 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MASLDDYDEFGNYIGADLDSDDSDNEQPTFAPQVPGISAPLEGFDDEDVPMRGQEEGFGEGALMEIDSGMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 Scaffold_7 AUGUSTUS gene 3494072 3494863 0.53 - . g753 Scaffold_7 AUGUSTUS transcript 3494072 3494863 0.53 - . g753.t1 Scaffold_7 AUGUSTUS stop_codon 3494072 3494074 . - 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_7 AUGUSTUS CDS 3494072 3494624 0.83 - 1 transcript_id "g753.t1"; gene_id "g753"; Scaffold_7 AUGUSTUS CDS 3494679 3494863 0.53 - 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_7 AUGUSTUS start_codon 3494861 3494863 . - 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MKLFFNLLMFLDVDPMYVGKGKFTVVGLGYHSVEEEEEEGENTAWKGKKWDDVVDVESFRNEQDWNPWITDLLDRIPS # NSLRVHPGWASNQVPPPIHAGRIVLLGDAFHPHGGALAAGGSLAIDDSIALFLSLQHVQQSSTPSTSSSSSSDVPSNSRSIEASARRRLSASELSHAL # DLYASTRLPHASRVFSVVERMRENVAKPGRLWDEEKIQEWARDKKEVVWLHEHDVHKAFVDALNSEHIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 Scaffold_7 AUGUSTUS gene 3496184 3496585 0.7 - . g754 Scaffold_7 AUGUSTUS transcript 3496184 3496585 0.7 - . g754.t1 Scaffold_7 AUGUSTUS stop_codon 3496184 3496186 . - 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_7 AUGUSTUS CDS 3496184 3496585 0.7 - 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_7 AUGUSTUS start_codon 3496583 3496585 . - 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MLQWKSEVGGWWNLALGKQPPAAQATPVDTGSNSRRRDTTDGGGVEDKINALAEALGMPPQDLAKAIAVAVREYVPPA # SLSSIKQRETGKPAVDELLRGNGEGKTVEADEPESTGIVGGVFRNMDSFVGLDEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 Scaffold_7 AUGUSTUS gene 3502193 3504164 0.12 - . g755 Scaffold_7 AUGUSTUS transcript 3502193 3504164 0.12 - . g755.t1 Scaffold_7 AUGUSTUS stop_codon 3502193 3502195 . - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_7 AUGUSTUS CDS 3502193 3502639 0.98 - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_7 AUGUSTUS CDS 3502714 3502876 0.92 - 1 transcript_id "g755.t1"; gene_id "g755"; Scaffold_7 AUGUSTUS CDS 3503439 3503557 0.9 - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_7 AUGUSTUS CDS 3503654 3503989 0.48 - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_7 AUGUSTUS CDS 3504081 3504164 0.4 - 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_7 AUGUSTUS start_codon 3504162 3504164 . - 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MRSVALTVVALAASGALAQAEDAKPTFTFTEDWSERWTPSEATKKTPVGGETFSYVGEWKVEEPLIQIIEGDVGLVAK # SKAAHHAISAPFAEPVDFKEKPLVVQYEVKYQKGGNCGGGYLKLLEDGFQTSGKEFSDTTPWIHFIFRHQNPKTGVFEEKHLKASPKPSIEKLAGLYT # LIVKNLYLTLSEFCCSPMKANPAYKGKWYAPMIDNPDYKGEWAPRKIANPDFFEDLTPGGVGIELWTMTEDILFDNIYVGHSTDDAKALAAETFDIKK # SLEKAKKATDDDEEEEEESFREDPIGFIRSKIFTFIDLLKLDPLLAFKTHPETGVALVTALLTLFGMFGVVTGVVGSQQKPVTKVNYGRLMPSFVFVT # HVLRPVCQES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 Scaffold_7 AUGUSTUS gene 3511394 3512212 0.55 + . g756 Scaffold_7 AUGUSTUS transcript 3511394 3512212 0.55 + . g756.t1 Scaffold_7 AUGUSTUS start_codon 3511394 3511396 . + 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_7 AUGUSTUS CDS 3511394 3512212 0.55 + 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_7 AUGUSTUS stop_codon 3512210 3512212 . + 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MASFTAIRSEFLLSEIKSDNCAVCHISQMEKELQYPTRIRQEEAITFRGRDFHILDYVLYRSFEDGPGNIGQVTSFVF # PQRETSWDPIEVVVRKLGRISSLKRVIPDNEMVDEVSAGFNGARFDLTTNQRELFYTEDQPGNYDWIHATSLIQVCHVLAAELRSEQIENWIMHGPEH # FYVRYCFPSLDDQSWASKKPIRRRQITICEKCHQKRLKEVESLNEFLTYQQKHPLRALDVLVGVVLLVLRWRTEAHASTSLMQLRLRLLQLKHIGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 Scaffold_7 AUGUSTUS gene 3516440 3517579 0.94 - . g757 Scaffold_7 AUGUSTUS transcript 3516440 3517579 0.94 - . g757.t1 Scaffold_7 AUGUSTUS stop_codon 3516440 3516442 . - 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_7 AUGUSTUS CDS 3516440 3517579 0.94 - 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_7 AUGUSTUS start_codon 3517577 3517579 . - 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MYAQVAPQQRPQSNYSQALEYQPDVGRPLDRRQYQEAEQEYEDEDAGYTPPNDPDDFYAGNGTGSRPASTYMPESFPP # AGPGSRSIAAQSTRGPSPPPGPILDHSHLRPGNHAALLSHERTLELYRANAKKTQDPDIQFEFAVFMIDASKSMPIPENTPGNLLQVEKALEKREDLI # KEAMTLLKRLADRGHPASQYFLADCYANGIGTPKNKQDFDRAYPLFVLAAKHGHPDAAYRAGTCCENGWGCRRESAKALQFFKKAAASLHPGAMYRLG # IAELNGELGQSKSPKEGVKWLKRSAEHATAEFPHALHELALLHERGIDNVVFVDYEYATELLAQAAELGYAPSAYRLGECYEYGKLGCPQDPALSIHY # YVCLLPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 Scaffold_7 AUGUSTUS gene 3525622 3526392 0.61 - . g758 Scaffold_7 AUGUSTUS transcript 3525622 3526392 0.61 - . g758.t1 Scaffold_7 AUGUSTUS stop_codon 3525622 3525624 . - 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_7 AUGUSTUS CDS 3525622 3526392 0.61 - 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_7 AUGUSTUS start_codon 3526390 3526392 . - 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MPNSKTPYDVIIIGAGVAGCSLAHALASTPRKEPLRIALVERSLEEPDRIVGELLQPGGVMSLQQLGLEHCLEEIDSI # PVHGYCVTEKEKIVHIPYPAGHKGRSFHHGKFITNLRNAAKKAKGVDVIEATVNDLIESDQRIIGVAATKKNATDNEKISLYAHLVIVADGCFSNFRT # KVMGPRVCNPVTKSYFVGVILNDATLPYQYHGTVCLTESAGPVLLYQIGTHDTRMLVDVKAPVPSDLKVSCHVCRRLPPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 Scaffold_7 AUGUSTUS gene 3527093 3527674 0.9 - . g759 Scaffold_7 AUGUSTUS transcript 3527093 3527674 0.9 - . g759.t1 Scaffold_7 AUGUSTUS stop_codon 3527093 3527095 . - 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_7 AUGUSTUS CDS 3527093 3527674 0.9 - 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_7 AUGUSTUS start_codon 3527672 3527674 . - 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MPEEQLTALPPDIRQMVMTGATAAMMNNTPNPGMMAPGVMMDMGMINSMNMGMNGDMGMNQQMMPVDQRGMMIQDGVP # SGPMGGTGAPEQVGGGGMPVGMMQDGFAPGGPMGMGMPGDYSMQVRSIDSQTDRPSHHTYFDEGPVTNVFGSRIGHSRSSEHAERSSCTHSSRSYSFI # PSTRQYGSRIAFTWIPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 Scaffold_7 AUGUSTUS gene 3527717 3528148 0.64 - . g760 Scaffold_7 AUGUSTUS transcript 3527717 3528148 0.64 - . g760.t1 Scaffold_7 AUGUSTUS stop_codon 3527717 3527719 . - 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_7 AUGUSTUS CDS 3527717 3528148 0.64 - 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_7 AUGUSTUS start_codon 3528146 3528148 . - 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MESSSSIAVSSSLPQMQPPPMQSAQSPATQPSAAQAEISSNNLNVSLDNGVDPTTLPPVKAPPSHPEIDPAAPGMLDG # RAIFEVDIAAMADKPWRRAGSDISDWFNYGFDELSWEAYCYRRRELGEMADALKVNVLVRKDQLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g760 ### # start gene g761 Scaffold_7 AUGUSTUS gene 3528385 3529245 0.93 - . g761 Scaffold_7 AUGUSTUS transcript 3528385 3529245 0.93 - . g761.t1 Scaffold_7 AUGUSTUS stop_codon 3528385 3528387 . - 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_7 AUGUSTUS CDS 3528385 3528673 0.93 - 1 transcript_id "g761.t1"; gene_id "g761"; Scaffold_7 AUGUSTUS CDS 3529241 3529245 0.96 - 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_7 AUGUSTUS start_codon 3529243 3529245 . - 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MYQPVENSLLDSRGIVSQLEAVVAASAAAAKHNAEMAQATNDIVPYSDPDTREDAQEGDVYAEGDGDGDDSEEDEDVS # SLYLLSYCLSKCDYCRLKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 Scaffold_7 AUGUSTUS gene 3531163 3532580 0.17 - . g762 Scaffold_7 AUGUSTUS transcript 3531163 3532580 0.17 - . g762.t1 Scaffold_7 AUGUSTUS stop_codon 3531163 3531165 . - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_7 AUGUSTUS CDS 3531163 3532176 0.27 - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_7 AUGUSTUS CDS 3532275 3532580 0.17 - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_7 AUGUSTUS start_codon 3532578 3532580 . - 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MSPARDSMAGLANHSTVYTLSLLSEYSHTLDSLPLDLSRNFADLRELDAVLSSSMASITQKITMLTQMIEEGTGKKEE # RLWLLTEIAEEAARLRPGGEDKIRTHNISHVAAKSFMPLTAFETTRRRRGGFGSLLTSATDPSPAKRKRLVKDDEPTPRKDKPNDSRNRNRARARKCV # CPILIPQTHSDLNLASSFRVERQPSPVESLLSVASHQNGILSRNNSSTNNKRSRSSVQHRAGSPSRDDHYTNGDQRQPSSNGRRDFDVPPSTSHPSLP # LPFHVNGNGYNHLSGPASDWAPSHNQLEGPGMPVARPVHSGTSASISAVEHMVDLNDGDVDGDGEDKPYCICQRGSFGEMIACDEPTCEFEWVRSDQL # LFRFPSHSILLQFHLNCIGLTVAPEGAWICDSCTSNQVAKKNGRRSARGGKRKGGGNRASGRAASGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 Scaffold_7 AUGUSTUS gene 3533439 3533999 0.92 - . g763 Scaffold_7 AUGUSTUS transcript 3533439 3533999 0.92 - . g763.t1 Scaffold_7 AUGUSTUS stop_codon 3533439 3533441 . - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_7 AUGUSTUS CDS 3533439 3533999 0.92 - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_7 AUGUSTUS start_codon 3533997 3533999 . - 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MILTGWNGLLLKGLCEEDVEGFPANATCWNEVVDIGGDGGFLLWLRFGSGGARLLSDEEVYEDEEAEEPILFGLELLP # LRVNGEELEEDTSELLSTLSTLSFSSCSSACFQVFPFFEAIRLCFIKAEVTWDVCECSNVGFEGSGGGGGGLPTDTTNEPCLGGVENLGLGVQAFWEE # EEEAWKESSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 Scaffold_7 AUGUSTUS gene 3534102 3535120 0.36 + . g764 Scaffold_7 AUGUSTUS transcript 3534102 3535120 0.36 + . g764.t1 Scaffold_7 AUGUSTUS start_codon 3534102 3534104 . + 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_7 AUGUSTUS CDS 3534102 3534562 0.36 + 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_7 AUGUSTUS CDS 3534664 3535120 0.78 + 1 transcript_id "g764.t1"; gene_id "g764"; Scaffold_7 AUGUSTUS stop_codon 3535118 3535120 . + 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MSYRKPPPPIPPNLSSSATSSGFHVIHKRTPSFTQLHKSAESFANDADEKDFEAIYGTKPKTASPYVSTFSRGSTDFT # SSRNREGTASDSSNHFDRNVFLNNGHSPSRMFRSKSLHHPSPTSLANRLAAAELGDTERSPFSPLDDDPPDASPGPPSGSSPNSNLSRHMSLSTPSPP # NGAASLRRHQRKVSSSSPGLGLGQSPSTSDNPLKSLAASLQPQLLSMQQQLQPHLDKARFKAEAGLSKRGFVRDHKSLIRPREEEEGLMRDEREDGWE # RQSVRMMIVMRMSRTMSGMDREVGKIGHQGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 Scaffold_7 AUGUSTUS gene 3538584 3539219 0.48 - . g765 Scaffold_7 AUGUSTUS transcript 3538584 3539219 0.48 - . g765.t1 Scaffold_7 AUGUSTUS stop_codon 3538584 3538586 . - 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_7 AUGUSTUS CDS 3538584 3539219 0.48 - 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_7 AUGUSTUS start_codon 3539217 3539219 . - 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MSVYAADALECPAQVLVNLTLHIIPTMVRQSEMQSRIKRDDTDKLIECSPRAFLKTYASNKQLRSKDLRNVVMNALKE # GKLLDDNGWISLRNTGKGQNQNETFAFLGQVAEAITRAATQHDETLKPQAVACPSPTATYQHSKLGYRFFPDWTAVFNVLSSSIHVDAKPSTVSASRK # TPVKTLDIASIAEFKLEDTTEKIIDVSFARNDLLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 Scaffold_7 AUGUSTUS gene 3540438 3540791 0.52 + . g766 Scaffold_7 AUGUSTUS transcript 3540438 3540791 0.52 + . g766.t1 Scaffold_7 AUGUSTUS start_codon 3540438 3540440 . + 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_7 AUGUSTUS CDS 3540438 3540791 0.52 + 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_7 AUGUSTUS stop_codon 3540789 3540791 . + 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MDEEDDRDWSALRKEYTTTLEKMIKERKSRQAAKNQAGSLEVIGMEEATRDLEKEPETEAVNTTAKGAPSINETKVRR # VGDETDVNVKDEHIHKLPVVPFYASRRYSAGIAEPSEEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 Scaffold_7 AUGUSTUS gene 3542011 3544061 0.63 + . g767 Scaffold_7 AUGUSTUS transcript 3542011 3544061 0.63 + . g767.t1 Scaffold_7 AUGUSTUS start_codon 3542011 3542013 . + 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_7 AUGUSTUS CDS 3542011 3542410 0.86 + 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_7 AUGUSTUS CDS 3542463 3543042 0.65 + 2 transcript_id "g767.t1"; gene_id "g767"; Scaffold_7 AUGUSTUS CDS 3543092 3544061 0.76 + 1 transcript_id "g767.t1"; gene_id "g767"; Scaffold_7 AUGUSTUS stop_codon 3544059 3544061 . + 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MEALVPPTSKYFDSSSSESSPSVSFSSTASTSDSGFSSRTRTKPHRQSTSEAAIVSIYSMYTDDQPTRASWVQDDTKD # IPQIKLDCRQSYLNESDNRDSTELAYFQEDTPIIDLTDPGNTSIRLSSHDSPNSSSIIPSSSRPISGFDRRNDHRRRSTGQSHRTTATSITSGPLSIA # RSGDSSYSPSRFSRKSGELPPLPVSPTPPPVTPPPNRNSETLEVPTSSPAPSLPPLPLKHPVYVGSPMSKTSLVPSEGEDMDSFHVRNTYAQLDVSGV # KGDGYEEGVERTRARIGDSRASQLNAEAALGDGTEKTKELDPKEAQLLAVVDRYGFFSSPSHDRLMLLPSAPLLRHIGLTHGGPKNAPVAGPSLKTLP # PPQHPLKEPSRIGKWERMLRPSKPDPGGILVWSIRSTKEAKLNERTYKGIPDRWRNAAWELLLSRFTAQHSPPSDRTQMSLARLAQDYYDVLDKPSSY # DIQIDLDVPRTISGHVMFKTRYGAGQRSLFHVLHCFSLRCEKCGYVQGMGPIAATLLCYFTPEQVYASLVRLHGAYGMHDIFSPGFPGLLEAIYVQER # ILEQMLPDVFKAFKTHMISTTSYATKWYITLFANSVPFQTQLRLWDAFFLDGEDVFITVAVAIVWVFRGTRPFRRCDQLPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 Scaffold_7 AUGUSTUS gene 3544730 3545176 0.54 + . g768 Scaffold_7 AUGUSTUS transcript 3544730 3545176 0.54 + . g768.t1 Scaffold_7 AUGUSTUS start_codon 3544730 3544732 . + 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_7 AUGUSTUS CDS 3544730 3545176 0.54 + 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_7 AUGUSTUS stop_codon 3545174 3545176 . + 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MQSLRSRRSQGPARKPTRQPTNGKLAKDARPRRRDTSGRSRVDDKIKKRMSTRYADISSPTELNIPRVPTLPIDAPGV # RRIDGEQDESVRDQEDLLSSQKAADAAAEEKKLLDDKSFDPDACASVVIKLWLIIHCLSFRSEEEVGKFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 Scaffold_7 AUGUSTUS gene 3545362 3545772 0.58 + . g769 Scaffold_7 AUGUSTUS transcript 3545362 3545772 0.58 + . g769.t1 Scaffold_7 AUGUSTUS start_codon 3545362 3545364 . + 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_7 AUGUSTUS CDS 3545362 3545772 0.58 + 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_7 AUGUSTUS stop_codon 3545770 3545772 . + 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MLELKESLSEYKSMPSLLHIPDPTSSSSSISTYRRSSVADLRIMYFNQMQQLHAQIEGSAKFAPTTPGRHVVGEADGV # LSLNAATYKVMGRVKFVVLDDAVLVAKRRRRTAGGAGDTSGRAGDVQKASWWQRDAGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 Scaffold_7 AUGUSTUS gene 3546683 3547552 0.29 + . g770 Scaffold_7 AUGUSTUS transcript 3546683 3547552 0.29 + . g770.t1 Scaffold_7 AUGUSTUS start_codon 3546683 3546685 . + 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_7 AUGUSTUS CDS 3546683 3546775 0.29 + 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_7 AUGUSTUS CDS 3546932 3547552 0.94 + 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_7 AUGUSTUS stop_codon 3547550 3547552 . + 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MRLRVVSFPAQPVAVVTNLAVAAFIDWARSQLLEEYGLDFRFLLDEQLAETPKIQPKAISSEISIPSFKGPLLARSSN # ATSAPKLSLSTSSGLTNRKVPAALNIPSPDIQADASLASTTPLMGTGAPMSTGSAYPDTSKFKGQMLGSARSRTPVGGSGILSISSSLLPPNSAPAHS # VPASPIPRQMRTPPPSAGRDRPPRSERGAGSPAPPPRSSNRPGSSISRTTLVAVAQRDGMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 Scaffold_7 AUGUSTUS gene 3557294 3557955 0.19 - . g771 Scaffold_7 AUGUSTUS transcript 3557294 3557955 0.19 - . g771.t1 Scaffold_7 AUGUSTUS stop_codon 3557294 3557296 . - 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_7 AUGUSTUS CDS 3557294 3557653 0.91 - 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_7 AUGUSTUS CDS 3557770 3557955 0.21 - 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_7 AUGUSTUS start_codon 3557953 3557955 . - 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MSVDNTTDTTSEASPTWSPTPSNSSTSSYAPSTSSAPSRRDAPPLPPSVPQLPVDPNAILGGPGQVPSTVIGAAKDKL # GAAEGAAPQPIKDKAGTVENAAPIQPPVRRSHRARRDAPAPPAPPSPPSPPSGPPSGAPSPPVQPPVQPPAKPPVQAPIQPPASTATVTSTSTVTETA # APTSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 Scaffold_7 AUGUSTUS gene 3570593 3571225 0.45 + . g772 Scaffold_7 AUGUSTUS transcript 3570593 3571225 0.45 + . g772.t1 Scaffold_7 AUGUSTUS start_codon 3570593 3570595 . + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_7 AUGUSTUS CDS 3570593 3570640 0.45 + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_7 AUGUSTUS CDS 3570788 3571225 0.66 + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_7 AUGUSTUS stop_codon 3571223 3571225 . + 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MSLDSQSIPRPRSCSLIYDVRIGAIAASLTPPDAVPFNIHTLSFSENGFHLAAPSSHSTVAVWDLRKQKASTNIDLGD # DFKVNKVVYDVSAQFLGVAGNTGGRVFMYKSWEELVRFEEGGEMNDFVFGDMGKEIWGVTGREVRIGVYLLKIIYSLKLLCVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 Scaffold_7 AUGUSTUS gene 3574271 3574627 0.98 - . g773 Scaffold_7 AUGUSTUS transcript 3574271 3574627 0.98 - . g773.t1 Scaffold_7 AUGUSTUS stop_codon 3574271 3574273 . - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_7 AUGUSTUS CDS 3574271 3574627 0.98 - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_7 AUGUSTUS start_codon 3574625 3574627 . - 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MEDTKAYNSSTEEIISLPTRTIRARRAPDVPVDVDADAEFVKEHLNDPYMDLSRPYKSTESMELSDKKVQQLQYAPSE # LDAESNVDTFDRYSTSRAESRNSTAIEFDECVSVYSLAVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 Scaffold_7 AUGUSTUS gene 3584742 3587012 0.94 + . g774 Scaffold_7 AUGUSTUS transcript 3584742 3587012 0.94 + . g774.t1 Scaffold_7 AUGUSTUS start_codon 3584742 3584744 . + 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_7 AUGUSTUS CDS 3584742 3587012 0.94 + 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_7 AUGUSTUS stop_codon 3587010 3587012 . + 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MSYFTTVRSQGSFTRKLNPQYIVGIPVDNLEPIRLQVRGTLYNAHGNKCNLHCDKFGPHNHIVSVIFAMSDVSGSRSK # PTTRSSIRQSLNFASVGKAFADVMNKERNDSTKKTGKDVNKTGGLKPRASLDTRPSPPPSKRPRTPDSKTITARRRSSLAAASLSTRNSADEPSVAPS # KTTPQSSVPARSSALRPRPGSSSNLPKYRPKSIIVENGKKPSSPGLSGSRKRTSTSDDEDKTSSGDMAVDASSQRRKSRPISPLPQRAAAKTKMSGNN # SKSNTPKPESSPLVRKASPNRMVKAVKAASTIPRPSSASSSSSSFTPRTPKASPGKGARGTHSVKVQKNNVSDSSEGSVHSALPESPLVRHVRQRSKA # ETPPAQNPGNMSHITEADSDDEEDDVEIMLAPIAAPGAPTPAMPRLQTMRNRSRLVPATPSKPLLPIHFEPPEASSTPPKNQDSPSFLRPNPSPGSDR # SLRGGSILSWEQLASEASRTIPVDELGTMLSDMSAPFQPGPLSPMPTGNGNGSMLLDVNFQNLPSSPGLSAFNSPSGYGSISQVLLPNATPSPAFPRH # SHSHSQRQHKESDGPAVDTAIATLLRLQLSSAENTAKERLMRLQELEEEIHNLKQTRTHETEVLSQQVSILESQLKNSLEARERSEGEQFAYTASLEE # QLRYTEVQQRQVVREAVESARQHAEASLRSTVESQNRKMNAACAASLAAREWRSVQEQCESELDVLAADRDTLALLFGELDLVRQQLLIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 Scaffold_7 AUGUSTUS gene 3595276 3595842 0.7 + . g775 Scaffold_7 AUGUSTUS transcript 3595276 3595842 0.7 + . g775.t1 Scaffold_7 AUGUSTUS start_codon 3595276 3595278 . + 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_7 AUGUSTUS CDS 3595276 3595842 0.7 + 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_7 AUGUSTUS stop_codon 3595840 3595842 . + 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MAAVATRYPTFVLPVPRPDPEAKGNANTTETPYEFQFMQWAFHESPPIPSAAEPDPFVPSTNTYRAADGSSNPPTSSI # LFTPLQEFKMRNSFATPYLVLTHYTDLARTHGIVLLRGEITPGSGNDGRYLLSQEDAQILSMGVQKFYLWSDNKGVEQQDRSTGESILRTFHEKPSEF # DWQEMLKYSTQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 Scaffold_7 AUGUSTUS gene 3596101 3597118 0.49 - . g776 Scaffold_7 AUGUSTUS transcript 3596101 3597118 0.49 - . g776.t1 Scaffold_7 AUGUSTUS stop_codon 3596101 3596103 . - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_7 AUGUSTUS CDS 3596101 3596733 0.8 - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_7 AUGUSTUS CDS 3596810 3596953 0.94 - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_7 AUGUSTUS CDS 3597011 3597118 0.54 - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_7 AUGUSTUS start_codon 3597116 3597118 . - 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MRCALVEAEVRDEVMREMETRMADMEDMYTRRLTKEIEQHEAKTDAKLDMLQRTGFGSPVKKAHPQRSRIDWSEDEEE # DVGLSFVQEDEEEGDSSEHSSGEEFDFDDDKDSEVSGTSPPTKKSKAIAKSSTTKRQSTVSQKVHEPRPAIPDGPMLPSDSEDAEMTGTETGDETGKE # EGDDDDDEEEGDEEEEEEEDGASVHTSDSGNGDDDEWAPSAPTPRAVKPPRASSPSPTRPKIPQPKFLTSRNRISAVEQGMRNMDLNDDLDDGDSMII # PSRKSRERQVSGSGPRKVKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 Scaffold_7 AUGUSTUS gene 3597287 3598534 0.6 - . g777 Scaffold_7 AUGUSTUS transcript 3597287 3598534 0.6 - . g777.t1 Scaffold_7 AUGUSTUS stop_codon 3597287 3597289 . - 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_7 AUGUSTUS CDS 3597287 3598534 0.6 - 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_7 AUGUSTUS start_codon 3598532 3598534 . - 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MSDSASETDMDVDTTALKLDRNYEYTIWLSYAEVYNEKVYDLLDSVHGETSRVKPSAIPRPGAASSLVLTRNALPVKS # SPSSDNSDSEIGGKYIFGLRQFRVETAAQAKELLRLGQLHRRVFGTLANKESSRSHGMVTLKIMRCHRGEKNVSFFRSHPSLSSFKCVLQDPTAIQIS # RFTLVDLAGSERTKHTHTTGDRLKEAGNINNSLMVLGQCLQVLRTNQRKVAVSLSQEGEGRAGRVDTRDVKQTLTIVPFRHSKLTEILMDYFAGDSRV # VSRFPLVLPAQLMFPLSFPKVMIVNVNPYDTGYDENSHVMKFAALAREVYVSPTPAPVQRVPTVGPGKTTGKTIKQLGPLTLNDPDIAPKPFSRKVTI # SIDGNSKSGRKASEAVLQVLEGTLYLSPSGPILLSCLMIPHSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 Scaffold_7 AUGUSTUS gene 3599070 3599459 0.47 - . g778 Scaffold_7 AUGUSTUS transcript 3599070 3599459 0.47 - . g778.t1 Scaffold_7 AUGUSTUS stop_codon 3599070 3599072 . - 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_7 AUGUSTUS CDS 3599070 3599459 0.47 - 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_7 AUGUSTUS start_codon 3599457 3599459 . - 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MSEKPKMATRSSARTKTSSTAPAPSTRTTRAKAGTTTTTKATTPPSLPVPPPPKKAASRKPLASRGNAEDASDLPSKP # PSKSTTVTRKAGKANANAADIEREPIMVCFLSSFELDLTSPPRPTLGYDRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 Scaffold_7 AUGUSTUS gene 3601276 3603396 0.25 + . g779 Scaffold_7 AUGUSTUS transcript 3601276 3603396 0.25 + . g779.t1 Scaffold_7 AUGUSTUS start_codon 3601276 3601278 . + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_7 AUGUSTUS CDS 3601276 3603396 0.25 + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_7 AUGUSTUS stop_codon 3603394 3603396 . + 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MAEPSVVSSSRHRSQPSRTNTSTRSASTQQGHISSQSPSQPISMPMPMPSTPPVLPNSQGTTELRRSYYTTNPDPDTE # GSVEGDYVNIPAVGVEGQVMGFNVQPVEVEPIPRRKGGGRFIGGFVRSLRKIPRTMFRPGHGSNTVVPETPSQPAARAPLPSYMLTPPTPAIPGQPFS # YLDETHVPETPDIFPVTSPHPTRIELDDATVHSPERNPDRDTNMPSMSRHTSHHTSHHTSQNHNNPSTNRNSFAYPNSYHDPPSVAAHPQPSPDYRRM # SRHTGEESVLGSYSAGTPSFSTELDRNPFRVLKALVNMPWISHDRVTVDYSPGMEDSRGALRVASPSGEKGKSKGSKERQSARWSIVEQGWKPWKRTS # VFLTLDGRIVSPEEGPDALARGDARKGKMYVPVNKPETSWYSGGHMIKVSRHKRSGVPRNRELDLMSSGSEPGARSSIASTPRASRVSARRRISRSTL # TSPSSPTSPPPLRRPRNRETFRQTPRRHSRRLYYANNEYAFLDPGSTPGSSPILARRSNMRSREVLRDRHRPIRRRYSRDIPQLPTQQPLVPPVPPPA # SPYPLSPLVFVQSAHMDSPSGGADPNSHPHPQTGSGMPVPVYGVTPMYMSILPGMPPPPTGSGVGIGESSPPGFAGRGAGGGYGAGYGVQGYAGTAPP # GSGAYTYSYAYPYAPSQSPPPPPQVHHNGETRKSPLNTAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 Scaffold_7 AUGUSTUS gene 3603991 3604497 0.34 - . g780 Scaffold_7 AUGUSTUS transcript 3603991 3604497 0.34 - . g780.t1 Scaffold_7 AUGUSTUS stop_codon 3603991 3603993 . - 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_7 AUGUSTUS CDS 3603991 3604497 0.34 - 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_7 AUGUSTUS start_codon 3604495 3604497 . - 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MNTLRSGVQIVVATPGRLLDMIKRGAIKSEHAKILCLDEADEMLSQGFKDQIYEVFQVLPGDLQVLLFSATMPSDVLE # LTSKFMRDPIRILVKKDELTLEGIKQFYIAVEKEEWKLDTLCDIYDTISVSQSVIFCNAKRKVDWLTQMMEQREFTVSAIVSSVQNTDVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 Scaffold_7 AUGUSTUS gene 3607422 3607958 0.26 - . g781 Scaffold_7 AUGUSTUS transcript 3607422 3607958 0.26 - . g781.t1 Scaffold_7 AUGUSTUS stop_codon 3607422 3607424 . - 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_7 AUGUSTUS CDS 3607422 3607555 1 - 2 transcript_id "g781.t1"; gene_id "g781"; Scaffold_7 AUGUSTUS CDS 3607611 3607772 0.72 - 2 transcript_id "g781.t1"; gene_id "g781"; Scaffold_7 AUGUSTUS CDS 3607874 3607958 0.27 - 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_7 AUGUSTUS start_codon 3607956 3607958 . - 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MLFANDMHLGQIKCSILFHATSMESYLTFLHTLETWDSTFVDGDDGQTPELLANSNPLANGPGVRTPAGSFYYGGVNH # GNGLDQDQVSVGDEDPGNSENEIEEADLDGAFGLFSEDEDDDMLDVPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # start gene g782 Scaffold_7 AUGUSTUS gene 3617843 3618304 0.55 - . g782 Scaffold_7 AUGUSTUS transcript 3617843 3618304 0.55 - . g782.t1 Scaffold_7 AUGUSTUS stop_codon 3617843 3617845 . - 0 transcript_id "g782.t1"; gene_id "g782"; Scaffold_7 AUGUSTUS CDS 3617843 3618304 0.55 - 0 transcript_id "g782.t1"; gene_id "g782"; Scaffold_7 AUGUSTUS start_codon 3618302 3618304 . - 0 transcript_id "g782.t1"; gene_id "g782"; # protein sequence = [MSFCSTYLPHFYQPPISIEQFLEMTGIRFMDLSAPRRSTYASQIPSRQPRNPSEIPLAEYAVAMAIDIPQLVLYSRVA # RDLEGWIEQSKVEFRQAEEEAAKVTPLLFAEYLRTDEEGQKDLTVRLFQTPWNDGQDDSDIRIASIEVDQDERSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g782 ### # start gene g783 Scaffold_7 AUGUSTUS gene 3618793 3620767 0.16 - . g783 Scaffold_7 AUGUSTUS transcript 3618793 3620767 0.16 - . g783.t1 Scaffold_7 AUGUSTUS stop_codon 3618793 3618795 . - 0 transcript_id "g783.t1"; gene_id "g783"; Scaffold_7 AUGUSTUS CDS 3618793 3619348 0.48 - 1 transcript_id "g783.t1"; gene_id "g783"; Scaffold_7 AUGUSTUS CDS 3619561 3619882 0.24 - 2 transcript_id "g783.t1"; gene_id "g783"; Scaffold_7 AUGUSTUS CDS 3619981 3620767 0.72 - 0 transcript_id "g783.t1"; gene_id "g783"; Scaffold_7 AUGUSTUS start_codon 3620765 3620767 . - 0 transcript_id "g783.t1"; gene_id "g783"; # protein sequence = [MVISSSSRRKSIAVVQEGRVNKPRKKRAYSSFGTGKLSPLTRSRLSIVSAVPILNTESTDHEQQGNVKGILKARPSIA # SSSQSSNSPASQESRPHSQSFAEESTAATESMDLTHDYQVPIHDNHARKSLGRRVSFREKVHVRYFEGDNTGSSAASQESPGSSGGPPSSDNDPPPPS # APVLNDENAYPGANRRRSSFRKSIAMTEDMDMTSTSAGAFLFDGVNNSALLDEDMDMDDNNSDMDVTQSFGGNLRRRSSVAQSALLLPLSQSLRPANQ # DDAWLALVKATHSGNASMAASDDVDGDGPDDADIEAMIARDAGRRYTFNFNDVSNDSISDASFGNSGDDENRTLNLTQMIGRNSLGGALGRPSIASAP # PAEPHPSAPPPLVAKPQSGTSPRKLPVFMPKSPTKQVTKQFSAAFAPPVSRPTPKKSTGPSGPESSQSAAKKRERKISDPSLPAVESEQPSPAKRQAI # EDKWVNKVGPTGSVTKPSTGAGTEEPRPLPPTKKAPFQSVPVPSSSQPASGIRRPSGYFARRKSLGAGLCKYVFGVAASTRRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g783 ### # start gene g784 Scaffold_7 AUGUSTUS gene 3622885 3623912 0.27 - . g784 Scaffold_7 AUGUSTUS transcript 3622885 3623912 0.27 - . g784.t1 Scaffold_7 AUGUSTUS stop_codon 3622885 3622887 . - 0 transcript_id "g784.t1"; gene_id "g784"; Scaffold_7 AUGUSTUS CDS 3622885 3623347 0.54 - 1 transcript_id "g784.t1"; gene_id "g784"; Scaffold_7 AUGUSTUS CDS 3623617 3623912 0.53 - 0 transcript_id "g784.t1"; gene_id "g784"; Scaffold_7 AUGUSTUS start_codon 3623910 3623912 . - 0 transcript_id "g784.t1"; gene_id "g784"; # protein sequence = [MMPDNLLTASILGTAVYVYCALAESSTSPDGDSDMSFYIDGSLKGTFVKTAPGNNNVYDYAIPVFSIDSLSVGMHNFT # LQNGHVNGTKSLVLLDEIIYTKRQQPQGQRATIDSPGPVAAAWTVGHPASFGPGGTALSSRQQLLNTELEHPDSAGANPYNPYSPTQIQSSAYLSSVS # GIQPDPDVHNTSSAYISSASGPTHGIHPDPDAHNTSTSASFSMIDGESPPAYDDRYLKAGGASLRVKERKTAIMNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g784 ### # start gene g785 Scaffold_7 AUGUSTUS gene 3625509 3626201 0.54 + . g785 Scaffold_7 AUGUSTUS transcript 3625509 3626201 0.54 + . g785.t1 Scaffold_7 AUGUSTUS start_codon 3625509 3625511 . + 0 transcript_id "g785.t1"; gene_id "g785"; Scaffold_7 AUGUSTUS CDS 3625509 3626201 0.54 + 0 transcript_id "g785.t1"; gene_id "g785"; Scaffold_7 AUGUSTUS stop_codon 3626199 3626201 . + 0 transcript_id "g785.t1"; gene_id "g785"; # protein sequence = [MYIGIQDTITREHFMTWAAKDSNGKPVAQPIMMIARYLNMDTSLRVFCGNHIPPHATKEISDKYWAVTQALELVNFPF # ALPGTKVYKAKQAAKVAMDWLTLAARNSKIAIANGAEPECLIDEWMRICADPTYKGRRDFSDDEIAMVVFSFLFASQDAMSSGLIFGFQHLADHPEIL # AKVREEQERVRQGNFDSPLTLELMDQMPYLQAVVKESLRVKPPVTMVCCLRVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g785 ### # start gene g786 Scaffold_7 AUGUSTUS gene 3631026 3631391 0.67 + . g786 Scaffold_7 AUGUSTUS transcript 3631026 3631391 0.67 + . g786.t1 Scaffold_7 AUGUSTUS start_codon 3631026 3631028 . + 0 transcript_id "g786.t1"; gene_id "g786"; Scaffold_7 AUGUSTUS CDS 3631026 3631391 0.67 + 0 transcript_id "g786.t1"; gene_id "g786"; Scaffold_7 AUGUSTUS stop_codon 3631389 3631391 . + 0 transcript_id "g786.t1"; gene_id "g786"; # protein sequence = [MSARRNKSKSSKAKKVKEFTPVVDQVMRKSSSDESMAVSSSLNTSIPRTPITSRTPVSSRMAMLEDGDEELELNLLGD # QERREARQGLEQEEEAEELTEHAKRPISSKDKRAMVLLCVLCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g786 ### # start gene g787 Scaffold_7 AUGUSTUS gene 3633735 3634088 0.65 + . g787 Scaffold_7 AUGUSTUS transcript 3633735 3634088 0.65 + . g787.t1 Scaffold_7 AUGUSTUS start_codon 3633735 3633737 . + 0 transcript_id "g787.t1"; gene_id "g787"; Scaffold_7 AUGUSTUS CDS 3633735 3634088 0.65 + 0 transcript_id "g787.t1"; gene_id "g787"; Scaffold_7 AUGUSTUS stop_codon 3634086 3634088 . + 0 transcript_id "g787.t1"; gene_id "g787"; # protein sequence = [MSTTTMHFGPEWMRTKPQPASRIQSPPSPPPPNASGHTASTYSSLLTTTVAAPAENKDEAHPFRYTKEEMLRIYREGG # GKGGLGLEVERWDGVVRETVTDPIGLKEIGEAEKKVTEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g787 ### # start gene g788 Scaffold_7 AUGUSTUS gene 3634432 3634974 0.93 + . g788 Scaffold_7 AUGUSTUS transcript 3634432 3634974 0.93 + . g788.t1 Scaffold_7 AUGUSTUS start_codon 3634432 3634434 . + 0 transcript_id "g788.t1"; gene_id "g788"; Scaffold_7 AUGUSTUS CDS 3634432 3634974 0.93 + 0 transcript_id "g788.t1"; gene_id "g788"; Scaffold_7 AUGUSTUS stop_codon 3634972 3634974 . + 0 transcript_id "g788.t1"; gene_id "g788"; # protein sequence = [MPSPSPRGRLGHTPGFDGVLNGGESWVARRRASEGLLPKIPANSARDPGEDSKELEIREEDEENHLDSNPEPDPQRGS # KATDQLAGGLAMQKPDKIESGAALDVPATLSVSNSPASTSASIGLPPGIVDLSSVEWSYLDPQGQVQGILIDFLHTIQSYNKYIRSIPSKCDAEMGRR # RFLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g788 ### # start gene g789 Scaffold_7 AUGUSTUS gene 3635021 3637174 0.85 + . g789 Scaffold_7 AUGUSTUS transcript 3635021 3637174 0.85 + . g789.t1 Scaffold_7 AUGUSTUS start_codon 3635021 3635023 . + 0 transcript_id "g789.t1"; gene_id "g789"; Scaffold_7 AUGUSTUS CDS 3635021 3636787 0.88 + 0 transcript_id "g789.t1"; gene_id "g789"; Scaffold_7 AUGUSTUS CDS 3636884 3637174 0.89 + 0 transcript_id "g789.t1"; gene_id "g789"; Scaffold_7 AUGUSTUS stop_codon 3637172 3637174 . + 0 transcript_id "g789.t1"; gene_id "g789"; # protein sequence = [MGDLKRLVGSTDKVFLTPIPLYGPPGLIRRTDSPFSNLNPNPNEGGYHNGPLQPSPVRTLRNSTLDSFSSNYSDSPTS # SFGAAGRFGDGSPDPAAFGGRAAPQYVLPGEMGSRFNGYPGEASPALSGRSGFAAPANDYRSPGFSNVTPGRANSLDVNPGFASPATSWSGFDGMANG # RGGSIDSSIYHPGHPNAGMSSPFGNNGFQTSFGTQNHPSLGMGGLAFEQYPPSPSVQFTDTSVMPNAVPDIFDHNQLQQTPARPSQPSTNSSAAASPW # GSGDSNINKRNVQFDTTPAKPPAVNNQSPWGTGRVSRSSSQANDLSPWLAASKGVTDNWKEEPSVISDLTSNNLGQHNREEKQLEETAEDVTEIITRP # KANIAETQADPVLAPAVPLPTPSHTKTTSRQAQQGTQVKAATTEPVHVISDIPEPQSVVLPSAAPKAWAKEEDPKKSATSLRKIQDAEAKKVEARKTA # EREKERAARVATQSIVSPSPEDVQTFTASWGLPTSKAGKGSAAVTPKEFLPPTPASASAAPPVWSTTAAKPVATKKTMKEIQEEEERRKKTVAKETVA # NVASRRAYAESTSKVSDCSTFTPVATTPTRPPATPTAAAAVSTTSITRVNGAATRPTPTPVSKAPVNSAKVDDFPIAPSTDFLKWLAESLKGLNNTVN # GELFYLGCFSTYNNYYVSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g789 ### # start gene g790 Scaffold_7 AUGUSTUS gene 3638188 3638832 0.99 + . g790 Scaffold_7 AUGUSTUS transcript 3638188 3638832 0.99 + . g790.t1 Scaffold_7 AUGUSTUS start_codon 3638188 3638190 . + 0 transcript_id "g790.t1"; gene_id "g790"; Scaffold_7 AUGUSTUS CDS 3638188 3638832 0.99 + 0 transcript_id "g790.t1"; gene_id "g790"; Scaffold_7 AUGUSTUS stop_codon 3638830 3638832 . + 0 transcript_id "g790.t1"; gene_id "g790"; # protein sequence = [MYPISCTSPRLLSICLAVLVLLAVNVVGSPIGSPVLALASPSVTLTSVHPLASNSPWNLNAVVTPTETVKDEIYFWMD # GDNAELYIGSRRFGLSNGHERLEPKEVGIPQTGTRKIGQVIYPSTNVKEQVLQILGKCGIRITTSIKASPVRICRGHYFQNIIQKLVKVSEMNSLEVK # DENGGGDLDSLFTNLLRDTGFLGTSKKTVEKSYRFRPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g790 ### # start gene g791 Scaffold_7 AUGUSTUS gene 3640632 3642145 0.97 + . g791 Scaffold_7 AUGUSTUS transcript 3640632 3642145 0.97 + . g791.t1 Scaffold_7 AUGUSTUS start_codon 3640632 3640634 . + 0 transcript_id "g791.t1"; gene_id "g791"; Scaffold_7 AUGUSTUS CDS 3640632 3640802 0.97 + 0 transcript_id "g791.t1"; gene_id "g791"; Scaffold_7 AUGUSTUS CDS 3640874 3642145 1 + 0 transcript_id "g791.t1"; gene_id "g791"; Scaffold_7 AUGUSTUS stop_codon 3642143 3642145 . + 0 transcript_id "g791.t1"; gene_id "g791"; # protein sequence = [MIFIDTSQEKPKAIEVEAPRTVSDSETRPVSSLSLKEQLEARLNNDQSNEIKDTIQANTSSPSVRSHKGKEKASEPQP # EVKPTPGAAHKALESVRNIEASLTALQDEFEFPSEVDFSPAPSRSSSPVRDDISESDTLTLRKLAYTARNHPIRSYEQALSRLLVQLDEIESHGNADV # RISRKAVVARVEGALEELEQKVESRWNKWNKSHRVEREEEVEEVQKKVEDAAESSQENQAALTPNDVVAVQDAVELAPDLPTASPSPAYPSAVDVSAD # DVSQRPSYAEVAKHHLSEASLPAADSSSTVPDALPPVEVTEHIENSSSVEASDPQVERHSQDEVVPSDANVEASVVEPVHRAEDNVTGIEAQAETLTE # PEVPASSYPPTSNSSEPSSYPPVSSVSTVAPIRPPETQSVSDSDDITEDLSSSAEISEDIHPIVISEESEAEVVDTFLLPEDNASDVASKQSPHDLED # VGSDWSEVDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g791 ### # start gene g792 Scaffold_7 AUGUSTUS gene 3646716 3647232 0.71 - . g792 Scaffold_7 AUGUSTUS transcript 3646716 3647232 0.71 - . g792.t1 Scaffold_7 AUGUSTUS stop_codon 3646716 3646718 . - 0 transcript_id "g792.t1"; gene_id "g792"; Scaffold_7 AUGUSTUS CDS 3646716 3646979 0.8 - 0 transcript_id "g792.t1"; gene_id "g792"; Scaffold_7 AUGUSTUS CDS 3647179 3647232 0.73 - 0 transcript_id "g792.t1"; gene_id "g792"; Scaffold_7 AUGUSTUS start_codon 3647230 3647232 . - 0 transcript_id "g792.t1"; gene_id "g792"; # protein sequence = [MLRFSVMLSAASPTLQRMDVATSNRCLDENRQQLVNAGAIPVLVSLLNSPDTDVQYYCTTALSNIAVDGKVVSEFLAC # ITDEMGYSQGQIGRSWPTLNPNWLQAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g792 ### # start gene g793 Scaffold_7 AUGUSTUS gene 3648365 3648685 0.91 - . g793 Scaffold_7 AUGUSTUS transcript 3648365 3648685 0.91 - . g793.t1 Scaffold_7 AUGUSTUS stop_codon 3648365 3648367 . - 0 transcript_id "g793.t1"; gene_id "g793"; Scaffold_7 AUGUSTUS CDS 3648365 3648685 0.91 - 0 transcript_id "g793.t1"; gene_id "g793"; Scaffold_7 AUGUSTUS start_codon 3648683 3648685 . - 0 transcript_id "g793.t1"; gene_id "g793"; # protein sequence = [MGQRSDAEESGKIECSVGTAELDGSFCSARKAKEAYAQTELGKLQNRMAFGEAEQEVGAFDQTKGLGMIGSGKVRAGM # GFKEQRYFTCSQSSLLSVTNILQPRCQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g793 ### # start gene g794 Scaffold_7 AUGUSTUS gene 3649814 3650191 0.67 - . g794 Scaffold_7 AUGUSTUS transcript 3649814 3650191 0.67 - . g794.t1 Scaffold_7 AUGUSTUS stop_codon 3649814 3649816 . - 0 transcript_id "g794.t1"; gene_id "g794"; Scaffold_7 AUGUSTUS CDS 3649814 3650191 0.67 - 0 transcript_id "g794.t1"; gene_id "g794"; Scaffold_7 AUGUSTUS start_codon 3650189 3650191 . - 0 transcript_id "g794.t1"; gene_id "g794"; # protein sequence = [MSGLADELLADLDGLDDDVDDYNEEESKENEAGSSTETTRKRKAEGSDDEMADDEAGDTGENQGAEGMVLAGGIRPAE # ELDAEDVQAMDLGGITDVSKIAKLEGSKKMLDIIKVRLLTISLFIAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g794 ### # start gene g795 Scaffold_7 AUGUSTUS gene 3661739 3663521 0.48 + . g795 Scaffold_7 AUGUSTUS transcript 3661739 3663521 0.48 + . g795.t1 Scaffold_7 AUGUSTUS start_codon 3661739 3661741 . + 0 transcript_id "g795.t1"; gene_id "g795"; Scaffold_7 AUGUSTUS CDS 3661739 3662364 0.49 + 0 transcript_id "g795.t1"; gene_id "g795"; Scaffold_7 AUGUSTUS CDS 3662855 3663521 0.68 + 1 transcript_id "g795.t1"; gene_id "g795"; Scaffold_7 AUGUSTUS stop_codon 3663519 3663521 . + 0 transcript_id "g795.t1"; gene_id "g795"; # protein sequence = [MASVSLQMDPWGPDMPEEEQGGWFVSRLMVGNLPPIQMLTRRRPPLLTLADELKLYHPSLQTLDILLEPLGKLGALDD # RILEVREYTRMLFWSINGSRMKWDDTDFAYLFFHPSETSFTQWNARRAWWKHNRMDVDGTASTVRSPTDFTIPALTFGEIFHYPSDIGMVYNGSSSFK # AYEFVQWKWDSLNEEEEATLLERYARSEDVQIRISFSTLLNASINPPIPRSFSWEEVEAAISLTNCSIGKTDLRCSEQVQNSDTPESAMINTLLNPSM # NGSTEENEDKKKKKKGKHSQQLSTKVLADVVESLIGAAYVHGGLSLGYECARFFKLNIESWLPIPDRIISVLMRADMMYTSFTSTSPSEEIQFPPQLS # NVEKIIGYTFLRPTLLLEALTHPSCQEDHGTISYERMEVNTFVIIFSSRPSDSSLVPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g795 ### # start gene g796 Scaffold_7 AUGUSTUS gene 3664032 3664475 0.85 + . g796 Scaffold_7 AUGUSTUS transcript 3664032 3664475 0.85 + . g796.t1 Scaffold_7 AUGUSTUS start_codon 3664032 3664034 . + 0 transcript_id "g796.t1"; gene_id "g796"; Scaffold_7 AUGUSTUS CDS 3664032 3664475 0.85 + 0 transcript_id "g796.t1"; gene_id "g796"; Scaffold_7 AUGUSTUS stop_codon 3664473 3664475 . + 0 transcript_id "g796.t1"; gene_id "g796"; # protein sequence = [MDVVREVMLSLGLYQILERIVKEDLDVLHPVSRLSMWAATQTVTDPDADPEAIHKKIKYDFKKERGRISCAVLVDGIE # LEGSMVDDVYGGKATQEEVRLAAAEKAIQILRLRDVGVEYESLKKKRKPKPKKQKEGKTSNKAPEIDDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g796 ### # start gene g797 Scaffold_7 AUGUSTUS gene 3670286 3670861 0.74 + . g797 Scaffold_7 AUGUSTUS transcript 3670286 3670861 0.74 + . g797.t1 Scaffold_7 AUGUSTUS start_codon 3670286 3670288 . + 0 transcript_id "g797.t1"; gene_id "g797"; Scaffold_7 AUGUSTUS CDS 3670286 3670861 0.74 + 0 transcript_id "g797.t1"; gene_id "g797"; Scaffold_7 AUGUSTUS stop_codon 3670859 3670861 . + 0 transcript_id "g797.t1"; gene_id "g797"; # protein sequence = [MPGEWPEHSPSTTTVHGDNTDEGYQSSDSARTFTTISSVFGWNSEKSDWSDSPIAEETQGGPAPQFVPVRFAPPHIQQ # SSLPIPPRTRSPPPPPPILPEIVDLVKEQQFDGSYNLNDKLRLLVGDAAYSEPLTRGLDHKTWATALSVAYIKIQLGNQRELVDDLVYKSLEYLQIGG # NEYLIERATTLITTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g797 ### # start gene g798 Scaffold_7 AUGUSTUS gene 3670878 3671722 0.29 - . g798 Scaffold_7 AUGUSTUS transcript 3670878 3671722 0.29 - . g798.t1 Scaffold_7 AUGUSTUS stop_codon 3670878 3670880 . - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_7 AUGUSTUS CDS 3670878 3670916 0.98 - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_7 AUGUSTUS CDS 3671049 3671087 0.97 - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_7 AUGUSTUS CDS 3671126 3671290 0.77 - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_7 AUGUSTUS CDS 3671339 3671472 0.49 - 2 transcript_id "g798.t1"; gene_id "g798"; Scaffold_7 AUGUSTUS CDS 3671674 3671722 0.6 - 0 transcript_id "g798.t1"; gene_id "g798"; Scaffold_7 AUGUSTUS start_codon 3671720 3671722 . - 0 transcript_id "g798.t1"; gene_id "g798"; # protein sequence = [MYHGFDWYGARFGSPRDYSGPDQHGSGLRMDNYGGGFGAGMGYPGGGYTEPEPSQQIMVRNLPWSTANEDLVELFETT # GQVELAEILFEGTRSKGCGVVQFAQVTEGETAIGECRLQNSNNICMAADPWTKISPTFTLSNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g798 ### # start gene g799 Scaffold_7 AUGUSTUS gene 3673660 3674109 0.48 + . g799 Scaffold_7 AUGUSTUS transcript 3673660 3674109 0.48 + . g799.t1 Scaffold_7 AUGUSTUS start_codon 3673660 3673662 . + 0 transcript_id "g799.t1"; gene_id "g799"; Scaffold_7 AUGUSTUS CDS 3673660 3674109 0.48 + 0 transcript_id "g799.t1"; gene_id "g799"; Scaffold_7 AUGUSTUS stop_codon 3674107 3674109 . + 0 transcript_id "g799.t1"; gene_id "g799"; # protein sequence = [MKRKLTILSPVQQECIPQAVLGMDVLCQAKSGHGKTAVFVLATLQQLEPINGQVSVLVLCHTRELAFQIKNEYTRFAK # YMPDVRISTFYGGTPVSQKTLKFYVTRQKCPHIVVATPGRLNALARDKVLDAKNVKHFVLDECDKMLEQLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g799 ### # start gene g800 Scaffold_7 AUGUSTUS gene 3679934 3680522 0.4 + . g800 Scaffold_7 AUGUSTUS transcript 3679934 3680522 0.4 + . g800.t1 Scaffold_7 AUGUSTUS start_codon 3679934 3679936 . + 0 transcript_id "g800.t1"; gene_id "g800"; Scaffold_7 AUGUSTUS CDS 3679934 3679965 0.4 + 0 transcript_id "g800.t1"; gene_id "g800"; Scaffold_7 AUGUSTUS CDS 3680031 3680067 0.41 + 1 transcript_id "g800.t1"; gene_id "g800"; Scaffold_7 AUGUSTUS CDS 3680160 3680522 0.43 + 0 transcript_id "g800.t1"; gene_id "g800"; Scaffold_7 AUGUSTUS stop_codon 3680520 3680522 . + 0 transcript_id "g800.t1"; gene_id "g800"; # protein sequence = [MAENPKRTFSFLATWKGLSSAFTPEEVAAVLRSQSQNNWMNKNFSGALEDTLQALKILGVEVNPAPTRREAAHMFERV # KNEILAIGFDEILSIPRANDPRTELAVRLLNDAGTNAYWSPTPFSFAEVIGLTVCNFVTLSEGAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g800 ### # start gene g801 Scaffold_7 AUGUSTUS gene 3689205 3690356 0.19 + . g801 Scaffold_7 AUGUSTUS transcript 3689205 3690356 0.19 + . g801.t1 Scaffold_7 AUGUSTUS start_codon 3689205 3689207 . + 0 transcript_id "g801.t1"; gene_id "g801"; Scaffold_7 AUGUSTUS CDS 3689205 3689222 0.89 + 0 transcript_id "g801.t1"; gene_id "g801"; Scaffold_7 AUGUSTUS CDS 3689292 3689657 0.26 + 0 transcript_id "g801.t1"; gene_id "g801"; Scaffold_7 AUGUSTUS CDS 3690006 3690356 0.63 + 0 transcript_id "g801.t1"; gene_id "g801"; Scaffold_7 AUGUSTUS stop_codon 3690354 3690356 . + 0 transcript_id "g801.t1"; gene_id "g801"; # protein sequence = [MSESRQGVPNKRYTESLAAVGSGVDLGQDENLDNLNVQNVEGHLDVDIAELSLGQRLTAVSGADDVQRDSDSEPSSNK # KQKSKSTQDGLSVVPAASLTRTLIQALHSSDSRLMETCLAHSDTTLIRNTRCDPSTAPAPIALRSAKSSSVARTVEKTHYVEGESEDEDPRMDVEVEV # DSGNEDADIEDIELGGSSQEESEEEEEEEEDDDDEEEEDDDEEDPTMNGFIDDEAEEEFTDEEGDESE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g801 ### # start gene g802 Scaffold_7 AUGUSTUS gene 3698752 3698976 0.83 + . g802 Scaffold_7 AUGUSTUS transcript 3698752 3698976 0.83 + . g802.t1 Scaffold_7 AUGUSTUS start_codon 3698752 3698754 . + 0 transcript_id "g802.t1"; gene_id "g802"; Scaffold_7 AUGUSTUS CDS 3698752 3698976 0.83 + 0 transcript_id "g802.t1"; gene_id "g802"; Scaffold_7 AUGUSTUS stop_codon 3698974 3698976 . + 0 transcript_id "g802.t1"; gene_id "g802"; # protein sequence = [MESVLSAVSASLSAASSQPVNTSSPLRLTSDTMADLSLQYPSEDFDDGAVVDDMIFDDEGQGVGIEGDLDKEED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g802 ### # start gene g803 Scaffold_7 AUGUSTUS gene 3699721 3701363 0.69 - . g803 Scaffold_7 AUGUSTUS transcript 3699721 3701363 0.69 - . g803.t1 Scaffold_7 AUGUSTUS stop_codon 3699721 3699723 . - 0 transcript_id "g803.t1"; gene_id "g803"; Scaffold_7 AUGUSTUS CDS 3699721 3700055 0.99 - 2 transcript_id "g803.t1"; gene_id "g803"; Scaffold_7 AUGUSTUS CDS 3700112 3701363 0.69 - 0 transcript_id "g803.t1"; gene_id "g803"; Scaffold_7 AUGUSTUS start_codon 3701361 3701363 . - 0 transcript_id "g803.t1"; gene_id "g803"; # protein sequence = [MSSSLPPHRLNKRTASYSSTHNGSPGSEWIYRRPKSPSASSPPRPSAIKYARRTVSDSTASASTPSPASTAESSRCVT # PTSTTYRSGLAASYFPDVSTSCLNASSSNLPAHLINGNRDTNVNNGSGSSIGSIGSIGVMIPSSLGLNSSASSLTRQPSSRRSKASSTSGKTGAFWNS # ILHPRSGPNSVSENASTPNSPPGSRIARLSLGRAKNKQEQQPPPSSPLAVHTATAIPSIWSGAILESANGTSPKRRKARGSLKELGISRIPVSSRITG # NRSPTSPTFSSPPIYNTPVKRRTSHGRSGSFSSTTSSSTSSAAFSNSVSSISSSTPSSPLTPSTPVSPTFGGFAKTKKFQPKFEPHHRAIVEVVEDDD # SSHMDVQRRKSPSPTKSILASRIPYSESSSELINSSSKFDSGVDLVSSNKSVKFVEKPTVHYASAIYESWDGTTGSGPFEYNNMGIDLSEMDMDTNED # NEGDGYMSEETAEQTAFINSHPYAASDLNLAGDMAPAAITAADEVKLNVTRAFCRRFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g803 ### # start gene g804 Scaffold_7 AUGUSTUS gene 3703725 3706144 0.15 + . g804 Scaffold_7 AUGUSTUS transcript 3703725 3706144 0.15 + . g804.t1 Scaffold_7 AUGUSTUS start_codon 3703725 3703727 . + 0 transcript_id "g804.t1"; gene_id "g804"; Scaffold_7 AUGUSTUS CDS 3703725 3703912 0.25 + 0 transcript_id "g804.t1"; gene_id "g804"; Scaffold_7 AUGUSTUS CDS 3704012 3704048 0.33 + 1 transcript_id "g804.t1"; gene_id "g804"; Scaffold_7 AUGUSTUS CDS 3704183 3706144 0.57 + 0 transcript_id "g804.t1"; gene_id "g804"; Scaffold_7 AUGUSTUS stop_codon 3706142 3706144 . + 0 transcript_id "g804.t1"; gene_id "g804"; # protein sequence = [MARFTRSSASENHQSSSPKSPPTSSKKRKRANSSNNELDEQPADKLQRTQSLPIPSVGDVPIKIDSQGFLDRVFPSAV # HHLFPVSLRNPRSRTTKLASQQQAFCNIALSLLDQASVHSVELPGDLETIIPDDYPPDKPSSSTSHIHHKPRYALVQHLPSGDYWTSLSSESSSLELK # ALPKGYSELVSILPSPYPSTSTSNIPTLGSFHNSVLPPLKNKPPSARQISSGSFLDYGIYGSFAPSFDQESEELGRQELGQILYAWETKKTQKAKQLN # SWITEKERERRTRSASPVAEDEAQEVRPVIDVDAEIEELLPPDQVEAIKSGLGSLELELAVSELLDKNKRALRRLQELQTERLMADGGGSSTPQEGSE # EWDTGTSLVLSSDLLAHLDMYSLAQAILDSLTALASLRPRSSKHEDAPLIPSPAILHALHRTLPLSPSPGWYGNLPPGRTTVIRDDNTMRVKPNVPPP # STPVPTPTPAVSTTPAVSNSGYAGYSYSAYPGTPAAQQNQQNQYRPGTANTYMYKPPTASGATSYYPNSYSYQHLYAQPGQTAYTPASGAGTTAYSSW # YTAYAPQNATTVPAAATPAVNGSGSGSGSGGRSTPATPQFAPSYSSFFNNGSSLAAAAAATVNWSAASTQARPPAVANTVLKPGQWNASSSAASPYSA # NTPSPATPTLPSHLRGQSQNHPSIQNGVAQLQAPLGQQSNFSAYQPGTTVPFTPAATTSSAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g804 ### # start gene g805 Scaffold_7 AUGUSTUS gene 3712292 3713557 0.69 + . g805 Scaffold_7 AUGUSTUS transcript 3712292 3713557 0.69 + . g805.t1 Scaffold_7 AUGUSTUS start_codon 3712292 3712294 . + 0 transcript_id "g805.t1"; gene_id "g805"; Scaffold_7 AUGUSTUS CDS 3712292 3712456 0.88 + 0 transcript_id "g805.t1"; gene_id "g805"; Scaffold_7 AUGUSTUS CDS 3712542 3712584 1 + 0 transcript_id "g805.t1"; gene_id "g805"; Scaffold_7 AUGUSTUS CDS 3712662 3713022 0.85 + 2 transcript_id "g805.t1"; gene_id "g805"; Scaffold_7 AUGUSTUS CDS 3713071 3713557 0.79 + 1 transcript_id "g805.t1"; gene_id "g805"; Scaffold_7 AUGUSTUS stop_codon 3713555 3713557 . + 0 transcript_id "g805.t1"; gene_id "g805"; # protein sequence = [MGRIFVGLCQVGAWGCFDEFNRLEERILSAVSQQVQTIQQGLAALVKNPNTEIELESSSPLTLPTLGVPNYRMAMTRP # DRELIAQVMLFSQGFRTAETLASKIVPFFNLCDEQLSPQPHYDFGLRALKAVLASAGILKRERLSSAREKADADDAAIGLSDAISEQIILIQSVTETI # VPKLVADDVPLLTNLLADVFPGVDYMPVDLDRLRDEIYKVCKERRLVTGERWIAKILQLYQIQKIQHGLMMVGPSGTGKTNAWRVLLAALERFDGIEG # VDYVIDPKAMHKDALYGTLDSTTREWNDGLFTHILRRIVDDARGESGKRHWIIFDGDVDPEWVENLNRLVYYSQSIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g805 ### # start gene g806 Scaffold_7 AUGUSTUS gene 3713718 3715595 0.57 + . g806 Scaffold_7 AUGUSTUS transcript 3713718 3715595 0.57 + . g806.t1 Scaffold_7 AUGUSTUS start_codon 3713718 3713720 . + 0 transcript_id "g806.t1"; gene_id "g806"; Scaffold_7 AUGUSTUS CDS 3713718 3714177 0.58 + 0 transcript_id "g806.t1"; gene_id "g806"; Scaffold_7 AUGUSTUS CDS 3714338 3714357 0.91 + 2 transcript_id "g806.t1"; gene_id "g806"; Scaffold_7 AUGUSTUS CDS 3714474 3715595 0.93 + 0 transcript_id "g806.t1"; gene_id "g806"; Scaffold_7 AUGUSTUS stop_codon 3715593 3715595 . + 0 transcript_id "g806.t1"; gene_id "g806"; # protein sequence = [MIWFSDDIVETSMVYENYLSTLSTTPIDSDEEDAGDALARRNNEVLPSDAAASAALETQKQVASVLERYFSEGDLVSS # ALAFADSIEHIMDFTTTRALNTLFSLINKTVRNIIEYNFQHPDFPLPPERVEQYVTKRLLVSIVWAFSGDAKLDLLTAADVVRPSEITDMEVVGLNFS # SATTPELILKTFEQYCEYRKTPNGVILAPIQIGRWLVVFCDEINLPAADKYGTQRVISFIRQLVESGGYWRTSDMAWVKLERIQFVGACNPPTDPGRV # PLSHRFLRHAPLVMVDYPGEVSLKQIYGTYNRAALKVVPNLRTYAEPLTDAMVSFYLASQRRFTTDAQAHYVYSPRELTRWVRGIYEAIRPLEILSVE # GLVRVWAHEALRLFQDRLVTEEERAWTDENIDVVALEYFPTISKDEALRRPILFSNWTSKDYIPVDRETLRDYTKARLKVFYEEELDVPLVLFNDVLD # HVLRIDRVFRQVQGHLLLIGVSGSGKVIFVFCYLTSMLIIPSDNFISRRLDEWSEHIPNQGLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g806 ### # start gene g807 Scaffold_7 AUGUSTUS gene 3716300 3717337 0.27 + . g807 Scaffold_7 AUGUSTUS transcript 3716300 3717337 0.27 + . g807.t1 Scaffold_7 AUGUSTUS start_codon 3716300 3716302 . + 0 transcript_id "g807.t1"; gene_id "g807"; Scaffold_7 AUGUSTUS CDS 3716300 3717337 0.27 + 0 transcript_id "g807.t1"; gene_id "g807"; Scaffold_7 AUGUSTUS stop_codon 3717335 3717337 . + 0 transcript_id "g807.t1"; gene_id "g807"; # protein sequence = [MSGLHAEKRDELEEQQRHLHVGLDKLRDTVTQVEELRKSLAIKRSQLEAKDAEANEKLKRMVADQQEAEQKKSASIDI # QAALVEQDKHIEQRRAIATADLADAEPAVLEAQSAVGNIKRQHLQEVRAMANPPEAVKLAMESVCTILGHKIDSWRTVQGIIRRDDFIQRIVNFDTTT # QMTKPLRDLMKRDFLSRPSYNFETVNRASKACGPLVKWALAQVKFSEILDRVEPLRNEVLSLEQQAETTKKQASAIINMIAELEGKIGRYKEEYALLI # SETQAIKSEMERVQSKVDRSMKLLESLSSERGRWEAGSRTFDDEMSTIVGDVLLSAAFLAYGDFSISIIVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g807 ### # start gene g808 Scaffold_7 AUGUSTUS gene 3717490 3719809 0.58 + . g808 Scaffold_7 AUGUSTUS transcript 3717490 3719809 0.58 + . g808.t1 Scaffold_7 AUGUSTUS start_codon 3717490 3717492 . + 0 transcript_id "g808.t1"; gene_id "g808"; Scaffold_7 AUGUSTUS CDS 3717490 3718687 0.62 + 0 transcript_id "g808.t1"; gene_id "g808"; Scaffold_7 AUGUSTUS CDS 3718746 3719809 0.93 + 2 transcript_id "g808.t1"; gene_id "g808"; Scaffold_7 AUGUSTUS stop_codon 3719807 3719809 . + 0 transcript_id "g808.t1"; gene_id "g808"; # protein sequence = [MLKRFNRYPLIIDPTGQATTFLMNEYKDRKITITSFLDEAFLKVLESALRFGNPLLIQDVERLDPILNAVLNKEIRRT # GGRVLIRLGSQDIDFSPSFTMFLSTRDPSVEFSPDICSRVTFVNFTMTRSSLQSQSLDQVLKVERPDTERKRTDLMKIQGEFRLRLRTLEKLLLQALN # ESSGNILDDDKVIDTLETLKREAAEITHKVEETDVVMKEVEQVTAEYLPLAQACSAVFFVLEQMNVVNHFYQFSLQFFLDIFDYVLHHNPNLRNISDY # NQRRDILLNDLFLVVYKRTSRALLYRDRVMLAVLLAQVKLRGVEEISDELEFLLESGDNVLASASSNEDITFLTMEQAQRLESFAKNHIFKPVVQHLR # EHEDEWRSFLESNTPELSVPIPWEASTPAVEALRAMLIIKCLRPDRLLQSTAQFVHNVFNTDVSAQSVYELGAMVSDEVPAATPLALVSVTGYDASYR # VENLIKNTGARSSSVAMGSQEGFSLADQAIASAARQGTWVLLKNVHLAPEWLGQLEKKLQTLNPHRNFRLFLTMEANPSIPVNILRQSRLLMNEPPPG # IKANLLDSLRNIAPSRLSQGPAEKVRLYFLLAWFQAVAQERLRYVPLGWSKVYDFNDSDMSSALDTIDTWLGAVSKGRANIDPATIPWDALRTLIKQS # VYGGRVDSEFDQRILDAFVDALFTPNAYHVDFDLVPSLTGQKMLGVPDGTKIDQFLSWVQQLPDREPPSWLSLPPTAERVIAIAQGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g808 ### # start gene g809 Scaffold_7 AUGUSTUS gene 3726071 3726502 0.59 + . g809 Scaffold_7 AUGUSTUS transcript 3726071 3726502 0.59 + . g809.t1 Scaffold_7 AUGUSTUS start_codon 3726071 3726073 . + 0 transcript_id "g809.t1"; gene_id "g809"; Scaffold_7 AUGUSTUS CDS 3726071 3726502 0.59 + 0 transcript_id "g809.t1"; gene_id "g809"; Scaffold_7 AUGUSTUS stop_codon 3726500 3726502 . + 0 transcript_id "g809.t1"; gene_id "g809"; # protein sequence = [MTTWPNLEPSISVLLVYNGTEASFNNAFAEFLSIPYTSSSPGSLSFLELSNAVHFPSGMGTLFSASSLAGTPANSDVS # VDDYLELYRQYNNFSSAFASSPDIGFTLLDFSPVLQSQIRAGYKKGGNPINPPLGTTGYSIILFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g809 ### # start gene g810 Scaffold_7 AUGUSTUS gene 3733326 3733832 0.88 + . g810 Scaffold_7 AUGUSTUS transcript 3733326 3733832 0.88 + . g810.t1 Scaffold_7 AUGUSTUS start_codon 3733326 3733328 . + 0 transcript_id "g810.t1"; gene_id "g810"; Scaffold_7 AUGUSTUS CDS 3733326 3733471 0.93 + 0 transcript_id "g810.t1"; gene_id "g810"; Scaffold_7 AUGUSTUS CDS 3733535 3733663 0.9 + 1 transcript_id "g810.t1"; gene_id "g810"; Scaffold_7 AUGUSTUS CDS 3733724 3733832 0.95 + 1 transcript_id "g810.t1"; gene_id "g810"; Scaffold_7 AUGUSTUS stop_codon 3733830 3733832 . + 0 transcript_id "g810.t1"; gene_id "g810"; # protein sequence = [MNYDKEVYGPDVEEFRPERFLLETEKGEYELKPEVENEDGHNSYGFGRRKCVGKHVADNALLIGICTILWAVNIEPVE # CKIDLARNTLDTVNPIPDFQCKFTPRFEGLESFLQHLRDNFEYFKQNRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g810 ### # start gene g811 Scaffold_7 AUGUSTUS gene 3737165 3738112 0.92 + . g811 Scaffold_7 AUGUSTUS transcript 3737165 3738112 0.92 + . g811.t1 Scaffold_7 AUGUSTUS start_codon 3737165 3737167 . + 0 transcript_id "g811.t1"; gene_id "g811"; Scaffold_7 AUGUSTUS CDS 3737165 3738112 0.92 + 0 transcript_id "g811.t1"; gene_id "g811"; Scaffold_7 AUGUSTUS stop_codon 3738110 3738112 . + 0 transcript_id "g811.t1"; gene_id "g811"; # protein sequence = [MSPQITPSGSGESVNPISGTSTPIASTNQSPVAHATVGGRRPSAISISSLNRPAFPLKLDLSSQSLRMSAEDAVSFLP # SGLRSPVTLAPKSARPIDYDIMAAFNDPRVDIDLTLTPAGSSSGMNLDLDSALGSSADKPIDLDMDGMDLDQAMSDLFGDSSEPDNTEANADGGGLFS # PHLGTTGEIGNSTNRVDDNFLSSIGVGGDNPNADIFASFGVGEGGDLTSPSGTISLPSTETLTAPSPGTLLASLSQSSTNTSQTQGLTMDESFDLGNL # GNLEFLSTENNSDVNLDSLSWMDTTGGNNDVTNGNPTTSTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g811 ### # start gene g812 Scaffold_7 AUGUSTUS gene 3742023 3742478 0.59 - . g812 Scaffold_7 AUGUSTUS transcript 3742023 3742478 0.59 - . g812.t1 Scaffold_7 AUGUSTUS stop_codon 3742023 3742025 . - 0 transcript_id "g812.t1"; gene_id "g812"; Scaffold_7 AUGUSTUS CDS 3742023 3742478 0.59 - 0 transcript_id "g812.t1"; gene_id "g812"; Scaffold_7 AUGUSTUS start_codon 3742476 3742478 . - 0 transcript_id "g812.t1"; gene_id "g812"; # protein sequence = [MGNRLTSDLAPPLLYHAVSQGALAIEIRSNDEESLKICQQITHRETALCCLAERACLRKLEGGCSVPVGIGSSLDGNV # LTITGCVTALDGSKHVEHTITETVASEEQAEVVGTKLAITLIETGAKEILDDITVDREMKIKLAQEKDEKIAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g812 ### # start gene g813 Scaffold_7 AUGUSTUS gene 3742647 3743162 0.55 - . g813 Scaffold_7 AUGUSTUS transcript 3742647 3743162 0.55 - . g813.t1 Scaffold_7 AUGUSTUS stop_codon 3742647 3742649 . - 0 transcript_id "g813.t1"; gene_id "g813"; Scaffold_7 AUGUSTUS CDS 3742647 3743162 0.55 - 0 transcript_id "g813.t1"; gene_id "g813"; Scaffold_7 AUGUSTUS start_codon 3743160 3743162 . - 0 transcript_id "g813.t1"; gene_id "g813"; # protein sequence = [MSNSSRTFVLASRGSQLAQIQTNLAMDNMKSLFASSKADAIPKFTTSFMSTAGDKNQSQALYLLGGKALWTKELEVAL # IEREVDMLVHSFKDVPTVLPEGCIIAGIMEREDPVDSLVVKKGSPWKTLDDLPNGSIVGTSSVRRVAQLKRKYPELVFQDVVSRLLVDNEYNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g813 ### # start gene g814 Scaffold_7 AUGUSTUS gene 3743574 3744068 0.5 - . g814 Scaffold_7 AUGUSTUS transcript 3743574 3744068 0.5 - . g814.t1 Scaffold_7 AUGUSTUS stop_codon 3743574 3743576 . - 0 transcript_id "g814.t1"; gene_id "g814"; Scaffold_7 AUGUSTUS CDS 3743574 3744068 0.5 - 0 transcript_id "g814.t1"; gene_id "g814"; Scaffold_7 AUGUSTUS start_codon 3744066 3744068 . - 0 transcript_id "g814.t1"; gene_id "g814"; # protein sequence = [MGVEGVKAIFYGPDFVTVSKDSEHPWAVIKPEIYSTLMEHFSSGQALFRSQEERDNAGPQDTRIYDTDSETVAMIKEL # LETRVRPAIMEDGGDIEYRGFDEAGSGMVKVKLKGSCRGCDSSTVTLKSGIERMLMHYIPEVKGVEQVNIFTLCTARTHSILQGVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g814 ### # start gene g815 Scaffold_7 AUGUSTUS gene 3744856 3746221 0.71 + . g815 Scaffold_7 AUGUSTUS transcript 3744856 3746221 0.71 + . g815.t1 Scaffold_7 AUGUSTUS start_codon 3744856 3744858 . + 0 transcript_id "g815.t1"; gene_id "g815"; Scaffold_7 AUGUSTUS CDS 3744856 3745860 0.77 + 0 transcript_id "g815.t1"; gene_id "g815"; Scaffold_7 AUGUSTUS CDS 3745925 3746221 0.71 + 0 transcript_id "g815.t1"; gene_id "g815"; Scaffold_7 AUGUSTUS stop_codon 3746219 3746221 . + 0 transcript_id "g815.t1"; gene_id "g815"; # protein sequence = [MHLTRKRTRRVSTNSITTLRSSRSEDGESAGVGEGHEEGKRTTSRLSEKSTTIGRTAPTLRPQRNRTTSLASVFPEST # EVSQGSFSLNSNVEAYKHHATLEDHSQTGLEKIIGSRLVETFLAVTAISEPSYVDAGLPTTSSSSFFPTSTPSSPRNGFPLISPRKDVFTPSSPSPLP # NTEKSRRDSRASTLSSSSSGHSKTMYDATLSRKGAVKPATGSPIASTSTFPSSPELPSSPVQPSVPAYFSPIHQPSTNPSFFFDPTSEFASWTDFSAV # KLKVELWAKIGNDSGPVNGKGKEKERPRETRDSNPPEWQVLEEWNVDLNELIPLPNINADDDPHHQLPSNTLLVTLNPPGQTFYAYVPILSQPSHRTM # DLASGYSSDPESTIRKNKEIDTKLDFAALPSRRRRQRGRQGQETAKEEYIARTAGWKDLFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g815 ### # start gene g816 Scaffold_7 AUGUSTUS gene 3750335 3751540 0.27 + . g816 Scaffold_7 AUGUSTUS transcript 3750335 3751540 0.27 + . g816.t1 Scaffold_7 AUGUSTUS start_codon 3750335 3750337 . + 0 transcript_id "g816.t1"; gene_id "g816"; Scaffold_7 AUGUSTUS CDS 3750335 3750573 0.27 + 0 transcript_id "g816.t1"; gene_id "g816"; Scaffold_7 AUGUSTUS CDS 3750620 3750656 0.52 + 1 transcript_id "g816.t1"; gene_id "g816"; Scaffold_7 AUGUSTUS CDS 3750734 3751540 0.74 + 0 transcript_id "g816.t1"; gene_id "g816"; Scaffold_7 AUGUSTUS stop_codon 3751538 3751540 . + 0 transcript_id "g816.t1"; gene_id "g816"; # protein sequence = [MPASRRTSASSHDDELASHLQGLSLEGQRSRKASPIPAPVSASILTRGSRYADDEGARYASTYNAGMMLDEQLDQEMH # SKCYEASPNFRRGQVSTSSAALDLAHISQSSNNRSLDNRDKISEWPQYPRGPEGITSAKSERRTVTNPGLILASPDGQASLGSISASATPLVSQHSQG # ISHQPPSPSHGSPLGLLESMNGTTRSVPATPLGLSSSHIMKPPGTPLGESQGMNGRMSTQGNHLNDAIDIQASLSRIPSGRYENGALNFNGIPQGLDE # PYGADSGFGLSGGLDGRYNSYADVNSNTSGSTALYHHNGSRYGLGLPGRANAGVDGKMNGLHGPKHKRGDMDRECKQLSGLFSCLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g816 ### # start gene g817 Scaffold_7 AUGUSTUS gene 3762984 3763661 0.59 + . g817 Scaffold_7 AUGUSTUS transcript 3762984 3763661 0.59 + . g817.t1 Scaffold_7 AUGUSTUS start_codon 3762984 3762986 . + 0 transcript_id "g817.t1"; gene_id "g817"; Scaffold_7 AUGUSTUS CDS 3762984 3763661 0.59 + 0 transcript_id "g817.t1"; gene_id "g817"; Scaffold_7 AUGUSTUS stop_codon 3763659 3763661 . + 0 transcript_id "g817.t1"; gene_id "g817"; # protein sequence = [MSRNMNTPKEPPPGQPRLKFPAAQTPRAVPASPANTSTNGDDGHRSLIAKAVTMGLMLSGEDYTIALPTKLIQLAASA # KDGKPKADIWEKIGLIGKILQECSFKDRMRKFRDEIMEKIEEKFDDETCRLEGRVKAMRKEVEDASNASTKLKDKVEGLVKDAEARGTMSWAGLMELE # AGEVEAMSNAQLSYANAAQAKSVAQHIQQPRHNPAIRDAELKDRRIIIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g817 ### # start gene g818 Scaffold_7 AUGUSTUS gene 3771214 3773569 0.1 + . g818 Scaffold_7 AUGUSTUS transcript 3771214 3773569 0.1 + . g818.t1 Scaffold_7 AUGUSTUS start_codon 3771214 3771216 . + 0 transcript_id "g818.t1"; gene_id "g818"; Scaffold_7 AUGUSTUS CDS 3771214 3771502 0.61 + 0 transcript_id "g818.t1"; gene_id "g818"; Scaffold_7 AUGUSTUS CDS 3772596 3773065 0.69 + 2 transcript_id "g818.t1"; gene_id "g818"; Scaffold_7 AUGUSTUS CDS 3773209 3773223 0.46 + 0 transcript_id "g818.t1"; gene_id "g818"; Scaffold_7 AUGUSTUS CDS 3773345 3773569 0.77 + 0 transcript_id "g818.t1"; gene_id "g818"; Scaffold_7 AUGUSTUS stop_codon 3773567 3773569 . + 0 transcript_id "g818.t1"; gene_id "g818"; # protein sequence = [MSNASENNLESIELAMQNPLPASNLNPSSVSVNAVLPSDDGFSSIDSIPSINRNQSSLPPVDKGFGAWSFVRILGLCY # VRRPDILSDSFSVNCSLRRGSVIGRLTTGYLSDKINPWTLGLSTLASTSAATFILWGVLSYNLAGLLSFSVAYGILAGGWSSTWNGFTKPLSGKQISS # TGIQFSVNSFKPQANDPNLFTTLYGILLFSRGLGNIFSTPISSALTSLDSNSTVSSTFNHSGHLGFNVGGGKFGKMIQIVRLEIMGMAPGVCLSYLLY # YPILTSSSSKTRTRSNDGWVTNGHHTTSPPTKSSNKIASKLSSISSLAIQVKKFPTST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g818 ### # start gene g819 Scaffold_7 AUGUSTUS gene 3776818 3777665 0.23 - . g819 Scaffold_7 AUGUSTUS transcript 3776818 3777665 0.23 - . g819.t1 Scaffold_7 AUGUSTUS stop_codon 3776818 3776820 . - 0 transcript_id "g819.t1"; gene_id "g819"; Scaffold_7 AUGUSTUS CDS 3776818 3777114 1 - 0 transcript_id "g819.t1"; gene_id "g819"; Scaffold_7 AUGUSTUS CDS 3777224 3777613 0.61 - 0 transcript_id "g819.t1"; gene_id "g819"; Scaffold_7 AUGUSTUS CDS 3777663 3777665 0.37 - 0 transcript_id "g819.t1"; gene_id "g819"; Scaffold_7 AUGUSTUS start_codon 3777663 3777665 . - 0 transcript_id "g819.t1"; gene_id "g819"; # protein sequence = [MTLDSHTAPISALDFSEPYGTLVSASVEDSQPIVWDLLAGTESGRLRGHVGTVKCIQVEDTVCVTGSEDCSVRLWDLR # LVDADGSDGWGDEGEIVSLSDVAEEDSSEEGTKPNGIRNGIGKEQKEDVACLRVTGASDKTLRQWDLTTGQCVMTMDILWAIAHPTSSTLANNLFAGA # AASVGTFAFPMPPRADGSWDMYEDYVGGVQFWGYGLVSGSGDGAVRMWDSKST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g819 ### # start gene g820 Scaffold_7 AUGUSTUS gene 3779124 3779561 0.57 - . g820 Scaffold_7 AUGUSTUS transcript 3779124 3779561 0.57 - . g820.t1 Scaffold_7 AUGUSTUS stop_codon 3779124 3779126 . - 0 transcript_id "g820.t1"; gene_id "g820"; Scaffold_7 AUGUSTUS CDS 3779124 3779561 0.57 - 0 transcript_id "g820.t1"; gene_id "g820"; Scaffold_7 AUGUSTUS start_codon 3779559 3779561 . - 0 transcript_id "g820.t1"; gene_id "g820"; # protein sequence = [MIQPADRCWCDLSTAGFFEPFNTSLWERISVEKLKDTLERQVRIEEKIKQLEFQVSENDTQSAQPSPTAYANAKSIAQ # GFWSLLRSKGQTDPQPASPPAELGTTRNISDPMPAIGTPPLPLLRREYDLRRFGVGLVIDFGSSANA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g820 ### # start gene g821 Scaffold_7 AUGUSTUS gene 3780605 3781054 1 + . g821 Scaffold_7 AUGUSTUS transcript 3780605 3781054 1 + . g821.t1 Scaffold_7 AUGUSTUS start_codon 3780605 3780607 . + 0 transcript_id "g821.t1"; gene_id "g821"; Scaffold_7 AUGUSTUS CDS 3780605 3781054 1 + 0 transcript_id "g821.t1"; gene_id "g821"; Scaffold_7 AUGUSTUS stop_codon 3781052 3781054 . + 0 transcript_id "g821.t1"; gene_id "g821"; # protein sequence = [MEEEYWPRLTKEKVRNSHIKTDFSKWVDEDEQDGEAAANDDDDMSGMGGMPGMGGMPGMGGMPGMGGMPGMGGLGGMP # GMEGMDFEKVRLCALHCYHSVVQLSDTAIVQMMAEMGSASGGGAGPSGIDDDGDDSDDDGPPPLEDAESAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g821 ### # start gene g822 Scaffold_7 AUGUSTUS gene 3781442 3783042 0.28 - . g822 Scaffold_7 AUGUSTUS transcript 3781442 3783042 0.28 - . g822.t1 Scaffold_7 AUGUSTUS stop_codon 3781442 3781444 . - 0 transcript_id "g822.t1"; gene_id "g822"; Scaffold_7 AUGUSTUS CDS 3781442 3781645 1 - 0 transcript_id "g822.t1"; gene_id "g822"; Scaffold_7 AUGUSTUS CDS 3781796 3782364 0.95 - 2 transcript_id "g822.t1"; gene_id "g822"; Scaffold_7 AUGUSTUS CDS 3782466 3782856 0.68 - 0 transcript_id "g822.t1"; gene_id "g822"; Scaffold_7 AUGUSTUS CDS 3783010 3783042 0.38 - 0 transcript_id "g822.t1"; gene_id "g822"; Scaffold_7 AUGUSTUS start_codon 3783040 3783042 . - 0 transcript_id "g822.t1"; gene_id "g822"; # protein sequence = [MYVSSRVSHLFVSDEPIQTGATDPSSSSSSSSSGTTAAASSSVSSATDNATSSSSANTTSGNTTDNSASGNPATASNN # TSTSSGSTGATDNSASGSAVTTSNGSTGSTSTATTIGSLSSSDITTNATENNPDAQSSLTLDPHVQEAGQVASLTSNNNFINYCLTQGNLPITNGLQI # TTGSCNPAPIGTIPSVQNMPSAKFANPANGATIAANTEFTITMNINNLDTGNFVNANENYFAAPQQLSAQGQIIGHTHVVIEALSDLAQTTPTNPQQF # AFFKGVNTAAVNGAVTADVTSGVPAGAYRLCSINSSSNHQPVIVPIAQHGSLDDCVYSNATAAAGAANSTAAGTAAAGTAATGASAAEIAKGQGQNKN # QGSQAQSQAAVAKAGNGKGKRSISRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g822 ### # start gene g823 Scaffold_7 AUGUSTUS gene 3787121 3788479 0.98 + . g823 Scaffold_7 AUGUSTUS transcript 3787121 3788479 0.98 + . g823.t1 Scaffold_7 AUGUSTUS start_codon 3787121 3787123 . + 0 transcript_id "g823.t1"; gene_id "g823"; Scaffold_7 AUGUSTUS CDS 3787121 3787372 0.98 + 0 transcript_id "g823.t1"; gene_id "g823"; Scaffold_7 AUGUSTUS CDS 3787488 3788036 0.98 + 0 transcript_id "g823.t1"; gene_id "g823"; Scaffold_7 AUGUSTUS CDS 3788183 3788479 1 + 0 transcript_id "g823.t1"; gene_id "g823"; Scaffold_7 AUGUSTUS stop_codon 3788477 3788479 . + 0 transcript_id "g823.t1"; gene_id "g823"; # protein sequence = [MSVSSATILKVFFCKANNAGAAAAATASNATAAAATASNSTATTGNTGSTSTATSVGALSSADITTNATENNPDAQSS # LTLDPRVASLTSNNNFINYCLTQGNLPITNGLQTTTGSCNPAPIGTIPSVQNMPSAKFASPANGDTIAANTEFTITMNINNLDTGNFVNANENYFAAP # QQLSAQGQIIGHTHVVIEALSDLAQTTPTNPQQFAFFKGVNTAAVNGAVTADVTSGVPAGAYRLCSINSSSNHQPVIVPIAQHGSLDDCVYSNATAAA # AGAANSTAAGTAAAAAGTAAAATGAAATASNATAAAAGAGSAAAAGAGAQAGAQAAKGQGQNKNQGAQAQGQAAGTKAGNGKGKRSRLSRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g823 ### # start gene g824 Scaffold_7 AUGUSTUS gene 3792447 3793172 1 + . g824 Scaffold_7 AUGUSTUS transcript 3792447 3793172 1 + . g824.t1 Scaffold_7 AUGUSTUS start_codon 3792447 3792449 . + 0 transcript_id "g824.t1"; gene_id "g824"; Scaffold_7 AUGUSTUS CDS 3792447 3793172 1 + 0 transcript_id "g824.t1"; gene_id "g824"; Scaffold_7 AUGUSTUS stop_codon 3793170 3793172 . + 0 transcript_id "g824.t1"; gene_id "g824"; # protein sequence = [MRQFTVKVPATSANIGPGFDVVGLSLSLHLILKVSVPPANAQAFVAPAITYSGEGADEVPLDAYKNLTTRVALYVLRC # NGIRSFPSGLKLHAHNEIPFGRGLGSSGAAVIAGVILGNELGQFNLSKERLLDFALMVERHPDNVTAALIGGFVGSYLRELDEADTVAASVPLSEVLP # EYPPDAGEDWGLNPPPPPSGIGHYVRFGWSEPIKAIAIIPRFELSTAKAREVLPSMYTRKDLVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g824 ### # start gene g825 Scaffold_7 AUGUSTUS gene 3796058 3796732 1 + . g825 Scaffold_7 AUGUSTUS transcript 3796058 3796732 1 + . g825.t1 Scaffold_7 AUGUSTUS start_codon 3796058 3796060 . + 0 transcript_id "g825.t1"; gene_id "g825"; Scaffold_7 AUGUSTUS CDS 3796058 3796732 1 + 0 transcript_id "g825.t1"; gene_id "g825"; Scaffold_7 AUGUSTUS stop_codon 3796730 3796732 . + 0 transcript_id "g825.t1"; gene_id "g825"; # protein sequence = [MVADIFRDATVGQLFNYFSNGTILPYPEERSDFTVPARFLPSQTPTIADESDDVQKPEPELQKSKEEVLVTETDTSRE # ITLDENEGLGDLEAQKINDGDPYLVTWYGVDDPENPKFVSSSSTLRTASNNYTHRNWSSKKRAFVGFCVTWMTFTSYVGSAIYIAAIPGIMEQFHVGL # TYAELGLTLYVFGLSFFSCYLVFRSNFHDTQPMVLDPCSSLLYKSYPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g825 ### # start gene g826 Scaffold_7 AUGUSTUS gene 3801174 3801917 0.6 + . g826 Scaffold_7 AUGUSTUS transcript 3801174 3801917 0.6 + . g826.t1 Scaffold_7 AUGUSTUS start_codon 3801174 3801176 . + 0 transcript_id "g826.t1"; gene_id "g826"; Scaffold_7 AUGUSTUS CDS 3801174 3801643 0.62 + 0 transcript_id "g826.t1"; gene_id "g826"; Scaffold_7 AUGUSTUS CDS 3801701 3801917 0.61 + 1 transcript_id "g826.t1"; gene_id "g826"; Scaffold_7 AUGUSTUS stop_codon 3801915 3801917 . + 0 transcript_id "g826.t1"; gene_id "g826"; # protein sequence = [MFYNGTAASFNESFAEFLAIPYTSSTAGPLSYLDLVNEVNFPYGEGNLFSGSVLAGVPSNSPESSDKLINNYMETYRL # FNNFSMTYANSSEIQSTLLSFTPVLQSQIRISYEKGGNAISPPMGQGGFNEVLFAVTYSAGVNQAPENIEQGRQFWIENTPRTAGLPLFANEADANQQ # VLASYGEYNFLREVYAKYDPSRCVKAIYNENDSLKEFSPRFNVRHTPGPLGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g826 ### # start gene g827 Scaffold_7 AUGUSTUS gene 3808884 3809804 1 - . g827 Scaffold_7 AUGUSTUS transcript 3808884 3809804 1 - . g827.t1 Scaffold_7 AUGUSTUS stop_codon 3808884 3808886 . - 0 transcript_id "g827.t1"; gene_id "g827"; Scaffold_7 AUGUSTUS CDS 3808884 3809804 1 - 0 transcript_id "g827.t1"; gene_id "g827"; Scaffold_7 AUGUSTUS start_codon 3809802 3809804 . - 0 transcript_id "g827.t1"; gene_id "g827"; # protein sequence = [MSRPLDPTLFSATATNDTTGEEIAPSLPEVSEQQCKQTLDKLVLSYLAHHGYIKTARAFKKQNREAVEESPASPSVDD # DIDMDDVPEPSTPSPSTSVLEADIESRTRIVNSVLSGNIDSALTETKEHYPGALEADEGLMFVKLRCRRFVELVLESAELEKKMKAMATKEQATAPEM # DGLEEGGMGMDVDDDDLFPGSPVTNGSNGAAGASSSEIPSRPPSARDQYEAALNSAIAYGQTLDKDFKSTRNPEIKQIFTRAFAIFAVFDPLSAGGTI # AEVAGHDARVQLANDLNQAILRMFIFLEAITS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g827 ### # start gene g828 Scaffold_7 AUGUSTUS gene 3812559 3813674 0.11 + . g828 Scaffold_7 AUGUSTUS transcript 3812559 3813674 0.11 + . g828.t1 Scaffold_7 AUGUSTUS start_codon 3812559 3812561 . + 0 transcript_id "g828.t1"; gene_id "g828"; Scaffold_7 AUGUSTUS CDS 3812559 3812876 0.38 + 0 transcript_id "g828.t1"; gene_id "g828"; Scaffold_7 AUGUSTUS CDS 3813041 3813090 0.25 + 0 transcript_id "g828.t1"; gene_id "g828"; Scaffold_7 AUGUSTUS CDS 3813177 3813307 0.59 + 1 transcript_id "g828.t1"; gene_id "g828"; Scaffold_7 AUGUSTUS CDS 3813373 3813674 0.61 + 2 transcript_id "g828.t1"; gene_id "g828"; Scaffold_7 AUGUSTUS stop_codon 3813672 3813674 . + 0 transcript_id "g828.t1"; gene_id "g828"; # protein sequence = [MARPAARYWAGKAPKNVVGADSDTEDEEEQPQTEEEGDVNIGGEQEIIQDRDEGEDEDMPMKKQGLKSKSMNIALRDV # DISTDGKVIVAGREESGKTVLEEDEGKTSSEYESDSEEEQKPKLQRNRETIAEREQLAEDTEEALKRKEMELEERRKQSHDLVAESIRQEKEEQVPDV # DDTDGLDPAGEFEAWRLRELGRIKKEKEEEIRREQEREEIERRRAMPEEQRLKEDLERAQKLRDEKPKGQQKFLQKYWHKGAFHQVRLAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g828 ### # start gene g829 Scaffold_7 AUGUSTUS gene 3819502 3819813 0.99 - . g829 Scaffold_7 AUGUSTUS transcript 3819502 3819813 0.99 - . g829.t1 Scaffold_7 AUGUSTUS stop_codon 3819502 3819504 . - 0 transcript_id "g829.t1"; gene_id "g829"; Scaffold_7 AUGUSTUS CDS 3819502 3819813 0.99 - 0 transcript_id "g829.t1"; gene_id "g829"; Scaffold_7 AUGUSTUS start_codon 3819811 3819813 . - 0 transcript_id "g829.t1"; gene_id "g829"; # protein sequence = [MPPRKKTADGAAPAAPTRSSSRNKAAKNAADAVATATTVSKPKSKTKRAHPSSDDEDDAPAKKPASKKAKKSKTTVDE # DEDAKAEDKPANIKQVCPRCLGVHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g829 ### # start gene g830 Scaffold_7 AUGUSTUS gene 3822595 3823116 0.62 - . g830 Scaffold_7 AUGUSTUS transcript 3822595 3823116 0.62 - . g830.t1 Scaffold_7 AUGUSTUS stop_codon 3822595 3822597 . - 0 transcript_id "g830.t1"; gene_id "g830"; Scaffold_7 AUGUSTUS CDS 3822595 3823116 0.62 - 0 transcript_id "g830.t1"; gene_id "g830"; Scaffold_7 AUGUSTUS start_codon 3823114 3823116 . - 0 transcript_id "g830.t1"; gene_id "g830"; # protein sequence = [MDYGIPGASASTSQVGRSTPSPLSSTPTPSGPSAITVAPASTSSSTDLPLPDPPFHAVVNSKSIYPYTDPRQVVSVYF # SVNCGKSYWECANSVSQRARYFQGGQSWGWKSSGLLGGLQGNASTNGSHNDGRLEAALIQMDRELPVVGHEVSCGQPSCLELCNRPSTSSNCHSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g830 ### # start gene g831 Scaffold_7 AUGUSTUS gene 3823882 3825311 0.84 - . g831 Scaffold_7 AUGUSTUS transcript 3823882 3825311 0.84 - . g831.t1 Scaffold_7 AUGUSTUS stop_codon 3823882 3823884 . - 0 transcript_id "g831.t1"; gene_id "g831"; Scaffold_7 AUGUSTUS CDS 3823882 3824674 0.98 - 1 transcript_id "g831.t1"; gene_id "g831"; Scaffold_7 AUGUSTUS CDS 3824734 3825311 0.84 - 0 transcript_id "g831.t1"; gene_id "g831"; Scaffold_7 AUGUSTUS start_codon 3825309 3825311 . - 0 transcript_id "g831.t1"; gene_id "g831"; # protein sequence = [MDREESGFEGVPLTLDTDSHRPNHSTSSAWTPKWSQSNVKSIPKFFTATAVGAGYEGLSLSWIHALISSDSFFVPAPS # LYDSLSITSSISAQSTFDTSSSRNPLPATTPGSPEEERYAFAKGVVELRRAVRTKVRQLRKRQMEIDEENERHARQSRLKGKGRQLTPLDSNDEDYQD # GLSDHSETAISDEWKQCTGIYYTNMVRILQLSYQRSCFIIPQSTEAVIDISRDISPSTGRPYVDLRTLQQAVWEAELVKHTIIRGNQNTSSHKALYPV # DKLGFAKPVSSISSTSATDNSLNRVKPYFTIPANESLRIGDTITTFSGINVEGNIHNNITMDELFASSFGRSSLHREHSSRERKGMQRGSATLGDTAA # SSDNQTGEQLEQEKTAPIAKPRMNEPSLGYETPFAMQLTQTIIRSHSFPLPLPFFIIPHPLSSCLHHNCSLRTRLFGSVSNFLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g831 ### # start gene g832 Scaffold_7 AUGUSTUS gene 3828120 3829576 0.47 + . g832 Scaffold_7 AUGUSTUS transcript 3828120 3829576 0.47 + . g832.t1 Scaffold_7 AUGUSTUS start_codon 3828120 3828122 . + 0 transcript_id "g832.t1"; gene_id "g832"; Scaffold_7 AUGUSTUS CDS 3828120 3828693 0.6 + 0 transcript_id "g832.t1"; gene_id "g832"; Scaffold_7 AUGUSTUS CDS 3828783 3829576 0.75 + 2 transcript_id "g832.t1"; gene_id "g832"; Scaffold_7 AUGUSTUS stop_codon 3829574 3829576 . + 0 transcript_id "g832.t1"; gene_id "g832"; # protein sequence = [MGSPEPTAIPATKTASHQPPANEPKSTKITLEGLFASALNPTSDNTAYDPQKNQYKPESYIWDHRQQSFPDVDNSMTL # ATTQTSGVPLRQIVSTSENTGMALLNDIFASASATGLTSSIIAPSDPISFQNNASSASNQSTSPLPTNTSKHADEPETIEIYSPRPKAPLSLASMFDA # AVRDATPSPSTELGLGGSMDLSTQDYRSNGHVIAEADTNSYATAEVNAEPEEIRKKLLDMIGLGTASLPHPPATNGDATPRVLLKYIPTLSSNSLPTS # AEFLKQPTQTADVSFAETDYAFNEGDDDDEAIVELDFSDTRALSDLRAFENRERALREQLVERRAASRSASRSTTPAVINHGPIPNKAKINLRGPDVN # GVDLKTEAHDFALNGENRYAPYASSPSTALPSTLPQITSSKVTLHPVTPAEMPRKISAPIADTPVTPPVPTTIAQKTPTGSPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g832 ### # start gene g833 Scaffold_7 AUGUSTUS gene 3829680 3830426 0.99 + . g833 Scaffold_7 AUGUSTUS transcript 3829680 3830426 0.99 + . g833.t1 Scaffold_7 AUGUSTUS start_codon 3829680 3829682 . + 0 transcript_id "g833.t1"; gene_id "g833"; Scaffold_7 AUGUSTUS CDS 3829680 3830426 0.99 + 0 transcript_id "g833.t1"; gene_id "g833"; Scaffold_7 AUGUSTUS stop_codon 3830424 3830426 . + 0 transcript_id "g833.t1"; gene_id "g833"; # protein sequence = [MGSVTSEDIDGQPDVETKGMAMEELSVPSSSSHNHDLLIDSEVSSQINASLSFVLSGKDKYQVNNRDELAELATRLLQ # VRSHFSISYFIFKTRLQTDRNFVDELWRAWKGSNEKFATISEGNISTVIASMTSPVEAFDTSTENGDQKSESPYPTLPHIALTHSAPAKLPTLIDGSS # SVLFDAVRPVSPQSNFQHTLSGLPSPAIINNGKVIEAERQCDSAIIEEENSPDTVDFGDADESHVVERLLDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g833 ### # start gene g834 Scaffold_7 AUGUSTUS gene 3836181 3837868 0.19 + . g834 Scaffold_7 AUGUSTUS transcript 3836181 3837868 0.19 + . g834.t1 Scaffold_7 AUGUSTUS start_codon 3836181 3836183 . + 0 transcript_id "g834.t1"; gene_id "g834"; Scaffold_7 AUGUSTUS CDS 3836181 3836935 0.35 + 0 transcript_id "g834.t1"; gene_id "g834"; Scaffold_7 AUGUSTUS CDS 3837060 3837357 1 + 1 transcript_id "g834.t1"; gene_id "g834"; Scaffold_7 AUGUSTUS CDS 3837446 3837868 0.52 + 0 transcript_id "g834.t1"; gene_id "g834"; Scaffold_7 AUGUSTUS stop_codon 3837866 3837868 . + 0 transcript_id "g834.t1"; gene_id "g834"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGNNPNVVLLLNLLVTHLLTSIWTPVITMIKTLLSTPTIRAPTTIHDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPLTALNPRARSRSQSGSAKEWFVPDILDPDLDSLPAW # TSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLADASRTKWRREAGKPFVARNPKKGSSDFKT # GSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGR # AAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g834 ### # start gene g835 Scaffold_7 AUGUSTUS gene 3842104 3843270 0.47 - . g835 Scaffold_7 AUGUSTUS transcript 3842104 3843270 0.47 - . g835.t1 Scaffold_7 AUGUSTUS stop_codon 3842104 3842106 . - 0 transcript_id "g835.t1"; gene_id "g835"; Scaffold_7 AUGUSTUS CDS 3842104 3842742 0.52 - 0 transcript_id "g835.t1"; gene_id "g835"; Scaffold_7 AUGUSTUS CDS 3842797 3843270 0.47 - 0 transcript_id "g835.t1"; gene_id "g835"; Scaffold_7 AUGUSTUS start_codon 3843268 3843270 . - 0 transcript_id "g835.t1"; gene_id "g835"; # protein sequence = [MTTSRTTTTTQPSASTSSRPADPPSPGAPIDEDEDEIIREALARVERVKARKAAEAAKRKAAEEAAAKKAAEEAEKKK # QAAERAAAARRQAAQDARDRAVRAREQEDEIVERRRKLAEAATARSQGGTSTGDVSASPRRPIVEVSKMKNKGKGKAKAPVVDEDPDDGDDGDDDDED # EEDREPCERCRSKKIPCLKQAGKRSSVICKPCHDSKVRCSYSGRPYVVKKDGGAGPSGERLAVLESQMAQLLADNRALREANSKTQQYLRQLLRRQED # DHTRLISMDTRMSLMGMGEGPAAAGPSRRTTERRRPLKRRRVVEESEEEREEEEEVEEREKETEKDGEGEEEEIVEEEMAPTEARADKGKEKEVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g835 ### # start gene g836 Scaffold_7 AUGUSTUS gene 3849231 3850762 0.57 + . g836 Scaffold_7 AUGUSTUS transcript 3849231 3850762 0.57 + . g836.t1 Scaffold_7 AUGUSTUS start_codon 3849231 3849233 . + 0 transcript_id "g836.t1"; gene_id "g836"; Scaffold_7 AUGUSTUS CDS 3849231 3849621 0.57 + 0 transcript_id "g836.t1"; gene_id "g836"; Scaffold_7 AUGUSTUS CDS 3849681 3850762 1 + 2 transcript_id "g836.t1"; gene_id "g836"; Scaffold_7 AUGUSTUS stop_codon 3850760 3850762 . + 0 transcript_id "g836.t1"; gene_id "g836"; # protein sequence = [MVLLKMKETAEAFLGTTITNSVVTVPAYFNDSQRQATKDAGTICGMNVLRIINEPTAAAIAYGLDKKVSGERSVLIFD # LGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSSNPRAVRRLRTACERAKRTLSSAAQTSIEIDSLYEGIDFYTSL # TRARFEELCQGLFRSTLDPVEKVLRDSKIDKANVHEIVLVGGSTRIPRIVKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILSGDTSEKTQDLLLLD # VSPLSLGIETAGGVMTAPIKRNTTVPIKKSETFSTYADNQPGVLIQVFEGERARTKDNNLLGKFELSSIPPAPRGVPQIEVTFDIDANGILNVSAADK # STVKSNRIIITNDKGRLTKEEIECMVSEAEKYKAEDEAATARITAKNSLKSYSYNFRNSLTDEKLADQFSPEDKAKLTTHVDEAIKWLDKSHRRRSTK # RSRRSLRQSQTQSCKMYVRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g836 ### # start gene g837 Scaffold_7 AUGUSTUS gene 3852423 3853007 0.58 + . g837 Scaffold_7 AUGUSTUS transcript 3852423 3853007 0.58 + . g837.t1 Scaffold_7 AUGUSTUS start_codon 3852423 3852425 . + 0 transcript_id "g837.t1"; gene_id "g837"; Scaffold_7 AUGUSTUS CDS 3852423 3852467 0.6 + 0 transcript_id "g837.t1"; gene_id "g837"; Scaffold_7 AUGUSTUS CDS 3852522 3853007 0.64 + 0 transcript_id "g837.t1"; gene_id "g837"; Scaffold_7 AUGUSTUS stop_codon 3853005 3853007 . + 0 transcript_id "g837.t1"; gene_id "g837"; # protein sequence = [MSDFNYDENAPYNPQKLRVPLPAAVAPERLRSGHSLVQRQQKIVQTKLKSADAHMLEYFTDMTFDQHKGRIKSYMSVR # SDKQKKSRWLEELAKEFDNTLSKIEPNPYSSRYYSSDGVKLLAVYANQFPDQPPPRRSVKEQLGLSHMLEAQSKGTSIHNNGVPVGLLFYISYLLSDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g837 ### # start gene g838 Scaffold_7 AUGUSTUS gene 3853311 3853919 0.95 + . g838 Scaffold_7 AUGUSTUS transcript 3853311 3853919 0.95 + . g838.t1 Scaffold_7 AUGUSTUS start_codon 3853311 3853313 . + 0 transcript_id "g838.t1"; gene_id "g838"; Scaffold_7 AUGUSTUS CDS 3853311 3853919 0.95 + 0 transcript_id "g838.t1"; gene_id "g838"; Scaffold_7 AUGUSTUS stop_codon 3853917 3853919 . + 0 transcript_id "g838.t1"; gene_id "g838"; # protein sequence = [MTPTRRAYHDVGGAQGPMAIQHWYEVTPEFGNLLSSVFKQEWPDKWEEAMKRFKAGKWQAANPGPWVGKAIVYKLTSS # IHPDEEDAEECPTVTVPVGHFVGGHIQFLDIHARLQYSPGHIVIGLTSILFHRVEDWTIATPSMEQLEEWKRWRLTPGRIGIVSFFPRNSYNLLNNKE # AHWGADTQYGRREELLPKSKRRKIVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g838 ### # start gene g839 Scaffold_7 AUGUSTUS gene 3854500 3856833 0.2 - . g839 Scaffold_7 AUGUSTUS transcript 3854500 3856833 0.2 - . g839.t1 Scaffold_7 AUGUSTUS stop_codon 3854500 3854502 . - 0 transcript_id "g839.t1"; gene_id "g839"; Scaffold_7 AUGUSTUS CDS 3854500 3856559 0.96 - 2 transcript_id "g839.t1"; gene_id "g839"; Scaffold_7 AUGUSTUS CDS 3856653 3856833 0.2 - 0 transcript_id "g839.t1"; gene_id "g839"; Scaffold_7 AUGUSTUS start_codon 3856831 3856833 . - 0 transcript_id "g839.t1"; gene_id "g839"; # protein sequence = [MVHYNGLATPDSNNHLNMLTNLNDYLNSSTDPLLSISPAPSGLPSLAPASSGPPSLAPASIHPHSRLPRVVLPHSRLP # RGPPLLAPALSGPPSLAPASSGPPSLAPASSGPPSLAPASSGPPSLAPASSGPPLLAPALSGPPSLAPASSGPPSLAPASSGPPSLAPASSGPPSLAP # ASSGPPSLTPASSGPPSLATATNSHLPGLSTAPSGFPFLATTPNGPPSLATATNSHLPGLSTAPSGFPFLATAPNGPPSLATATNSHLPGLSTTPSGL # QSFATAPNSHLPGLSTTPSGLQSFATAPNSHLPGLSTAPSGFPFLATAPNSHLPGLSTAPSGLQSFATAPNSHLPGLSTAPSGLQSFATAPNSHLPGL # STAPSGLQSFATSPNSHLPGLSTTPSGLQSFATAPNSHLPGLSTAPSGLQSFATAPNSHLPGLSTAPSGLQSFATAPNSHLPGLSTTPSGLQSFATAP # NSHLPGLSTAPSGFPFLATAPNSHLPGLSTAPSGFPLLVTAPNSLPPGLLTGPSGLPQIITTPNSLPDVARPSSGLSLISTAPSSVLPSSAFLGASGA # TDGGGNTAQLLSLFPSLGQPVTGDYPMYQGYQQSCQSNPYSGPPASIELDSPEVQYTRTNAENFEEFCKLCGEDPKNILFKGDHEIPLQPRYQNYCSL # RLVLRPLGFTSETTWFKLKHLGIHYNKSNQYELLTDILSYNWKERTLNDKRKFFEWAEKADKYVWDETKRPKSPILEGKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g839 ### # start gene g840 Scaffold_7 AUGUSTUS gene 3858943 3862458 0.91 - . g840 Scaffold_7 AUGUSTUS transcript 3858943 3862458 0.91 - . g840.t1 Scaffold_7 AUGUSTUS stop_codon 3858943 3858945 . - 0 transcript_id "g840.t1"; gene_id "g840"; Scaffold_7 AUGUSTUS CDS 3858943 3862458 0.91 - 0 transcript_id "g840.t1"; gene_id "g840"; Scaffold_7 AUGUSTUS start_codon 3862456 3862458 . - 0 transcript_id "g840.t1"; gene_id "g840"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKK # IQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSL # LARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRQEDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRIL # REARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVINYTPGKV # TPLMAKYQHHQSRYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g840 ### # start gene g841 Scaffold_7 AUGUSTUS gene 3862509 3863675 0.89 - . g841 Scaffold_7 AUGUSTUS transcript 3862509 3863675 0.89 - . g841.t1 Scaffold_7 AUGUSTUS stop_codon 3862509 3862511 . - 0 transcript_id "g841.t1"; gene_id "g841"; Scaffold_7 AUGUSTUS CDS 3862509 3863675 0.89 - 0 transcript_id "g841.t1"; gene_id "g841"; Scaffold_7 AUGUSTUS start_codon 3863673 3863675 . - 0 transcript_id "g841.t1"; gene_id "g841"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g841 ### # start gene g842 Scaffold_7 AUGUSTUS gene 3865322 3865678 0.37 + . g842 Scaffold_7 AUGUSTUS transcript 3865322 3865678 0.37 + . g842.t1 Scaffold_7 AUGUSTUS start_codon 3865322 3865324 . + 0 transcript_id "g842.t1"; gene_id "g842"; Scaffold_7 AUGUSTUS CDS 3865322 3865678 0.37 + 0 transcript_id "g842.t1"; gene_id "g842"; Scaffold_7 AUGUSTUS stop_codon 3865676 3865678 . + 0 transcript_id "g842.t1"; gene_id "g842"; # protein sequence = [MFGFDMIVNGLRGESLEQVAMTDEELEVFGVDWEGLKDEVKISPLRKNYRTEGAGSWLGQQGPPAELNQVVVDPPSGL # FTSEQIAFMDQQLQGYARTPQEGRCCALVDYCPCACKIYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g842 ### # start gene g843 Scaffold_7 AUGUSTUS gene 3869966 3870376 0.95 + . g843 Scaffold_7 AUGUSTUS transcript 3869966 3870376 0.95 + . g843.t1 Scaffold_7 AUGUSTUS start_codon 3869966 3869968 . + 0 transcript_id "g843.t1"; gene_id "g843"; Scaffold_7 AUGUSTUS CDS 3869966 3870376 0.95 + 0 transcript_id "g843.t1"; gene_id "g843"; Scaffold_7 AUGUSTUS stop_codon 3870374 3870376 . + 0 transcript_id "g843.t1"; gene_id "g843"; # protein sequence = [MVHHEGNLEEGVAPVYEGAFSYKGVVHHILTKDNYVRNKHHLDPEILVDTIDSNLVVWRDSDLIPHEEDRFSPAMCGH # DDLLFNTDPALNPVLRKPFTEQSISLGPFGNISLSRRDDVAGSGSSYKFVILPPLIPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g843 ### # start gene g844 Scaffold_7 AUGUSTUS gene 3880675 3881334 0.46 - . g844 Scaffold_7 AUGUSTUS transcript 3880675 3881334 0.46 - . g844.t1 Scaffold_7 AUGUSTUS stop_codon 3880675 3880677 . - 0 transcript_id "g844.t1"; gene_id "g844"; Scaffold_7 AUGUSTUS CDS 3880675 3881334 0.46 - 0 transcript_id "g844.t1"; gene_id "g844"; Scaffold_7 AUGUSTUS start_codon 3881332 3881334 . - 0 transcript_id "g844.t1"; gene_id "g844"; # protein sequence = [MFHSPRSTEAPMDFQFTSRPNTTPVWKSGDDLSTPRKSLSNVQFYVVFVLRNYSAGSHDDMNPSTPANSSSFGFGANR # NIPFIFATPSRQTPEPYSWAPPPNASPATSFPSPSLNEIKDVDMSDASPAKLEEEFKSNNDRAVATGALRRVYRARHKTPQGKRFASMRDRDSDNDPT # VSDDEDEHALNLSNQNTSNHYTLNVSPASSPSDMPYVLLGWVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g844 ### # start gene g845 Scaffold_7 AUGUSTUS gene 3885646 3886188 0.48 + . g845 Scaffold_7 AUGUSTUS transcript 3885646 3886188 0.48 + . g845.t1 Scaffold_7 AUGUSTUS start_codon 3885646 3885648 . + 0 transcript_id "g845.t1"; gene_id "g845"; Scaffold_7 AUGUSTUS CDS 3885646 3886188 0.48 + 0 transcript_id "g845.t1"; gene_id "g845"; Scaffold_7 AUGUSTUS stop_codon 3886186 3886188 . + 0 transcript_id "g845.t1"; gene_id "g845"; # protein sequence = [MASNEEDSREGASSDVIDVTSKHEVRISRQDLPPSPPLTRSNSVASTPGVTVLDEDRDEKDMANENEVSEEGWDPLQR # EVGGQPMEDETFVAARGGELLEAGDSVVDVNGRVIFSPGRNLSRSNLQLEFEPRPLQPWDLVDPPLTNGEKLINPYGTVNSHKFSTLQDSAYVRSLAL # KFLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g845 ### # start gene g846 Scaffold_7 AUGUSTUS gene 3887195 3888462 0.29 + . g846 Scaffold_7 AUGUSTUS transcript 3887195 3888462 0.29 + . g846.t1 Scaffold_7 AUGUSTUS start_codon 3887195 3887197 . + 0 transcript_id "g846.t1"; gene_id "g846"; Scaffold_7 AUGUSTUS CDS 3887195 3887569 0.31 + 0 transcript_id "g846.t1"; gene_id "g846"; Scaffold_7 AUGUSTUS CDS 3887890 3888462 0.71 + 0 transcript_id "g846.t1"; gene_id "g846"; Scaffold_7 AUGUSTUS stop_codon 3888460 3888462 . + 0 transcript_id "g846.t1"; gene_id "g846"; # protein sequence = [MESFSNLAPLWDLSQATNFSQLPDEEFLALLQKQFPSAGQHGSYQSSGFGAVDGVNPQSITQYSLPSITPPSEDSSPS # PQAAESSSKQSPEESSPQEDFSEFGLKRKASDEDLGEGPSQKSAHTGLEDKVAALESKNQQATTENENLRDLLSRLQSENMALKEASFTFSVPKQPTA # STSTASSKSPLFAPDNSLFSTLPRITYTAPDPSKYTNPLDMTSMMSFDPSVLNLLDESPQETATDGAMQMDFGFGKTNSDEFLPKNYTTIASNPAFFS # LTSAFDHFTPPTNSSSVSGSQSQSPSNNTNDRSPFNFDMSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g846 ### # start gene g847 Scaffold_7 AUGUSTUS gene 3889559 3890122 0.5 - . g847 Scaffold_7 AUGUSTUS transcript 3889559 3890122 0.5 - . g847.t1 Scaffold_7 AUGUSTUS stop_codon 3889559 3889561 . - 0 transcript_id "g847.t1"; gene_id "g847"; Scaffold_7 AUGUSTUS CDS 3889559 3890122 0.5 - 0 transcript_id "g847.t1"; gene_id "g847"; Scaffold_7 AUGUSTUS start_codon 3890120 3890122 . - 0 transcript_id "g847.t1"; gene_id "g847"; # protein sequence = [MKKAFNECYKAVLACEAEEGRKRCELFREVPDKRVRRWSFHNYPLLILLQDYPDYYQLIKQPIALSQIRKRSQGNFYK # DVLQYKSDWKLMFNNARTYNQEGSWVYNDAEEMEKVFNAAYDRVISGSSLPGAMSTASGSGSNAGSHDDSALTPMDDDERPPPRLNREVQEASRCSAM # RSISLLVMMNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g847 ### # start gene g848 Scaffold_7 AUGUSTUS gene 3892554 3894173 0.98 - . g848 Scaffold_7 AUGUSTUS transcript 3892554 3894173 0.98 - . g848.t1 Scaffold_7 AUGUSTUS stop_codon 3892554 3892556 . - 0 transcript_id "g848.t1"; gene_id "g848"; Scaffold_7 AUGUSTUS CDS 3892554 3894173 0.98 - 0 transcript_id "g848.t1"; gene_id "g848"; Scaffold_7 AUGUSTUS start_codon 3894171 3894173 . - 0 transcript_id "g848.t1"; gene_id "g848"; # protein sequence = [MVITVQPQAQQNSQIKHHSQSQAEVSFTPDQINVLRAQIHAFRLLSRGVPLPEGLHQAVQLNSTIIPDLEKLLQPPDS # SSRIVDSAVKISKAPDVALKTEEQAVVLPINPADMPKGPFLEDDVNSGIYPYNSYRHPFSQLKRHAEMDPTLFATRLQRLLVPTIMPPGLDAQQILNE # RDRYIDARIQQRMRELESIPATVGDESFENDIVEEFMPDTNSPLSFPSTSHGKLTALIELKSLRLIEKQRTMRALVAERLTHGSLVPLNRPDFRRTRK # PTIRDARMTEQLERKQRLDRERRAKHKHVEQLTVICNHGRQVIEANRAAQDRLTRLGRSVLNFHVQTEKEEQKRIERISKERLKALKADDEEAYMKLI # DTAKDTRITHLLRQTDTFLDSLAQSVMAQQNEGAGLRDFEMEDAPASEATFGAQVSTDEPQDKTKVDYYAVAHRISERVTRQPSILVGGTLKEYQLKG # LQWMVSLYNNKLNGILADEMVITSRIVIPLLTFDCRVWEKPFRLFPSSLFLSNPKISVVLTSSLFLFLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g848 ### # start gene g849 Scaffold_7 AUGUSTUS gene 3896236 3897033 1 + . g849 Scaffold_7 AUGUSTUS transcript 3896236 3897033 1 + . g849.t1 Scaffold_7 AUGUSTUS start_codon 3896236 3896238 . + 0 transcript_id "g849.t1"; gene_id "g849"; Scaffold_7 AUGUSTUS CDS 3896236 3897033 1 + 0 transcript_id "g849.t1"; gene_id "g849"; Scaffold_7 AUGUSTUS stop_codon 3897031 3897033 . + 0 transcript_id "g849.t1"; gene_id "g849"; # protein sequence = [MNDSLAKRVVQRVPGLACIDTRPGRVQEQDTKGPPPPSPPASDEAGGEEDAREERARVLSNATPQTEISNARMSTETK # ASAQIVKSDPSPPSPSHNQSTTTVPQSEYLQPPPISSHNIRPHRRNTTGSVAPISVIPARTTRASLTSQYNQYPSQSHSYSYSNQLYDDSIIQPSDNV # EDDIQAHAEKIRRERQEKRAKQAEAEAALTREAGLRRETTVGGARKGENYPLVGNLIGEDHVNYVLMYNMLTGIRIGVSIFFLFLMHIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g849 ### # start gene g850 Scaffold_7 AUGUSTUS gene 3899486 3900688 0.29 - . g850 Scaffold_7 AUGUSTUS transcript 3899486 3900688 0.29 - . g850.t1 Scaffold_7 AUGUSTUS stop_codon 3899486 3899488 . - 0 transcript_id "g850.t1"; gene_id "g850"; Scaffold_7 AUGUSTUS CDS 3899486 3899859 0.3 - 2 transcript_id "g850.t1"; gene_id "g850"; Scaffold_7 AUGUSTUS CDS 3899962 3900688 0.38 - 0 transcript_id "g850.t1"; gene_id "g850"; Scaffold_7 AUGUSTUS start_codon 3900686 3900688 . - 0 transcript_id "g850.t1"; gene_id "g850"; # protein sequence = [MEGAFKGEDEIALAFLSGREQCLKGSLESLRRDIIRIAALEGELSTRDKDDLVKYLGKYIGLWREGVYDLITQYESIF # LANVQEGNALSPKLHALLQMYVSHAFKTHLMPLLDSSQHSKEPPITSLPITALPSLVTQLTYCAAALGRVGADFRSSVARCVSDAVVQIFSREIVLAE # KHFISQFPRDMYSTKGKDASNPSASKRANKLVAPSMWLLTQEDLGSTDLTSSPSSTLNSTPPFHTHRYVYFSTTEANTNAANSLPDILENSLIREGQT # IFDYVKAVFEVEELSTVDSGNSTGLSRESVVALAFARAFFEAWTPWLLNALAVGVFGLAEIRLQPKGTKEGSNSELVQLLEGWQRWAQEAST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g850 ### # start gene g851 Scaffold_7 AUGUSTUS gene 3901598 3903241 0.5 - . g851 Scaffold_7 AUGUSTUS transcript 3901598 3903241 0.5 - . g851.t1 Scaffold_7 AUGUSTUS stop_codon 3901598 3901600 . - 0 transcript_id "g851.t1"; gene_id "g851"; Scaffold_7 AUGUSTUS CDS 3901598 3903241 0.5 - 0 transcript_id "g851.t1"; gene_id "g851"; Scaffold_7 AUGUSTUS start_codon 3903239 3903241 . - 0 transcript_id "g851.t1"; gene_id "g851"; # protein sequence = [MQVDGDPDTSSTTNNHEDEKKTIFPHQSFTTRMWAEDVSDQTGSHGTAFRVDEAVRHMHSQNRLSEWDPSNARLKAQI # EGNIEHASSVDPRSMDVNMSGSSQHTSSGPGQIATTPGVTIQSGAAEVVARGRPGSIPFVFPSSSIDSASSSDDSYELKNGLKGMPHHRLGHHAVNSP # SYGESAITSSTGTSFSSLQSLPDSSMPKASTLPVIREGRLPVLNVRGEEARLRTWSAPSARSMQKVANDDNERTNKTDDPESRVLHEAFTFTSSPSVL # GDRSRAVEKSPSPFSRIRSIDHDESASLPPPSRSLSPPNRTEVSSAPPNPQSPDKSEGSIVADSSPTSATKANYLSTNPVFRSVPVGTANESANASVY # SQSVSTGNLDFSPFVKDARINTSSADFSYPRALHHDKSPQALSNLGEPVLEVLQDMREQRMSLCQSLRQYVFVHAAVIEGALMIVDEERERERKTIRM # DVDDISSMKQAVSSTPGPSSSPSRHSWTTTTGKRVASPTELPKEDKKGAQMLFKRPSIKKKLVLSNRSQGAPESEMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g851 ### # start gene g852 Scaffold_7 AUGUSTUS gene 3903343 3904625 0.84 - . g852 Scaffold_7 AUGUSTUS transcript 3903343 3904625 0.84 - . g852.t1 Scaffold_7 AUGUSTUS stop_codon 3903343 3903345 . - 0 transcript_id "g852.t1"; gene_id "g852"; Scaffold_7 AUGUSTUS CDS 3903343 3904363 1 - 1 transcript_id "g852.t1"; gene_id "g852"; Scaffold_7 AUGUSTUS CDS 3904426 3904625 0.84 - 0 transcript_id "g852.t1"; gene_id "g852"; Scaffold_7 AUGUSTUS start_codon 3904623 3904625 . - 0 transcript_id "g852.t1"; gene_id "g852"; # protein sequence = [MRAPPPAAGSGGETTESEHEHDDSEKEPTSEDHDDYVNASYVQPLCTTRRYIATQGPLEATFVDFWTLVYQQNVHVII # MLTREIEGSMVKCGPYWKDEVFGPLRLKLMSVEGNVDEGKDDDVRRKAGGGDAVGGFFFSSPVVPDTKLGKKKKKNPADAIIKRTFLLSHVGYPDIPP # RKIVQFQYLEWPDMNVPDDPRGVLGLIKEVDQAVTEAMHLNDQGKEEEDTTKEVLPSNIEAGVPAFIRPSLSRSKSGSVEILNRNTGIANKAMGRRHS # PVLLHCSAGVGRTGGFIMVDAVLDGIRREVRKKKLCLHQPQNDIINSWNTSGTMDVDVKNEETAVQDEQGYWNRTGNCDVDMAGNKTDLRTVAIPAHN # SGNILHVPVHTSTMVTTLILFYRIPLGKSLTMTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g852 ### # start gene g853 Scaffold_7 AUGUSTUS gene 3905103 3906731 1 - . g853 Scaffold_7 AUGUSTUS transcript 3905103 3906731 1 - . g853.t1 Scaffold_7 AUGUSTUS stop_codon 3905103 3905105 . - 0 transcript_id "g853.t1"; gene_id "g853"; Scaffold_7 AUGUSTUS CDS 3905103 3906731 1 - 0 transcript_id "g853.t1"; gene_id "g853"; Scaffold_7 AUGUSTUS start_codon 3906729 3906731 . - 0 transcript_id "g853.t1"; gene_id "g853"; # protein sequence = [MDQDFFGTKPDSGSLGDDVDTFARAISERSILNPVMNAKDLSPIKSKLPLSTTNSKPSSSFSSVEPTHLLPFINNTSA # LIIDIRPHAAYSSARIPTALSLSVPSTLLKRPFSPWTVLEQCFLHLPLVLVFAEWPKFTTIVVYDVDSIGSPFLPEGNNILGLLRKFSNDAAYNGNAL # FWLKGGFQRVWRERRDLVDFRPPEPEPEDDVNEPGSLKTNHLPSKAFGSGTTTRSSLDLSSPRKRPPSAMSLRANAPLMSEKTSGTSSVPFNPFFDTI # RQNMELTQVCDHLTFSSIFYINILLQGITERIPLRLPKRVRKRIDDLPFEWLREISRRADVKPDDSFTSDGDESPPSTSENKSNATNHLSPKSSGKLL # PPGIHYERPTSPIKMSQQHPTPPPPDQALLDEGMEALAMQFYRIELAEQRRLMGVMKHHSAESGVVSSQTQAQRKDIVESADSSGLRPHVPQTVDYIS # AHVSLRSVSPSPQPGHMRESFGVLNSNKPRNVSSGPIVPPSISESDSDHGRDSKTVFPYSITAGVEKGAKNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g853 ### # start gene g854 Scaffold_7 AUGUSTUS gene 3918752 3919183 0.96 - . g854 Scaffold_7 AUGUSTUS transcript 3918752 3919183 0.96 - . g854.t1 Scaffold_7 AUGUSTUS stop_codon 3918752 3918754 . - 0 transcript_id "g854.t1"; gene_id "g854"; Scaffold_7 AUGUSTUS CDS 3918752 3919183 0.96 - 0 transcript_id "g854.t1"; gene_id "g854"; Scaffold_7 AUGUSTUS start_codon 3919181 3919183 . - 0 transcript_id "g854.t1"; gene_id "g854"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g854 ### # start gene g855 Scaffold_7 AUGUSTUS gene 3924402 3926411 0.96 - . g855 Scaffold_7 AUGUSTUS transcript 3924402 3926411 0.96 - . g855.t1 Scaffold_7 AUGUSTUS stop_codon 3924402 3924404 . - 0 transcript_id "g855.t1"; gene_id "g855"; Scaffold_7 AUGUSTUS CDS 3924402 3926411 0.96 - 0 transcript_id "g855.t1"; gene_id "g855"; Scaffold_7 AUGUSTUS start_codon 3926409 3926411 . - 0 transcript_id "g855.t1"; gene_id "g855"; # protein sequence = [MYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIP # VTEDESDEQPIAIRRPVRTRKPPGEWWKTKPSTSRVPANNDDSDDSNDDYYGDAELAASTTLQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTW # DIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQP # EGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVKLGFKRLESDPCVYLFQRGDIKVIVPVWVDDITLASKNSGVLNKFVIELSKELKLRDLGET # TFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGMQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRF # NSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEV # LAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPITS # DDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g855 ### # start gene g856 Scaffold_7 AUGUSTUS gene 3926494 3928378 0.19 - . g856 Scaffold_7 AUGUSTUS transcript 3926494 3928378 0.19 - . g856.t1 Scaffold_7 AUGUSTUS stop_codon 3926494 3926496 . - 0 transcript_id "g856.t1"; gene_id "g856"; Scaffold_7 AUGUSTUS CDS 3926494 3927118 0.79 - 1 transcript_id "g856.t1"; gene_id "g856"; Scaffold_7 AUGUSTUS CDS 3927169 3927628 0.36 - 2 transcript_id "g856.t1"; gene_id "g856"; Scaffold_7 AUGUSTUS CDS 3927751 3928378 0.52 - 0 transcript_id "g856.t1"; gene_id "g856"; Scaffold_7 AUGUSTUS start_codon 3928376 3928378 . - 0 transcript_id "g856.t1"; gene_id "g856"; # protein sequence = [MWSILEQQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDS # ELQSMALIRALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPS # NPHNKRKGIQANKAKVTEVDDDGVTESAGSATAKFQFDLQIILLCILKEWAEVLFTPIVDGKEARQVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQI # LKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHSASFTIIMVMLASCLRIRWLRALNSSLVQNQTHTETRASEVL # ELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQ # QNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKVCVHW # VP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g856 ### # start gene g857 Scaffold_7 AUGUSTUS gene 3928956 3929445 0.33 + . g857 Scaffold_7 AUGUSTUS transcript 3928956 3929445 0.33 + . g857.t1 Scaffold_7 AUGUSTUS start_codon 3928956 3928958 . + 0 transcript_id "g857.t1"; gene_id "g857"; Scaffold_7 AUGUSTUS CDS 3928956 3928973 0.6 + 0 transcript_id "g857.t1"; gene_id "g857"; Scaffold_7 AUGUSTUS CDS 3929126 3929129 0.35 + 0 transcript_id "g857.t1"; gene_id "g857"; Scaffold_7 AUGUSTUS CDS 3929195 3929445 0.35 + 2 transcript_id "g857.t1"; gene_id "g857"; Scaffold_7 AUGUSTUS stop_codon 3929443 3929445 . + 0 transcript_id "g857.t1"; gene_id "g857"; # protein sequence = [MTRVNILMITRSDEALCNVCRRVFYHYSMLNKIAASMASVVSVESPTKQLTPNPAMRSLSTVDQRVKTALAGPRSLAG # TKRAAPESNSRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g857 ### # start gene g858 Scaffold_7 AUGUSTUS gene 3933574 3934257 0.18 - . g858 Scaffold_7 AUGUSTUS transcript 3933574 3934257 0.18 - . g858.t1 Scaffold_7 AUGUSTUS stop_codon 3933574 3933576 . - 0 transcript_id "g858.t1"; gene_id "g858"; Scaffold_7 AUGUSTUS CDS 3933574 3934257 0.18 - 0 transcript_id "g858.t1"; gene_id "g858"; Scaffold_7 AUGUSTUS start_codon 3934255 3934257 . - 0 transcript_id "g858.t1"; gene_id "g858"; # protein sequence = [MSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISDADLGGN # KDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWL # REQVIHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTMIGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g858 ### # start gene g859 Scaffold_7 AUGUSTUS gene 3937473 3938409 0.8 + . g859 Scaffold_7 AUGUSTUS transcript 3937473 3938409 0.8 + . g859.t1 Scaffold_7 AUGUSTUS start_codon 3937473 3937475 . + 0 transcript_id "g859.t1"; gene_id "g859"; Scaffold_7 AUGUSTUS CDS 3937473 3937730 0.9 + 0 transcript_id "g859.t1"; gene_id "g859"; Scaffold_7 AUGUSTUS CDS 3937781 3937940 0.98 + 0 transcript_id "g859.t1"; gene_id "g859"; Scaffold_7 AUGUSTUS CDS 3938021 3938409 0.89 + 2 transcript_id "g859.t1"; gene_id "g859"; Scaffold_7 AUGUSTUS stop_codon 3938407 3938409 . + 0 transcript_id "g859.t1"; gene_id "g859"; # protein sequence = [MWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARFEAAMADIQNLRLLLLLLLSSQMDFLPSDSHSIPWTL # NYNLWLSSDNLDKEKILAAFLAEQQNQEHAEQQSESSCTGCILLTRRRIYKLLLGLEPKDYSNKAKVTEVDDDGVTESAGSATASSLSNVLSASSFAD # TMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEARQVYFLESYMYLHLITISSLFYISPSTKVLLYKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g859 ### # start gene g860 Scaffold_7 AUGUSTUS gene 3938627 3939067 0.58 + . g860 Scaffold_7 AUGUSTUS transcript 3938627 3939067 0.58 + . g860.t1 Scaffold_7 AUGUSTUS start_codon 3938627 3938629 . + 0 transcript_id "g860.t1"; gene_id "g860"; Scaffold_7 AUGUSTUS CDS 3938627 3939067 0.58 + 0 transcript_id "g860.t1"; gene_id "g860"; Scaffold_7 AUGUSTUS stop_codon 3939065 3939067 . + 0 transcript_id "g860.t1"; gene_id "g860"; # protein sequence = [MVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPM # KKKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGSKYNARLEIDLSKMESLKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g860 ### # start gene g861 Scaffold_7 AUGUSTUS gene 3939261 3939914 0.63 + . g861 Scaffold_7 AUGUSTUS transcript 3939261 3939914 0.63 + . g861.t1 Scaffold_7 AUGUSTUS start_codon 3939261 3939263 . + 0 transcript_id "g861.t1"; gene_id "g861"; Scaffold_7 AUGUSTUS CDS 3939261 3939914 0.63 + 0 transcript_id "g861.t1"; gene_id "g861"; Scaffold_7 AUGUSTUS stop_codon 3939912 3939914 . + 0 transcript_id "g861.t1"; gene_id "g861"; # protein sequence = [MAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTP # KQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPHVTVSLLVNGGKQNHPLPCVPAPNDDS # DDSNDDYYGDAELASISTQQVEPRNYREAMHSSEAFKWEEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g861 ### # start gene g862 Scaffold_7 AUGUSTUS gene 3940725 3941426 0.72 + . g862 Scaffold_7 AUGUSTUS transcript 3940725 3941426 0.72 + . g862.t1 Scaffold_7 AUGUSTUS start_codon 3940725 3940727 . + 0 transcript_id "g862.t1"; gene_id "g862"; Scaffold_7 AUGUSTUS CDS 3940725 3941426 0.72 + 0 transcript_id "g862.t1"; gene_id "g862"; Scaffold_7 AUGUSTUS stop_codon 3941424 3941426 . + 0 transcript_id "g862.t1"; gene_id "g862"; # protein sequence = [MINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISD # ADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLD # RTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTMIGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g862 ### # start gene g863 Scaffold_7 AUGUSTUS gene 3944211 3945011 0.79 - . g863 Scaffold_7 AUGUSTUS transcript 3944211 3945011 0.79 - . g863.t1 Scaffold_7 AUGUSTUS stop_codon 3944211 3944213 . - 0 transcript_id "g863.t1"; gene_id "g863"; Scaffold_7 AUGUSTUS CDS 3944211 3945011 0.79 - 0 transcript_id "g863.t1"; gene_id "g863"; Scaffold_7 AUGUSTUS start_codon 3945009 3945011 . - 0 transcript_id "g863.t1"; gene_id "g863"; # protein sequence = [MSENRHRPYIKVETPFNVDRLENLLASHPNQPFVASVMRSLREGFWPFYEAEWEVESKQKLDNYVSEPQDFAALRAHR # DQEVAAGRWSEALPEDFVLLPGMKVSPMFVVWQKGKPRVVMDHTGSGLNDNIPKAEGKVKYDDMHTFGQVLNDILKEHPDEELILFKSDVSKAFLNLP # GHPLWQLCQVVEVDGRYHIVRRLVFGTRTSPRCWCSLSSLMCWFGSEKLGIIGLHVIWMISMAGTLRGICYCSMINSALRDRSSSLYSGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g863 ### # start gene g864 Scaffold_7 AUGUSTUS gene 3947276 3948416 0.47 - . g864 Scaffold_7 AUGUSTUS transcript 3947276 3948416 0.47 - . g864.t1 Scaffold_7 AUGUSTUS stop_codon 3947276 3947278 . - 0 transcript_id "g864.t1"; gene_id "g864"; Scaffold_7 AUGUSTUS CDS 3947276 3947681 0.55 - 1 transcript_id "g864.t1"; gene_id "g864"; Scaffold_7 AUGUSTUS CDS 3947806 3948416 0.77 - 0 transcript_id "g864.t1"; gene_id "g864"; Scaffold_7 AUGUSTUS start_codon 3948414 3948416 . - 0 transcript_id "g864.t1"; gene_id "g864"; # protein sequence = [MLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVF # IGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNS # PRLEHTPGPDIPVTEDESDEQPLLYDVPINHSQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIER # FKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHASLTRTLTPLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g864 ### # start gene g865 Scaffold_7 AUGUSTUS gene 3948661 3950244 0.7 - . g865 Scaffold_7 AUGUSTUS transcript 3948661 3950244 0.7 - . g865.t1 Scaffold_7 AUGUSTUS stop_codon 3948661 3948663 . - 0 transcript_id "g865.t1"; gene_id "g865"; Scaffold_7 AUGUSTUS CDS 3948661 3950244 0.7 - 0 transcript_id "g865.t1"; gene_id "g865"; Scaffold_7 AUGUSTUS start_codon 3950242 3950244 . - 0 transcript_id "g865.t1"; gene_id "g865"; # protein sequence = [MKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQVPIKAHQEDPIRMWSILEQQHVSKKP # GARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALIRALPEEYRHLSSNLLMQDNLDKEKIL # AAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKGIQANKAKVTEVDDDGVTESAGSATAS # SLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEARQVLFSRVLHVPSLNNNLLSVLYLTKH # KGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLESSAKPDPVC # EPCLGGKMHANPSPVLRPALLKCWNLSLRMYMTLVSSHMKATAIGFRSSAIRHALEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g865 ### # start gene g866 Scaffold_7 AUGUSTUS gene 3952763 3955265 0.35 + . g866 Scaffold_7 AUGUSTUS transcript 3952763 3955265 0.35 + . g866.t1 Scaffold_7 AUGUSTUS start_codon 3952763 3952765 . + 0 transcript_id "g866.t1"; gene_id "g866"; Scaffold_7 AUGUSTUS CDS 3952763 3952952 0.5 + 0 transcript_id "g866.t1"; gene_id "g866"; Scaffold_7 AUGUSTUS CDS 3953407 3953429 0.73 + 2 transcript_id "g866.t1"; gene_id "g866"; Scaffold_7 AUGUSTUS CDS 3953506 3953729 0.7 + 0 transcript_id "g866.t1"; gene_id "g866"; Scaffold_7 AUGUSTUS CDS 3953810 3954158 0.84 + 1 transcript_id "g866.t1"; gene_id "g866"; Scaffold_7 AUGUSTUS CDS 3954558 3955265 0.66 + 0 transcript_id "g866.t1"; gene_id "g866"; Scaffold_7 AUGUSTUS stop_codon 3955263 3955265 . + 0 transcript_id "g866.t1"; gene_id "g866"; # protein sequence = [MKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQVPIKAHQEDPIRLETLRITANKAKVT # EVDDDGVTESAGSATASSLSNGLSASSFADTMQWNTDTGATSHMTPHRTGFETILHIEFQFDLQIILLVLHVPSLNNNLLSVLYLTKHKGFTVQILKD # TMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLESSAKPDPDIGGTTDCYATG # IGFTKDILGECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISE # RADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIA # IRRRPARNRKPPGEWWKTKPSSSRVPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g866 ### # start gene g867 Scaffold_7 AUGUSTUS gene 3955653 3956917 0.69 + . g867 Scaffold_7 AUGUSTUS transcript 3955653 3956917 0.69 + . g867.t1 Scaffold_7 AUGUSTUS start_codon 3955653 3955655 . + 0 transcript_id "g867.t1"; gene_id "g867"; Scaffold_7 AUGUSTUS CDS 3955653 3956301 0.69 + 0 transcript_id "g867.t1"; gene_id "g867"; Scaffold_7 AUGUSTUS CDS 3956412 3956917 1 + 2 transcript_id "g867.t1"; gene_id "g867"; Scaffold_7 AUGUSTUS stop_codon 3956915 3956917 . + 0 transcript_id "g867.t1"; gene_id "g867"; # protein sequence = [MELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVKLGFKRLESDPCVYL # FQRGNIKVIVPVWVDDITLACKDPGVLDKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLEEFSMQDSKPVKTPLNPTVSLSK # EDSPKTPEDKEAMINIPYMSAVGSLLFLAMILRADIAFATDPTAPDLITAISDADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFV # ASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVTHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTM # IGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g867 ### # start gene g868 Scaffold_7 AUGUSTUS gene 3970607 3972711 0.22 - . g868 Scaffold_7 AUGUSTUS transcript 3970607 3972711 0.22 - . g868.t1 Scaffold_7 AUGUSTUS stop_codon 3970607 3970609 . - 0 transcript_id "g868.t1"; gene_id "g868"; Scaffold_7 AUGUSTUS CDS 3970607 3970880 0.97 - 1 transcript_id "g868.t1"; gene_id "g868"; Scaffold_7 AUGUSTUS CDS 3970940 3971268 0.43 - 0 transcript_id "g868.t1"; gene_id "g868"; Scaffold_7 AUGUSTUS CDS 3971382 3971503 0.54 - 2 transcript_id "g868.t1"; gene_id "g868"; Scaffold_7 AUGUSTUS CDS 3971589 3971611 0.58 - 1 transcript_id "g868.t1"; gene_id "g868"; Scaffold_7 AUGUSTUS CDS 3971716 3972122 0.58 - 0 transcript_id "g868.t1"; gene_id "g868"; Scaffold_7 AUGUSTUS CDS 3972283 3972711 0.56 - 0 transcript_id "g868.t1"; gene_id "g868"; Scaffold_7 AUGUSTUS start_codon 3972709 3972711 . - 0 transcript_id "g868.t1"; gene_id "g868"; # protein sequence = [MNLYNRQPSEIHYDRIGGRNAAHLVNQDDPDVLEIWNNVFIQFNREEDGSLKSLPSKHVDTGMGFERLVSVVQDKRSN # YDTDVFTPIFAKIQELTGVRPYEGRFGVDDQDGIDTAYRVVADHVRTLTFALSDGGVPNKDGRGYGHIFPEITTKTVEIKEILDEEEESFSRTLDRGE # KLFDQYSAHVKQQGSNILSGKDVWRLYDTYGFPVDLTRLMAEELGLEINDAEFNEAQAASKEASKATLKKGAGNIVKLDVHDLAYLENAGLPKTDDSA # KYGIFQPWKYHQNGLTDFEVTNVQVYNGHVLHTGFLKYGQLELGNQVVSSYDEVLGDHIDQRGSLVAPSKLRFDFSHKAQITIPDLTKIEAMSIDWVQ # KNVKVYSKELDLHNAYKIPGLRAVFGESYPDPVRVVSLEYDVDDIAKDIENPMWRKTSIEFCGGTHVAKTGDIKEFVITEESGIAKGIRRIVAVTGHE # AQEMNRLVQDFKFRIDQVSHLSDKEQDAALKALSVVSKGILCPFDSPLPPFSGNRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g868 ### # start gene g869 Scaffold_7 AUGUSTUS gene 3976047 3977350 0.23 + . g869 Scaffold_7 AUGUSTUS transcript 3976047 3977350 0.23 + . g869.t1 Scaffold_7 AUGUSTUS start_codon 3976047 3976049 . + 0 transcript_id "g869.t1"; gene_id "g869"; Scaffold_7 AUGUSTUS CDS 3976047 3976365 0.37 + 0 transcript_id "g869.t1"; gene_id "g869"; Scaffold_7 AUGUSTUS CDS 3976434 3976571 0.26 + 2 transcript_id "g869.t1"; gene_id "g869"; Scaffold_7 AUGUSTUS CDS 3977013 3977350 0.64 + 2 transcript_id "g869.t1"; gene_id "g869"; Scaffold_7 AUGUSTUS stop_codon 3977348 3977350 . + 0 transcript_id "g869.t1"; gene_id "g869"; # protein sequence = [MVGSEVYSTEVKKTEVLAESFRRAIGLRIKETKEVYEGEVTEMTPSESENPLSGYGKTISHVVVGLKSVKGTKQLRLD # PSIYEAMLKEKIVVGDVIYIEHSGAVKVHAYASSYDLESETYVPLPKGDVHKRKELVQDVTLGDLDAANARPQGEPYAKEQVAKVLQLRANIEGLKLA # EGVLDKLATEGEKSSLRYLALNTLPPAVRIHTLHFCRYALQLLAPASIIASINDRSEISLEDVGEMNELFLDAKTSAAMIGASENVKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g869 ### # start gene g870 Scaffold_7 AUGUSTUS gene 3987504 3987818 0.71 + . g870 Scaffold_7 AUGUSTUS transcript 3987504 3987818 0.71 + . g870.t1 Scaffold_7 AUGUSTUS start_codon 3987504 3987506 . + 0 transcript_id "g870.t1"; gene_id "g870"; Scaffold_7 AUGUSTUS CDS 3987504 3987818 0.71 + 0 transcript_id "g870.t1"; gene_id "g870"; Scaffold_7 AUGUSTUS stop_codon 3987816 3987818 . + 0 transcript_id "g870.t1"; gene_id "g870"; # protein sequence = [MGRLFGVQAQARRALDGGQLPNDTNATGQSGGIVIQYNIHYQPGQQHFNPQTQAEPLQPVPQLQGFRGPRDIWHAWPQ # PGIGEAGRDNAPVEDPVASQSVESGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g870 ### # start gene g871 Scaffold_7 AUGUSTUS gene 3992505 3993722 0.47 + . g871 Scaffold_7 AUGUSTUS transcript 3992505 3993722 0.47 + . g871.t1 Scaffold_7 AUGUSTUS start_codon 3992505 3992507 . + 0 transcript_id "g871.t1"; gene_id "g871"; Scaffold_7 AUGUSTUS CDS 3992505 3992588 0.48 + 0 transcript_id "g871.t1"; gene_id "g871"; Scaffold_7 AUGUSTUS CDS 3992868 3993722 0.55 + 0 transcript_id "g871.t1"; gene_id "g871"; Scaffold_7 AUGUSTUS stop_codon 3993720 3993722 . + 0 transcript_id "g871.t1"; gene_id "g871"; # protein sequence = [MTTVQADGLTVSTPTGSTAYSVSQIALIGDHIKVTASKYPFPTVCADKQSTDWFHAISRTLKWNERERQKSFVVVEEG # PEKVKKQKKVEKTGRDGTPKPTQVEEAESLDDEEEDEVSDEEEEDKFDIDDSSPEAAAAASVISGQVTNVLSKRDQAVGHEKANELVAEEQLHKALSL # SGLRPRRHTPRSRSASPSGLRSGIDSPSRYAGLPPHPPVSVPRHVEFAPESSDESYGRNGARDELFAHRKASAKSRIPKEREDVKTPTASNSVYPRNR # SRGRAHSRTRSGEYVGHRAFAVWGQDESDSNASDSDAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g871 ### # start gene g872 Scaffold_7 AUGUSTUS gene 3993831 3994421 0.66 - . g872 Scaffold_7 AUGUSTUS transcript 3993831 3994421 0.66 - . g872.t1 Scaffold_7 AUGUSTUS stop_codon 3993831 3993833 . - 0 transcript_id "g872.t1"; gene_id "g872"; Scaffold_7 AUGUSTUS CDS 3993831 3994421 0.66 - 0 transcript_id "g872.t1"; gene_id "g872"; Scaffold_7 AUGUSTUS start_codon 3994419 3994421 . - 0 transcript_id "g872.t1"; gene_id "g872"; # protein sequence = [MYALTEIKGVGRRYSNIVCKKADVDLNKRCATFSLIARYPFDNGFSKSAGELNSDELERIVTIMQNPTQFKIPTWFLS # RQKDIVDGKDYQILSNNVDSKLRDDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGTFLESCCLSNNINLFQVVVERLLVCRRSVVKCVYHYVFFPYDN # LVLWNAYAMSPDESNKRRLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g872 ### # start gene g873 Scaffold_7 AUGUSTUS gene 3996178 3997581 0.5 + . g873 Scaffold_7 AUGUSTUS transcript 3996178 3997581 0.5 + . g873.t1 Scaffold_7 AUGUSTUS start_codon 3996178 3996180 . + 0 transcript_id "g873.t1"; gene_id "g873"; Scaffold_7 AUGUSTUS CDS 3996178 3997581 0.5 + 0 transcript_id "g873.t1"; gene_id "g873"; Scaffold_7 AUGUSTUS stop_codon 3997579 3997581 . + 0 transcript_id "g873.t1"; gene_id "g873"; # protein sequence = [MKFALVHIATQTLQHRTSLKPETPSATPIPPHKISQIGSKCTSITAAIQSLSVKPLNIVKRGDVSGPPLTGIRPPTVR # PAVIRDVSKPPTATSAAPLRTDSATVAVSAFPAFGFLNSPAESTSTISKHRRRSRSSNALFTSQLPTARTRMNSEHFKVSELSEPGHDPKVPTTVSNP # ATPTICQHHNKSPTPNTTVTTLGTPNFASKDVVRAPSATPTLRKRVSGDIQRTTESVNRRCTSKYFKSSSTATASRENLSESRIPSSKLKLAFHPHTL # DPVLLKPKHGITHSVDIVNLNPRLLQTPRIRQYQDVRNVFPRCVEPPTAVEKSQSIESVTVTPSPPLGRRSVLKSELPSKRHAIYTRSLYVGKAEKNS # SNYLRALEGMITSHSSLHSQVTDHEEVSTSSDSLESILQVYQVQSMMKLILILGPFRWDCLPPIPSPHSTTSMLHHSPLPAQVTHRLMRTSLSSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g873 ### # start gene g874 Scaffold_7 AUGUSTUS gene 3998674 3999021 0.9 - . g874 Scaffold_7 AUGUSTUS transcript 3998674 3999021 0.9 - . g874.t1 Scaffold_7 AUGUSTUS stop_codon 3998674 3998676 . - 0 transcript_id "g874.t1"; gene_id "g874"; Scaffold_7 AUGUSTUS CDS 3998674 3999021 0.9 - 0 transcript_id "g874.t1"; gene_id "g874"; Scaffold_7 AUGUSTUS start_codon 3999019 3999021 . - 0 transcript_id "g874.t1"; gene_id "g874"; # protein sequence = [MLLTHVKLHFGGPDVNNMLLTPPNQFSATLLLVPICLTAAAASPRPLVLWHGLGDSYASPGMLEFASMIKNVHPGIFI # HSIYIEEELDKDRQAGFVRVQSTNCLGAYYPKSSTGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g874 ### # start gene g875 Scaffold_7 AUGUSTUS gene 4008916 4009521 0.79 - . g875 Scaffold_7 AUGUSTUS transcript 4008916 4009521 0.79 - . g875.t1 Scaffold_7 AUGUSTUS stop_codon 4008916 4008918 . - 0 transcript_id "g875.t1"; gene_id "g875"; Scaffold_7 AUGUSTUS CDS 4008916 4009521 0.79 - 0 transcript_id "g875.t1"; gene_id "g875"; Scaffold_7 AUGUSTUS start_codon 4009519 4009521 . - 0 transcript_id "g875.t1"; gene_id "g875"; # protein sequence = [MTERLEIDPAKIPAPNFASGAHTFMRNALITDANTPEITTDEHAAQRLKVQWEIHIEGPRAQYEVQLREAETLREQRR # QEAADAERLAAVEQQEKEKELAKEADKKRMPIYSFQKGVGVESIPLQVHPYAKKMITARKYVPLWYFLPDAATEAKERSKDSLVGSHTVPRLTKRHSR # LPTILASGHARKKRLPQHTKARGLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g875 ### # start gene g876 Scaffold_7 AUGUSTUS gene 4013557 4014594 0.53 - . g876 Scaffold_7 AUGUSTUS transcript 4013557 4014594 0.53 - . g876.t1 Scaffold_7 AUGUSTUS stop_codon 4013557 4013559 . - 0 transcript_id "g876.t1"; gene_id "g876"; Scaffold_7 AUGUSTUS CDS 4013557 4014105 0.86 - 0 transcript_id "g876.t1"; gene_id "g876"; Scaffold_7 AUGUSTUS CDS 4014160 4014594 0.54 - 0 transcript_id "g876.t1"; gene_id "g876"; Scaffold_7 AUGUSTUS start_codon 4014592 4014594 . - 0 transcript_id "g876.t1"; gene_id "g876"; # protein sequence = [MYAIGPIYALDWCKSTSPKEQMRPRSSFRFGIGSFLENFSNRIAIVGLQDEHILVEDDYTDYPDFVTLCDAHHGYPVT # SLQWQPVSAISYQWSQKSPSTELLATTGDALRLWEYSGDAQPAMSNFVGRTASSSGHSLTLKTALSGQSKVQNNSNGAPLTNFSWNEKAPSLIVTSSI # DTTCTVWNIDTSAAVTQLIAHDREVYDVAWLPGSTDIFVSVGADGSLRAFDLRSLEHSTILYETPAPKNVPPPSVSPSTSARPPTSPLLRIAFNPSDS # NYMSTFHMDGSEIQILDMRSPGQPVLELKGHHSQINAVGWGSGDQPLLATAGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g876 ### # start gene g877 Scaffold_7 AUGUSTUS gene 4017070 4017432 0.19 - . g877 Scaffold_7 AUGUSTUS transcript 4017070 4017432 0.19 - . g877.t1 Scaffold_7 AUGUSTUS stop_codon 4017070 4017072 . - 0 transcript_id "g877.t1"; gene_id "g877"; Scaffold_7 AUGUSTUS CDS 4017070 4017432 0.19 - 0 transcript_id "g877.t1"; gene_id "g877"; Scaffold_7 AUGUSTUS start_codon 4017430 4017432 . - 0 transcript_id "g877.t1"; gene_id "g877"; # protein sequence = [MNERSASQDDSFRNLNAKLANPLAHIPREQLMEDARLFAETHGLKDLVLEFQKGALVAQDPSQFENLPQLDEADKAVF # RRELTHKWDQPRMLYYLVILCSMAAAVQGVCESSSKSTCTRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g877 ### # start gene g878 Scaffold_7 AUGUSTUS gene 4026049 4029792 0.24 - . g878 Scaffold_7 AUGUSTUS transcript 4026049 4029792 0.24 - . g878.t1 Scaffold_7 AUGUSTUS stop_codon 4026049 4026051 . - 0 transcript_id "g878.t1"; gene_id "g878"; Scaffold_7 AUGUSTUS CDS 4026049 4029792 0.24 - 0 transcript_id "g878.t1"; gene_id "g878"; Scaffold_7 AUGUSTUS start_codon 4029790 4029792 . - 0 transcript_id "g878.t1"; gene_id "g878"; # protein sequence = [MISTRIPTDNWTQIDIDSPDITAIQITTGIGIIRIFNIYNDCEHDDTLQALNSWMRSPAARPSESGPHHYIWLGDFNR # HHPLWDEPRNHHLFTARNLDAAQTLISLTAQYGLYMALPGSIPTLQAHNTGNYTRVDNLFCTDTLLDHIIFCNTVPSKRPILTDHFPIHTTFDIQLPT # VDERERWNWAKVDWEEFAERLEEVLGELEPPREIETEETFWNALGNFDTAVQRVIKEVVPKAKPSPHQRRWWKPTLTELKKKTGTLSSKSYKKRHNSE # HPIHEEYRRMRQAYDMEIKKAKVEKWVEYLEYADTSSVWEIGRLMENGYTDGGRARVPGLKVNQPGTTECIIEDNVGKEYVFRDAFFPPPPQSPNVPA # NAAYPNQSWTFTPPTNRQITATIRRMKNGKATKPGTIPNDLFKATSELITPYLGPIYRATFTLRIYPADWSSTETIILKKPGRPDYRDPNAWRPITLS # NGHGRLMNACVAEEITKRAELLGLLPALQFGARPGRNTTDSIHLMVDRIKELWREGYLVAVLYMDVKGAFPSVDLDMLQHELRMVGVPEEILDWMRRR # YSGRKTQLSFDDYISQPFAVPGGEDQGDPFAAVGYILYAAGLLATFKTLDKEEGFGFMDDVAAMKWGKDVNQLHAEIGQMMNKANGPLEWAASHNCQF # GVPKFKLVDFNRQRKPHPTESRKTIPITGPGVQLRGTLIKSEPFTKFLGTLMDRQLRWNEQHAAMVRKGQQWVAQFRRVARMRDGMVAQLVRQLYKAK # ALPKMLYAADIVLTPTSRKSEKKWTQASHTRGIIRKLTSIQRQAALLITGAMTTTATDILNIHAALLPLPLEIERHRHRAATRLLTLPEEHPLSDRIK # DGTRNRRRTHHFSPIHDLMARYGLRPNHMEKRRAVRYEASWDPKLTVNIWEDKSEALKAYGEDGTALKIFTDGSGFQGYVGASAILYRNGQETNAIRY # RLGSDKYHEVYEGECVGLILALHLAREEELAESISIWADSTAAIAATDTNKSGSSHYLLDIFHHALTALRACHPDIPVTISWIPGHIGVEGNERADQE # AKKATTGRSSRKEKLPTQLHRPLPHSQTATIRTFRQELEKHHNKHWRKSPRFAQFQRIDPSDATTASRNYWKLTRWLPRKLLSLLTQLRTGHIPLQKH # LHRIGKADSPTCPCCKRADETVTHFLFNCPAHRRARGRLQRKLPNQLWSLGPLLSVKQALPPLFRYINTTRRFHHIVGELPELSEDDENRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g878 ### # start gene g879 Scaffold_7 AUGUSTUS gene 4030499 4031843 0.4 - . g879 Scaffold_7 AUGUSTUS transcript 4030499 4031843 0.4 - . g879.t1 Scaffold_7 AUGUSTUS stop_codon 4030499 4030501 . - 0 transcript_id "g879.t1"; gene_id "g879"; Scaffold_7 AUGUSTUS CDS 4030499 4030591 0.48 - 0 transcript_id "g879.t1"; gene_id "g879"; Scaffold_7 AUGUSTUS CDS 4030671 4031843 0.57 - 0 transcript_id "g879.t1"; gene_id "g879"; Scaffold_7 AUGUSTUS start_codon 4031841 4031843 . - 0 transcript_id "g879.t1"; gene_id "g879"; # protein sequence = [MSRNSLNTPKEPPPGQPRLKFPAVQPPRTVPASPANTSTNGDDEHRSLIAKAVAMNLMLPGEDHTIALPTKLIQLAAS # AKDGKPKADIWEKVGLIGKILQECSYKDRMRKFKDEIMEKIEEKFDDETCRLEGRVKAMRKEVEDASNASTKLKDKVEELVRNAEARETTSWAGLMEL # EAGEIEGTTTAQLSYASAAQAKSVAQHIQQPRHNPAIRDAELKDRRIIIRSEADSDWKLTEKELVVKANLAIEKMLQDEDEGMEMKVIAATKLRGNGA # FLLMSSAAEAEAMKTGERMARFCDAWGSKAFLRPNYHELVVESLPVETLIESMYERSRIEDTNDLPSGSIAQIRWIKPIEKRRADQKYAHAILAMNDR # ATANKLILNQVIVGGKALRSMIPVHDVQDDTERAPALRQAIKCNALTAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g879 ### # start gene g880 Scaffold_7 AUGUSTUS gene 4039325 4039886 0.49 + . g880 Scaffold_7 AUGUSTUS transcript 4039325 4039886 0.49 + . g880.t1 Scaffold_7 AUGUSTUS start_codon 4039325 4039327 . + 0 transcript_id "g880.t1"; gene_id "g880"; Scaffold_7 AUGUSTUS CDS 4039325 4039460 0.8 + 0 transcript_id "g880.t1"; gene_id "g880"; Scaffold_7 AUGUSTUS CDS 4039612 4039886 0.49 + 2 transcript_id "g880.t1"; gene_id "g880"; Scaffold_7 AUGUSTUS stop_codon 4039884 4039886 . + 0 transcript_id "g880.t1"; gene_id "g880"; # protein sequence = [MSTAKLHQAWKPRLLKYDEDCLTLNIWTPSGTSPEQGWPVMLWFHAAAYRLSVFGFLASNELAEEAATLGEYAFGNYG # LWDQRAALLWTHEHVHHFGGNAQELTLSGRSAGAYSTHALASHDFCSIPKNGLSTDAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g880 ### # start gene g881 Scaffold_7 AUGUSTUS gene 4041704 4042102 0.21 - . g881 Scaffold_7 AUGUSTUS transcript 4041704 4042102 0.21 - . g881.t1 Scaffold_7 AUGUSTUS stop_codon 4041704 4041706 . - 0 transcript_id "g881.t1"; gene_id "g881"; Scaffold_7 AUGUSTUS CDS 4041704 4042102 0.21 - 0 transcript_id "g881.t1"; gene_id "g881"; Scaffold_7 AUGUSTUS start_codon 4042100 4042102 . - 0 transcript_id "g881.t1"; gene_id "g881"; # protein sequence = [MSPISNIPSTHELEDSSVNSLPSHYSMLPHQHTSLSISPRHYSPSEVTPYPNVDILPKESLRPDFQMDSVYQDAPNSY # IPQTPDQEVVDYMIGSQLSHYESGCNAWFWPGDGGESAYNVNGSMLQNSHIASV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g881 ### # start gene g882 Scaffold_7 AUGUSTUS gene 4044419 4044685 0.96 - . g882 Scaffold_7 AUGUSTUS transcript 4044419 4044685 0.96 - . g882.t1 Scaffold_7 AUGUSTUS stop_codon 4044419 4044421 . - 0 transcript_id "g882.t1"; gene_id "g882"; Scaffold_7 AUGUSTUS CDS 4044419 4044685 0.96 - 0 transcript_id "g882.t1"; gene_id "g882"; Scaffold_7 AUGUSTUS start_codon 4044683 4044685 . - 0 transcript_id "g882.t1"; gene_id "g882"; # protein sequence = [MLNQWIDDHGSSGSKDAVRKLPHKLSGRSSRTDGVDFDEDEDDEPQLSLLRDAPSRGHRSFKKPKLWPDNSQNTNLQG # DLEEEDGQSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g882 ### # start gene g883 Scaffold_7 AUGUSTUS gene 4050038 4050361 0.55 + . g883 Scaffold_7 AUGUSTUS transcript 4050038 4050361 0.55 + . g883.t1 Scaffold_7 AUGUSTUS start_codon 4050038 4050040 . + 0 transcript_id "g883.t1"; gene_id "g883"; Scaffold_7 AUGUSTUS CDS 4050038 4050361 0.55 + 0 transcript_id "g883.t1"; gene_id "g883"; Scaffold_7 AUGUSTUS stop_codon 4050359 4050361 . + 0 transcript_id "g883.t1"; gene_id "g883"; # protein sequence = [MEREQILAHNFELGVHPEAVEAELRESISTALTPSQALRLKHQHLHSISTLANQFGGKIVDVSENSVIVELTAKTNRV # EAFLGLLRPFGILEAARTGKYLIFVCDPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g883 ### # start gene g884 Scaffold_7 AUGUSTUS gene 4050930 4052009 0.86 - . g884 Scaffold_7 AUGUSTUS transcript 4050930 4052009 0.86 - . g884.t1 Scaffold_7 AUGUSTUS stop_codon 4050930 4050932 . - 0 transcript_id "g884.t1"; gene_id "g884"; Scaffold_7 AUGUSTUS CDS 4050930 4052009 0.86 - 0 transcript_id "g884.t1"; gene_id "g884"; Scaffold_7 AUGUSTUS start_codon 4052007 4052009 . - 0 transcript_id "g884.t1"; gene_id "g884"; # protein sequence = [MISGRFAFSALSEYLTLQKVKQVEYTFPEGFDNNAKDLVQKLLVSFTAFVPTNQNHSCQVREPTDRLGAGEPSSSLGM # SALRSHPFFESTIWATLWTEPAPPIVAGLVQREYPLDQGQDKNWQDVGATWDALVMDDDVSPVGDDIDWADDAEGSSLLLRQRQCDTSMSPVDISLVS # QVIPGDLDEEHRGLSGSADSTAAMPITIHSSVARTESPPSGSPESSSDGDGSVERVAAGLQTMKPFRFTSDYNEIAVERERGRSQAPTPIQGNTSSTI # ELYACNHLFPAILFIISCRPLALNPEPNEVVIYRSIVEDHSARRRANRLLKPIPGAQIKPKARELILTNYRLICVKAKTPPSYAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g884 ### # start gene g885 Scaffold_7 AUGUSTUS gene 4056497 4056929 0.55 - . g885 Scaffold_7 AUGUSTUS transcript 4056497 4056929 0.55 - . g885.t1 Scaffold_7 AUGUSTUS stop_codon 4056497 4056499 . - 0 transcript_id "g885.t1"; gene_id "g885"; Scaffold_7 AUGUSTUS CDS 4056497 4056702 1 - 2 transcript_id "g885.t1"; gene_id "g885"; Scaffold_7 AUGUSTUS CDS 4056761 4056929 0.55 - 0 transcript_id "g885.t1"; gene_id "g885"; Scaffold_7 AUGUSTUS start_codon 4056927 4056929 . - 0 transcript_id "g885.t1"; gene_id "g885"; # protein sequence = [MRDRDTQRSRGFGFVTFSTSQEAEAAIAALHEQELDGRLIKVNIAKVRGGGGGGGGGYGGGYSGGGGGGGYGGYQGGG # GGYQGGGGYNGSGGGGYSGGSGGYQVEDTGGGGGGYSGGGGGYQSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g885 ### # start gene g886 Scaffold_7 AUGUSTUS gene 4057872 4058657 0.38 - . g886 Scaffold_7 AUGUSTUS transcript 4057872 4058657 0.38 - . g886.t1 Scaffold_7 AUGUSTUS stop_codon 4057872 4057874 . - 0 transcript_id "g886.t1"; gene_id "g886"; Scaffold_7 AUGUSTUS CDS 4057872 4058657 0.38 - 0 transcript_id "g886.t1"; gene_id "g886"; Scaffold_7 AUGUSTUS start_codon 4058655 4058657 . - 0 transcript_id "g886.t1"; gene_id "g886"; # protein sequence = [MWADQISASDDPAFSIHSVKPEVSGYSAGPSESTEQVVLPPEDENVGAYVEVPAPEIDLKESAVVTTESKPEQEPESI # VTEEPAPTAPEQEAVPIANPIAFPSAEPEEEPTVPLGVTSEPTSPIIAFPISDETQSTTRTTPTSPVLAGVTFEATSGSPRSGTPDPDAEPKRKRISS # QNFQRLARRISISTRRQGSVASIIPGIPGLKRDSSPRVSVDDGAASSSARGEGSVHDSPAPSLGEDLDKTKKKKKISKKEKKKTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g886 ### # start gene g887 Scaffold_7 AUGUSTUS gene 4069271 4069914 0.48 - . g887 Scaffold_7 AUGUSTUS transcript 4069271 4069914 0.48 - . g887.t1 Scaffold_7 AUGUSTUS stop_codon 4069271 4069273 . - 0 transcript_id "g887.t1"; gene_id "g887"; Scaffold_7 AUGUSTUS CDS 4069271 4069830 0.95 - 2 transcript_id "g887.t1"; gene_id "g887"; Scaffold_7 AUGUSTUS CDS 4069896 4069914 0.48 - 0 transcript_id "g887.t1"; gene_id "g887"; Scaffold_7 AUGUSTUS start_codon 4069912 4069914 . - 0 transcript_id "g887.t1"; gene_id "g887"; # protein sequence = [MAGGNLVLKSVLQIQPQFVNPPELYSEQGSLHSMRSHLSPVNSRSSGSASVSRREKSGSTGSASSRPSARSAARSIVS # GSDGSGASLAHSNSISADDRRKNRAQPPMSPAFSVFGNNPLPASSSGHSHHPSLDSPLSEESVDKLLKISTPIAEVSTVATSSEDRGQLSPRSPRSPL # SSVPWAAGLDDAWSPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g887 ### # start gene g888 Scaffold_7 AUGUSTUS gene 4069953 4070408 0.16 - . g888 Scaffold_7 AUGUSTUS transcript 4069953 4070408 0.16 - . g888.t1 Scaffold_7 AUGUSTUS stop_codon 4069953 4069955 . - 0 transcript_id "g888.t1"; gene_id "g888"; Scaffold_7 AUGUSTUS CDS 4069953 4070408 0.16 - 0 transcript_id "g888.t1"; gene_id "g888"; Scaffold_7 AUGUSTUS start_codon 4070406 4070408 . - 0 transcript_id "g888.t1"; gene_id "g888"; # protein sequence = [MMLNHLCLVTPLVMPPPRAMANSGSAEFGFWPQTGTETASSMTAVAPGRSQDGQTTGTQSTSASTGNHTGDVLDMPAP # RGISPFASSHSVREVGSLSSQGSQGKAEFPYPPGLTSFSTPGVWNETVGTTPSPGSFAAVPTLALGAEIGLEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g888 ### # start gene g889 Scaffold_7 AUGUSTUS gene 4070912 4071882 0.33 - . g889 Scaffold_7 AUGUSTUS transcript 4070912 4071882 0.33 - . g889.t1 Scaffold_7 AUGUSTUS stop_codon 4070912 4070914 . - 0 transcript_id "g889.t1"; gene_id "g889"; Scaffold_7 AUGUSTUS CDS 4070912 4071729 0.7 - 2 transcript_id "g889.t1"; gene_id "g889"; Scaffold_7 AUGUSTUS CDS 4071822 4071882 0.33 - 0 transcript_id "g889.t1"; gene_id "g889"; Scaffold_7 AUGUSTUS start_codon 4071880 4071882 . - 0 transcript_id "g889.t1"; gene_id "g889"; # protein sequence = [MAAPTQILPPWLSATEVVVDDSSGISVYLWRLNLTGVLDVKYSDTPSTSSSSATSTATPSSTSTSLPSSSSTATSTSS # SSPAPSTSSSTASSSSSSITPSSPTTPTAKVMVWKEVNSLALLLPAFLDSSSYSCWLFSYTSGGMLVVIVVVMERTLSMVPPSDDDDLVIIPPGGVSP # GEGSPRVSGEEADPFLRRQSGNSATHHASSVAGPSADNARQPPSTDNSVTSSTKSSSNSAASGYGTLLQIPVSVYLSLNSRIDAGIFYHQMNSVNLVI # FLRSSNVHGYRLWENRVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g889 ### # start gene g890 Scaffold_7 AUGUSTUS gene 4076434 4077819 0.47 - . g890 Scaffold_7 AUGUSTUS transcript 4076434 4077819 0.47 - . g890.t1 Scaffold_7 AUGUSTUS stop_codon 4076434 4076436 . - 0 transcript_id "g890.t1"; gene_id "g890"; Scaffold_7 AUGUSTUS CDS 4076434 4076705 0.89 - 2 transcript_id "g890.t1"; gene_id "g890"; Scaffold_7 AUGUSTUS CDS 4076800 4077430 0.79 - 0 transcript_id "g890.t1"; gene_id "g890"; Scaffold_7 AUGUSTUS CDS 4077521 4077641 0.6 - 1 transcript_id "g890.t1"; gene_id "g890"; Scaffold_7 AUGUSTUS CDS 4077692 4077819 0.89 - 0 transcript_id "g890.t1"; gene_id "g890"; Scaffold_7 AUGUSTUS start_codon 4077817 4077819 . - 0 transcript_id "g890.t1"; gene_id "g890"; # protein sequence = [MEALYVQCAEVLSLAQSMKDDLAALLDPDTGIAPRFRQLCRDQIEELENVASFESVSEEKELLRLEENTWALLQAVMP # SVPCLQNPYTPTATIAQAILNASPVLTELIVVREWLQDTAPPPMQPEATTGYWKFTKHNIMQGLRTGAGARHGLVKEMDPDAVNRGDGRSLAADDSVR # VSKLFVLFVFIWSPRATKKASYRPCTDMFEQADSRMPLSYAREHTNPGEPQVYEVLFFSIGRVSVQSSHLFNYIRSQHTVVNEGFQDEMDDDDADSWT # GNPNRRLWKSACSRAALNVSPAPQTSLILKSACRTWEDHLWAQISIMCEEKQTMEMSRLGGSFWEGGMSAVEKGARSVSRETMEEEEEEWEEEVRGAL # NGLKSVHVEEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g890 ### # start gene g891 Scaffold_7 AUGUSTUS gene 4079224 4079628 0.94 + . g891 Scaffold_7 AUGUSTUS transcript 4079224 4079628 0.94 + . g891.t1 Scaffold_7 AUGUSTUS start_codon 4079224 4079226 . + 0 transcript_id "g891.t1"; gene_id "g891"; Scaffold_7 AUGUSTUS CDS 4079224 4079628 0.94 + 0 transcript_id "g891.t1"; gene_id "g891"; Scaffold_7 AUGUSTUS stop_codon 4079626 4079628 . + 0 transcript_id "g891.t1"; gene_id "g891"; # protein sequence = [MKSRVFVLERLSDANIEEIIKRAVIRLSPPSLQTSEIVKSEPSPDDSFDFSSSPCPPTPVSSQIPQPSSPPSSTSIPN # GMIPKSPNPTPLFPAYPHFTAAVLASITSLSSGDARAALSLLDMVLSAAKTTAEEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g891 ### # start gene g892 Scaffold_7 AUGUSTUS gene 4080620 4081349 0.37 + . g892 Scaffold_7 AUGUSTUS transcript 4080620 4081349 0.37 + . g892.t1 Scaffold_7 AUGUSTUS start_codon 4080620 4080622 . + 0 transcript_id "g892.t1"; gene_id "g892"; Scaffold_7 AUGUSTUS CDS 4080620 4080670 0.37 + 0 transcript_id "g892.t1"; gene_id "g892"; Scaffold_7 AUGUSTUS CDS 4080765 4081349 0.67 + 0 transcript_id "g892.t1"; gene_id "g892"; Scaffold_7 AUGUSTUS stop_codon 4081347 4081349 . + 0 transcript_id "g892.t1"; gene_id "g892"; # protein sequence = [MPALSTANGGGEEGVFNPFQNHTAENPSWLAVKPLHNVVIPLDSDPVVIDGQVVMRTPTTSSKHWLVKISALEIPVEY # EAVMDTVPKLHLRPPVLPDEVKDDFYPLPPDKGYDFIFHVGVAGRGPLRMEKLGHKLGYYMKDAAGKLAPIVKGPPSEFGRRGIEDTDVSVGEQPLQV # GERLGLGFEMENAGDSYSARPSRGFGVGYEKFSDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g892 ### # start gene g893 Scaffold_7 AUGUSTUS gene 4083685 4084095 0.99 + . g893 Scaffold_7 AUGUSTUS transcript 4083685 4084095 0.99 + . g893.t1 Scaffold_7 AUGUSTUS start_codon 4083685 4083687 . + 0 transcript_id "g893.t1"; gene_id "g893"; Scaffold_7 AUGUSTUS CDS 4083685 4084095 0.99 + 0 transcript_id "g893.t1"; gene_id "g893"; Scaffold_7 AUGUSTUS stop_codon 4084093 4084095 . + 0 transcript_id "g893.t1"; gene_id "g893"; # protein sequence = [MSRFFRQAGDSDSDSDESEELMSSGDEAPQAKPTTGAKTAMSRFLRKTGPGADSDSSSDSDSDSDEDSDSDSDVPKPK # KGLPLRSDSEDSETEEEEDRQGIRIMSAQEKRLAEMEGTGKAMENALKINDWVSISNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g893 ### # start gene g894 Scaffold_7 AUGUSTUS gene 4084169 4084707 0.34 + . g894 Scaffold_7 AUGUSTUS transcript 4084169 4084707 0.34 + . g894.t1 Scaffold_7 AUGUSTUS start_codon 4084169 4084171 . + 0 transcript_id "g894.t1"; gene_id "g894"; Scaffold_7 AUGUSTUS CDS 4084169 4084388 0.35 + 0 transcript_id "g894.t1"; gene_id "g894"; Scaffold_7 AUGUSTUS CDS 4084475 4084707 0.64 + 2 transcript_id "g894.t1"; gene_id "g894"; Scaffold_7 AUGUSTUS stop_codon 4084705 4084707 . + 0 transcript_id "g894.t1"; gene_id "g894"; # protein sequence = [MIQRQHNVSEPIPPFYIKTLLSLESSLTSAIAKEKEAKKKMNATNAKALNSMKQKVRKAAKEYEQDIAKYQAVTLITR # DAPPAPTVARAAIGTAAVTNEDENGGFKPVGKGGRTMLLTAEGIFKSLQAVQEARGKKVELILMSPRGYTDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g894 ### # start gene g895 Scaffold_7 AUGUSTUS gene 4084848 4085264 0.92 + . g895 Scaffold_7 AUGUSTUS transcript 4084848 4085264 0.92 + . g895.t1 Scaffold_7 AUGUSTUS start_codon 4084848 4084850 . + 0 transcript_id "g895.t1"; gene_id "g895"; Scaffold_7 AUGUSTUS CDS 4084848 4085264 0.92 + 0 transcript_id "g895.t1"; gene_id "g895"; Scaffold_7 AUGUSTUS stop_codon 4085262 4085264 . + 0 transcript_id "g895.t1"; gene_id "g895"; # protein sequence = [MPTELWISAQNEVDQLVAIVASNPAFIVQEITEDYDDLLERSPATEKSGIVRIRGSIISFIDRLDDEFTRSLQNIDPH # GTEYVDRLKDEKTLYSTICRAQAFYEQTKQDDPLSRVIMRRLEHIYSKVEIVFLETLAFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g895 ### # start gene g896 Scaffold_7 AUGUSTUS gene 4085501 4086067 0.51 + . g896 Scaffold_7 AUGUSTUS transcript 4085501 4086067 0.51 + . g896.t1 Scaffold_7 AUGUSTUS start_codon 4085501 4085503 . + 0 transcript_id "g896.t1"; gene_id "g896"; Scaffold_7 AUGUSTUS CDS 4085501 4086067 0.51 + 0 transcript_id "g896.t1"; gene_id "g896"; Scaffold_7 AUGUSTUS stop_codon 4086065 4086067 . + 0 transcript_id "g896.t1"; gene_id "g896"; # protein sequence = [MSHLQESIHSADVATQILYNRTVVQLGLCAFRSGLIKEAQATLQDIFTTQRVKELLAQGVHQQRYQVLTPEQEKAEKQ # RQLPFHMHINTELLEAAFLVSSMLVEIPLLASIDSEELKRKAISKPFRRLLDFADRQVFTGPPESTRDHIMQASKALQDGEWEKCRDLVQSIKIWSLM # PEAASVKEMLAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g896 ### # start gene g897 Scaffold_7 AUGUSTUS gene 4086250 4086657 0.61 + . g897 Scaffold_7 AUGUSTUS transcript 4086250 4086657 0.61 + . g897.t1 Scaffold_7 AUGUSTUS start_codon 4086250 4086252 . + 0 transcript_id "g897.t1"; gene_id "g897"; Scaffold_7 AUGUSTUS CDS 4086250 4086657 0.61 + 0 transcript_id "g897.t1"; gene_id "g897"; Scaffold_7 AUGUSTUS stop_codon 4086655 4086657 . + 0 transcript_id "g897.t1"; gene_id "g897"; # protein sequence = [MIWNEELAASLDQAGGCIAFHRTEVTRQQQLALIIAEKVNSMAEQNEKALDAKMGTSGGWGDRADGKTGEKRGEQVQE # RRGRGDRTRGGSRGNFLSGCINMFLTICVLQVVAEVVELDLHKGLGNQMGHTSQRAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g897 ### # start gene g898 Scaffold_7 AUGUSTUS gene 4089628 4091222 0.38 - . g898 Scaffold_7 AUGUSTUS transcript 4089628 4091222 0.38 - . g898.t1 Scaffold_7 AUGUSTUS stop_codon 4089628 4089630 . - 0 transcript_id "g898.t1"; gene_id "g898"; Scaffold_7 AUGUSTUS CDS 4089628 4090248 0.41 - 0 transcript_id "g898.t1"; gene_id "g898"; Scaffold_7 AUGUSTUS CDS 4090301 4090507 0.78 - 0 transcript_id "g898.t1"; gene_id "g898"; Scaffold_7 AUGUSTUS CDS 4090647 4091222 0.76 - 0 transcript_id "g898.t1"; gene_id "g898"; Scaffold_7 AUGUSTUS start_codon 4091220 4091222 . - 0 transcript_id "g898.t1"; gene_id "g898"; # protein sequence = [MVLSSKPTEFSVLTALAQTHLDFGRAKSSDGFVARAERALVESIRISLKAIAKSTGFRTVIWKTVADALYFLSTKDAF # CDLDVVHSVLVDVKSVLGSPSNRIADIIAYRSQDDLHLDSNGILEVAIAAYDHRIELGSPESVAVGSAWFDYSISLRSLAQRVPDGDRKTKVTDQISK # ALIEAIRIAPTNDTYWNARTWTNLGLLFYYHNDFELANEAFYRAQSADPDYTLAWFGQALIAITNGHTSGATSILEHAVGLANTVPEVDFQYASSIFA # RTKESGKNRSSSSTTDALLPVYFVLDRYVKSRPNDPTALHLYALVCESVGQLEIGVDLITRAIALLEASYEQTEDTEIERQFTIAHSNIGRLKLSLDD # YEGALESLETTLGLLSEEEDETTMLLRAQAQFGSGIAHFRIGNLETAVEFFEKAIGSATNNEFVQGEITVMLAQTLWAIGTSESRDQAKTRLLEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g898 ### # start gene g899 Scaffold_7 AUGUSTUS gene 4091413 4092670 0.56 - . g899 Scaffold_7 AUGUSTUS transcript 4091413 4092670 0.56 - . g899.t1 Scaffold_7 AUGUSTUS stop_codon 4091413 4091415 . - 0 transcript_id "g899.t1"; gene_id "g899"; Scaffold_7 AUGUSTUS CDS 4091413 4092256 0.73 - 1 transcript_id "g899.t1"; gene_id "g899"; Scaffold_7 AUGUSTUS CDS 4092378 4092670 0.56 - 0 transcript_id "g899.t1"; gene_id "g899"; Scaffold_7 AUGUSTUS start_codon 4092668 4092670 . - 0 transcript_id "g899.t1"; gene_id "g899"; # protein sequence = [MQIPISEGARDDDKAVEDTDVGYDMVLVNSCSFSALLMLIKRCMKEAFPSVSSSLIAARIVSEIHLLETDYDNAIQIV # ESGLRTLAKFEQDNGKILSKALQLVDEILLVSPENIAAIMGKGYILEASHEWGKAAENFAKVFELLGTEHDEGLRAQEEYAWCISRNGDVQGGIDSLQ # NVLHILGLESRDHDRARCHWRLGKCLWDLASKHRIVLCLVWYLLSSGEKIIEGFQNFIAALKCDPNYAPAFTCLGIYYSEHLSPSDPARASKCFQKAF # ELDSREADAAHRLAKGFADEQEWDLVEVVARRTIEGEGGLDGGLQKIEENVAGKYLPTNAWAWKALGVVSLVRRQFISYHASNIAIDESKLHTCYKCP # SGSFEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g899 ### # start gene g900 Scaffold_7 AUGUSTUS gene 4094999 4096431 0.34 - . g900 Scaffold_7 AUGUSTUS transcript 4094999 4096431 0.34 - . g900.t1 Scaffold_7 AUGUSTUS stop_codon 4094999 4095001 . - 0 transcript_id "g900.t1"; gene_id "g900"; Scaffold_7 AUGUSTUS CDS 4094999 4095809 0.74 - 1 transcript_id "g900.t1"; gene_id "g900"; Scaffold_7 AUGUSTUS CDS 4095862 4096244 0.74 - 0 transcript_id "g900.t1"; gene_id "g900"; Scaffold_7 AUGUSTUS CDS 4096297 4096431 0.4 - 0 transcript_id "g900.t1"; gene_id "g900"; Scaffold_7 AUGUSTUS start_codon 4096429 4096431 . - 0 transcript_id "g900.t1"; gene_id "g900"; # protein sequence = [MLIHDSQSLPKPHEYIDISKKTENLVTASTSYACTSSVEDIARSRIAQLASQHNVSEYSCLKYGPNGYPGKYVPLSVQ # APQTFQELRARQTQWSNAKAWWFSDKATEATSIVLGPSGASGVTSDSLSDGLAQQLSAAIDEQLPQPVNEGKLSRSSSNGAHSHTIKTSSSHPINISA # IIPVEILALLSSHVMFTSNGPFTESPRDFPSLDTQPTVFEVPSPFTLDRFILSFTGHPQTQFSQSHRSSIPPPSTSTEIHPDAHLRTRSHVTEALHAA # LNSGIKSGSITPTEDTHATFHSNGSSVSLSISLKSVPTSQGVSRTMSDTEQTNLEFGTNVDIPSEATSETGPPTNEELQAEAQLPSVDSIPTLPYSTD # TPSFILGNMFMSSCPGKKGMDSFTENKSCLFILCVSVRLKGPVKGRSGVCRDLYADLQRMKDLAVGCVVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g900 ### # start gene g901 Scaffold_7 AUGUSTUS gene 4100231 4100587 0.45 - . g901 Scaffold_7 AUGUSTUS transcript 4100231 4100587 0.45 - . g901.t1 Scaffold_7 AUGUSTUS stop_codon 4100231 4100233 . - 0 transcript_id "g901.t1"; gene_id "g901"; Scaffold_7 AUGUSTUS CDS 4100231 4100587 0.45 - 0 transcript_id "g901.t1"; gene_id "g901"; Scaffold_7 AUGUSTUS start_codon 4100585 4100587 . - 0 transcript_id "g901.t1"; gene_id "g901"; # protein sequence = [MQQRSKKCLSVLLVGRSVVFNLPILESRSQPTSAMVNNLDTVAAVTNMLAFETVSLAPTDNYGFKAISAGAILNSRSK # THPYCDADQDVASNSSEKNLMPLWDNRLFAIEFESLTLWM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g901 ### # start gene g902 Scaffold_7 AUGUSTUS gene 4101768 4102822 0.52 - . g902 Scaffold_7 AUGUSTUS transcript 4101768 4102822 0.52 - . g902.t1 Scaffold_7 AUGUSTUS stop_codon 4101768 4101770 . - 0 transcript_id "g902.t1"; gene_id "g902"; Scaffold_7 AUGUSTUS CDS 4101768 4102298 0.85 - 0 transcript_id "g902.t1"; gene_id "g902"; Scaffold_7 AUGUSTUS CDS 4102814 4102822 0.53 - 0 transcript_id "g902.t1"; gene_id "g902"; Scaffold_7 AUGUSTUS start_codon 4102820 4102822 . - 0 transcript_id "g902.t1"; gene_id "g902"; # protein sequence = [MELRREERRRREFERAHPAGYVPGEDDLLSARDVRSQYDGSDAYSITSSEDDHWGMQIGGYNENSTQYPPPPVGLMPK # DRVMESAKTVDASELEAMLESGFDERDRPPTAPAYTPRFQLSDNGSATQLATGNNGYAPLTRSTSPTNTPTSPSFGASRAGSGGARQHYGPLGPLDPA # TRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g902 ### # start gene g903 Scaffold_7 AUGUSTUS gene 4103638 4104162 0.45 - . g903 Scaffold_7 AUGUSTUS transcript 4103638 4104162 0.45 - . g903.t1 Scaffold_7 AUGUSTUS stop_codon 4103638 4103640 . - 0 transcript_id "g903.t1"; gene_id "g903"; Scaffold_7 AUGUSTUS CDS 4103638 4104162 0.45 - 0 transcript_id "g903.t1"; gene_id "g903"; Scaffold_7 AUGUSTUS start_codon 4104160 4104162 . - 0 transcript_id "g903.t1"; gene_id "g903"; # protein sequence = [MPEGANVSIDNKNGTAPWAAPGGGAKKLNKKDYNKSDRSFGSSTTLTNSTSDSSVAPVMSLASIGAELFAICLVTCYS # EGEDSLRTTLDSISRTTYSDSRKLLFVVADGMITGAGEKKSTPDICVGLLEADPRFGNPIPMMYEAVGSGDKGINRAMVYAGHYSEFQSPSGKCAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g903 ### # start gene g904 Scaffold_7 AUGUSTUS gene 4110142 4110845 0.87 - . g904 Scaffold_7 AUGUSTUS transcript 4110142 4110845 0.87 - . g904.t1 Scaffold_7 AUGUSTUS stop_codon 4110142 4110144 . - 0 transcript_id "g904.t1"; gene_id "g904"; Scaffold_7 AUGUSTUS CDS 4110142 4110485 0.88 - 2 transcript_id "g904.t1"; gene_id "g904"; Scaffold_7 AUGUSTUS CDS 4110563 4110845 0.87 - 0 transcript_id "g904.t1"; gene_id "g904"; Scaffold_7 AUGUSTUS start_codon 4110843 4110845 . - 0 transcript_id "g904.t1"; gene_id "g904"; # protein sequence = [MLCSFLDEIRNIAVNSRLLSNGTLARLKKAPVLLALQRRVSVEETSKKVVDGDEDWETQYDLKRPDQIVIADDSNSLQ # LFGDKLFVAPQEDILEGSKRLSALVQENYEVTNEINNSPQAAKLQAHILERLPLFLHEHTHARTKTSFTWLSSSNNFIVRSFGKISVVKSLKFGSVNL # SKRQAASVVGPKSSRGPLQIWLANDVETDMYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g904 ### # start gene g905 Scaffold_7 AUGUSTUS gene 4112378 4113280 0.78 - . g905 Scaffold_7 AUGUSTUS transcript 4112378 4113280 0.78 - . g905.t1 Scaffold_7 AUGUSTUS stop_codon 4112378 4112380 . - 0 transcript_id "g905.t1"; gene_id "g905"; Scaffold_7 AUGUSTUS CDS 4112378 4113280 0.78 - 0 transcript_id "g905.t1"; gene_id "g905"; Scaffold_7 AUGUSTUS start_codon 4113278 4113280 . - 0 transcript_id "g905.t1"; gene_id "g905"; # protein sequence = [MYLVWNKELLSIGGTVSRAVYELEMDNIKHISDSAGPAKSLELQTWLMDRAVHVLKFFTFHQSTPSADVSSLMEQAFF # ACSTGFRIISTNGIQDVADIRLPDAQFSSFLKDLPVLPEQLLTAARPMVTALQNRKLVKAITFSDVLKELRNRPLTEDESVACLTWWISLNKDGESAA # RLQSIQKQLLDAAVFTTGATGSKEERIIPLNTIQTILNPRNMAGNIPPDAPFPPTMLPPSFSKSFKPDQLTFAFHWTELTLVEWLRFIATSGPSPEYD # LSVSDHWSERVLGILARAWLPSLLVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g905 ### # start gene g906 Scaffold_7 AUGUSTUS gene 4113756 4114151 0.68 - . g906 Scaffold_7 AUGUSTUS transcript 4113756 4114151 0.68 - . g906.t1 Scaffold_7 AUGUSTUS stop_codon 4113756 4113758 . - 0 transcript_id "g906.t1"; gene_id "g906"; Scaffold_7 AUGUSTUS CDS 4113756 4114151 0.68 - 0 transcript_id "g906.t1"; gene_id "g906"; Scaffold_7 AUGUSTUS start_codon 4114149 4114151 . - 0 transcript_id "g906.t1"; gene_id "g906"; # protein sequence = [MRWVYTSGSEKAPAPSAIKPVKPPAPGGFFASLFSGLTSTSTTPHPPVTTVETPKPIDPLKTDTTSVSLTVFSADADI # KVDQKLAAELHRSTKKSVPKKIKYELIYVSQAKLNYTHFHRVEVPTCAIDRDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g906 ### # start gene g907 Scaffold_7 AUGUSTUS gene 4115793 4116506 0.58 - . g907 Scaffold_7 AUGUSTUS transcript 4115793 4116506 0.58 - . g907.t1 Scaffold_7 AUGUSTUS stop_codon 4115793 4115795 . - 0 transcript_id "g907.t1"; gene_id "g907"; Scaffold_7 AUGUSTUS CDS 4115793 4116506 0.58 - 0 transcript_id "g907.t1"; gene_id "g907"; Scaffold_7 AUGUSTUS start_codon 4116504 4116506 . - 0 transcript_id "g907.t1"; gene_id "g907"; # protein sequence = [MSPASSEIRGPVHLLSMSSTATPPTASTSSSPKSSFATAKSLFTPSKRSMGPPLPLYHPFGKLAMSLPPLDPTAFGLP # VPINIDDESTRSSSHSKRSGVKLRDAAVETDPVPPVASVGTVAAIAAREVKEKASPRKKRAGGGGKRKRNSGDDGDATYPAKRTRQPRGVAPSAVDDE # PESLDASANGGLPMDVVSSTPGTPADVIDKPERRTTRSRGAITRRDSTASAVKLLLPLPPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g907 ### # start gene g908 Scaffold_7 AUGUSTUS gene 4124921 4125574 0.51 - . g908 Scaffold_7 AUGUSTUS transcript 4124921 4125574 0.51 - . g908.t1 Scaffold_7 AUGUSTUS stop_codon 4124921 4124923 . - 0 transcript_id "g908.t1"; gene_id "g908"; Scaffold_7 AUGUSTUS CDS 4124921 4125574 0.51 - 0 transcript_id "g908.t1"; gene_id "g908"; Scaffold_7 AUGUSTUS start_codon 4125572 4125574 . - 0 transcript_id "g908.t1"; gene_id "g908"; # protein sequence = [MFVKDSVPTAVEASALAEPERPIVTDVPTVVAARNSLKTLSAPSTTVNGTSPKARDMILALTSVCDGPFGINNWAKTC # PSAATFMSCCKATMSIGKSNGMVNAAVVELLEVAGAYAVSSENWRSSSFRSMDWMIFRTPRLGRLVSTWSAEMASFNHETYKGQVRIKDSKIKDDFHI # GRASAGSVNHQLAIQSMNKIIEDLRNCSKTLRRGLGYQTPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g908 ### # start gene g909 Scaffold_7 AUGUSTUS gene 4126195 4126698 0.91 + . g909 Scaffold_7 AUGUSTUS transcript 4126195 4126698 0.91 + . g909.t1 Scaffold_7 AUGUSTUS start_codon 4126195 4126197 . + 0 transcript_id "g909.t1"; gene_id "g909"; Scaffold_7 AUGUSTUS CDS 4126195 4126698 0.91 + 0 transcript_id "g909.t1"; gene_id "g909"; Scaffold_7 AUGUSTUS stop_codon 4126696 4126698 . + 0 transcript_id "g909.t1"; gene_id "g909"; # protein sequence = [MSKISLSPVTIPALNQSLISSASLTFPTDIVSTGIAEATFSLANPFTASINLLTVDASATYQNITLGTISVGETSNPI # HADGHSNITSPSLPFNFNLNPVSIVELLQAGAQANGVNLGPLIDIFEFIIDNPNFNPPVRKHIESQLFTASHISTSGKLYCRYQFPDLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g909 ### # start gene g910 Scaffold_7 AUGUSTUS gene 4131318 4132461 0.36 - . g910 Scaffold_7 AUGUSTUS transcript 4131318 4132461 0.36 - . g910.t1 Scaffold_7 AUGUSTUS stop_codon 4131318 4131320 . - 0 transcript_id "g910.t1"; gene_id "g910"; Scaffold_7 AUGUSTUS CDS 4131318 4131641 0.7 - 0 transcript_id "g910.t1"; gene_id "g910"; Scaffold_7 AUGUSTUS CDS 4131724 4132461 0.4 - 0 transcript_id "g910.t1"; gene_id "g910"; Scaffold_7 AUGUSTUS start_codon 4132459 4132461 . - 0 transcript_id "g910.t1"; gene_id "g910"; # protein sequence = [MDVDLVDCDGLWEIELPNEEEQTTAIRVFRHGSKTDFRDLKAKSLRYLAIQEGLDYRRSKHSLFSALSQLVIHINIDV # HYIDTFFQRTQRQWPTPPESSGSSNQIPPTIVPVVNEPSFHNYSSPANATTISISQQSSKNKRPVPVSDLSFDSLGKARLAYLQQESKSYLLKNFSTD # VLLLLAEELKLGPILTPKGKTSRDRKQIVNALLQRVRGVSIFSKFAVIQPIAREIQILVRNIKLRSITTRAAQTKDLAEDDMPVSQNKAQILYRTATK # AKINRLRRPDLVAVWKIASHFIAAANRARLAATAKKTAENDWYEDQEYDDSNASLGGSNGLRAPMKRITRSKYLLETKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g910 ### # start gene g911 Scaffold_7 AUGUSTUS gene 4141826 4142564 0.75 + . g911 Scaffold_7 AUGUSTUS transcript 4141826 4142564 0.75 + . g911.t1 Scaffold_7 AUGUSTUS start_codon 4141826 4141828 . + 0 transcript_id "g911.t1"; gene_id "g911"; Scaffold_7 AUGUSTUS CDS 4141826 4141850 0.75 + 0 transcript_id "g911.t1"; gene_id "g911"; Scaffold_7 AUGUSTUS CDS 4141996 4142564 0.98 + 2 transcript_id "g911.t1"; gene_id "g911"; Scaffold_7 AUGUSTUS stop_codon 4142562 4142564 . + 0 transcript_id "g911.t1"; gene_id "g911"; # protein sequence = [MSLRSMVLSWSSIDSSPYAHHGCGSPYGNVTLPSSGPALPVSPVSTPHINNSGSTHLQPAHSGSRIPSTPSATTTLRP # DVPAPPNESVSNPGQMDHLVHPGGRVRSSASTTTHGPLVSAPPPGSVPNPNRMEHLAPQSGYMWTSNSGGPAAKKVKGEDGRARRQSLKPIDDGDEFE # RPAGSSSNKRKAVEKIDPSCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g911 ### # start gene g912 Scaffold_7 AUGUSTUS gene 4146495 4146938 0.23 + . g912 Scaffold_7 AUGUSTUS transcript 4146495 4146938 0.23 + . g912.t1 Scaffold_7 AUGUSTUS start_codon 4146495 4146497 . + 0 transcript_id "g912.t1"; gene_id "g912"; Scaffold_7 AUGUSTUS CDS 4146495 4146938 0.23 + 0 transcript_id "g912.t1"; gene_id "g912"; Scaffold_7 AUGUSTUS stop_codon 4146936 4146938 . + 0 transcript_id "g912.t1"; gene_id "g912"; # protein sequence = [MKRTKTSVDTDISHTTVPNHGSTSYTQRHHSSSSGQHRTPSLVATSATPVPHAGSSEQHRNPSTTGQSSILFSSNHVH # TPFSEITVAPNEAASEQRKHPSSSHGSSHFSTLTGQDRPLPGQITTATHSTPINETLSSQTCAPSTSAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g912 ### # start gene g913 Scaffold_7 AUGUSTUS gene 4165661 4166084 0.36 + . g913 Scaffold_7 AUGUSTUS transcript 4165661 4166084 0.36 + . g913.t1 Scaffold_7 AUGUSTUS start_codon 4165661 4165663 . + 0 transcript_id "g913.t1"; gene_id "g913"; Scaffold_7 AUGUSTUS CDS 4165661 4165792 0.36 + 0 transcript_id "g913.t1"; gene_id "g913"; Scaffold_7 AUGUSTUS CDS 4165851 4166084 0.85 + 0 transcript_id "g913.t1"; gene_id "g913"; Scaffold_7 AUGUSTUS stop_codon 4166082 4166084 . + 0 transcript_id "g913.t1"; gene_id "g913"; # protein sequence = [MDGLKFRNRDEVALGWVEIVNTTPERTDFVNTEFKRGDSDETSLGSSSLIERQEGLIQIAKHLIQDLRQKLKELNIRN # VHLKEENTILRKQLASALEMAQSQAVCEYVDTGMLNNTDTQPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g913 ### # start gene g914 Scaffold_7 AUGUSTUS gene 4166516 4169972 0.25 + . g914 Scaffold_7 AUGUSTUS transcript 4166516 4169972 0.25 + . g914.t1 Scaffold_7 AUGUSTUS start_codon 4166516 4166518 . + 0 transcript_id "g914.t1"; gene_id "g914"; Scaffold_7 AUGUSTUS CDS 4166516 4166777 0.28 + 0 transcript_id "g914.t1"; gene_id "g914"; Scaffold_7 AUGUSTUS CDS 4166875 4169972 0.66 + 2 transcript_id "g914.t1"; gene_id "g914"; Scaffold_7 AUGUSTUS stop_codon 4169970 4169972 . + 0 transcript_id "g914.t1"; gene_id "g914"; # protein sequence = [MKALEVPHIIGRKRRDLHPHTADDGSEIAQEKEYSIAKRFKDMSGVPVLDFSLILILTHPDPHSRKDLPSTSARVRLL # PRRFRNPGHASSDVPVHEHGPAFDNKEADFGVALQARSGSNTNTLFEESFDQVRHDPESRPLDTQPLIRLDDMQPFPNSGFDRIGGILPHAQSLDNVF # DQVRGYSESNSLPLPLAHDEIQFFRNHHAQSSDDVSQQGIEIAQNKSQESGRDGEYFTQPVASPSDCVIPHTFDQVQGNPELESSPIAASGVYNGTRI # SSGFGFGNDDDDEISLDGVSQNESDVDVWNEGEGVTDSPHCDQESYIQTFPDQATPIFDQTQAGYPELESLFPPVSSSFTTFDQTQAGHPELEFLPTD # LSSARNEMYMPRSDSTGEIHTQSIDHASQTSPDVGVRTGSEDEVFQLHRHIQPDSLPSDHFAPNTYEDDIDIESPSPPTIPFGAETPTSSSSQPHNDS # DFYPLAQPSEHASHSACSDLSCQIEVEDSRGNQGLGRNQNEFQLSYSNASLSIEPGTDFVNNYDLEHLSSSNGANLYCRSPSRSLGGVSISRDLDVKV # DGTYSRATLQKADVKIPDIPKGSYTAASTICYSNGAEPSYIQSDTIPDIATGSYAAASTVFHSNGAEPSHIQPETQAASDHDFQNACHNLVLAEPPYI # QTKPQAASDHEFQNVCHNSFLGPDSSYIYSDFRSLHLSFQPTDTSFPADPVTDTCEAMSDLRSLRYDDAEKSSLVRRLEMIESGMSTVHQLHDSGTFH # EMSNPHGDGIFSPEHSQYQPKDGAALDLQDEYGIYAPGPHHFAAIPSHPKKYNGSDNGDESFSRDCVPFYCIQPEGEHTSDDDIVCFDAQGSLDYIQL # LDANSSRADAEINECFQEQLDVSIGSLDASLPSISLDGPSSEADQERINTLSSLPNCEGLLIASHSGIRSYTPSPLDTPVAFGISFSPEEHMDVQLNL # DDTEFDADDEGVKEDVGDSEMKYEHAHFDLDVSMADSGNGTQTFAYDNSFTDIPPAPTHTRAHVHDDPRRRTTRTTPDNTVEVPLASIQGNTLTPGPQ # GTRGDIGYQQGIPPLSPLTEIPDTPMVADTAEDERCLRTELESLVNNNVKSVSMVRLLVII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g914 ### # start gene g915 Scaffold_7 AUGUSTUS gene 4172285 4173274 0.36 + . g915 Scaffold_7 AUGUSTUS transcript 4172285 4173274 0.36 + . g915.t1 Scaffold_7 AUGUSTUS start_codon 4172285 4172287 . + 0 transcript_id "g915.t1"; gene_id "g915"; Scaffold_7 AUGUSTUS CDS 4172285 4172642 0.41 + 0 transcript_id "g915.t1"; gene_id "g915"; Scaffold_7 AUGUSTUS CDS 4172789 4172928 0.6 + 2 transcript_id "g915.t1"; gene_id "g915"; Scaffold_7 AUGUSTUS CDS 4173005 4173274 0.9 + 0 transcript_id "g915.t1"; gene_id "g915"; Scaffold_7 AUGUSTUS stop_codon 4173272 4173274 . + 0 transcript_id "g915.t1"; gene_id "g915"; # protein sequence = [MVIKSSDNFLSFAELGLDLGTVTFDSFYDNVLVGRELLSRLLVVWALISLSALVGEDLVLSADATTTTHLSGRIIPQS # GSDLNTIGQLFSDYLAGDNLTLVAKGVSVQPPGSSSTVSWLTVTLNDDSEAYDPSTGSNFTSASYKNPFGFSLQVVQSATDIILSSNGLSLPTSDTVG # GVSTGNVANLPIAWENEPLKSLNDDAFNALFAAVTLSNSISLGLDGSANVTAKTPSGDVPISRIPFNVTSSLSGKIISE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g915 ### # start gene g916 Scaffold_7 AUGUSTUS gene 4173527 4174730 0.38 + . g916 Scaffold_7 AUGUSTUS transcript 4173527 4174730 0.38 + . g916.t1 Scaffold_7 AUGUSTUS start_codon 4173527 4173529 . + 0 transcript_id "g916.t1"; gene_id "g916"; Scaffold_7 AUGUSTUS CDS 4173527 4173529 0.78 + 0 transcript_id "g916.t1"; gene_id "g916"; Scaffold_7 AUGUSTUS CDS 4173604 4173687 0.8 + 0 transcript_id "g916.t1"; gene_id "g916"; Scaffold_7 AUGUSTUS CDS 4173747 4173861 0.47 + 0 transcript_id "g916.t1"; gene_id "g916"; Scaffold_7 AUGUSTUS CDS 4174201 4174730 0.47 + 2 transcript_id "g916.t1"; gene_id "g916"; Scaffold_7 AUGUSTUS stop_codon 4174728 4174730 . + 0 transcript_id "g916.t1"; gene_id "g916"; # protein sequence = [MNLNLVPGTNSVPSEFHYEPANSNDSVAQSFIADFLTSNNSLPLSIKGDSASTPIDSLQEALSGLSLINSGEINNVLL # TQGAIASLGIIGENLDVAAANTIQVGVGGYTLPWLKINQLDVPTTYTLDIAGLTLGQLKSQAEQNASSISSSAVGSKPTSASTSQNGSTSVSATVSLS # SLASSTITSSTTGDGTTAEATSSASSAGKEDSSTATSATANTPLMPASSASSDAAPTSATLVATLLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g916 ### # start gene g917 Scaffold_7 AUGUSTUS gene 4177012 4177566 0.86 + . g917 Scaffold_7 AUGUSTUS transcript 4177012 4177566 0.86 + . g917.t1 Scaffold_7 AUGUSTUS start_codon 4177012 4177014 . + 0 transcript_id "g917.t1"; gene_id "g917"; Scaffold_7 AUGUSTUS CDS 4177012 4177566 0.86 + 0 transcript_id "g917.t1"; gene_id "g917"; Scaffold_7 AUGUSTUS stop_codon 4177564 4177566 . + 0 transcript_id "g917.t1"; gene_id "g917"; # protein sequence = [MGLDFSPALLPGERPSWCSVSLQPVSPPNAFVLPEPTSVYLRDSNGKRVKRTATWKWEEPEWRVLVRKEDGVVSRVEK # PVPAPKEENSSLIMKAAGKMKDVNSLQSPVNGEGDRPSSEKDEDESEDEDIPTDVDGWVYGDNKWEARSSKGGMGKVCINCAFSSMTNIHLSVHKIST # LDKGRCGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g917 ### # start gene g918 Scaffold_7 AUGUSTUS gene 4186129 4187408 0.93 + . g918 Scaffold_7 AUGUSTUS transcript 4186129 4187408 0.93 + . g918.t1 Scaffold_7 AUGUSTUS start_codon 4186129 4186131 . + 0 transcript_id "g918.t1"; gene_id "g918"; Scaffold_7 AUGUSTUS CDS 4186129 4186253 0.94 + 0 transcript_id "g918.t1"; gene_id "g918"; Scaffold_7 AUGUSTUS CDS 4186307 4187408 0.99 + 1 transcript_id "g918.t1"; gene_id "g918"; Scaffold_7 AUGUSTUS stop_codon 4187406 4187408 . + 0 transcript_id "g918.t1"; gene_id "g918"; # protein sequence = [MKRRVAGLPPVSAAVFNEKVTERRTETAIMSSLKGSVCEVCNKTYSTENAYRSHINSKKHKETELQASVKLAYKLAKK # DGLEEEYEAEVKTFNKNPSKLESQETPVPLDVNDSAEDEQNQTIDQKIAAARSRLSPAHCLFCSSEFSDLQANLLHMASAHSFFVPDADYLVDAEGLI # GYLGEKIAVGNVCLFCNEKSREFRTLDAVRKHMVDKSHCKVAYDTQDDRLEISDYYDFTSSYPDAHLRKKKANVGEDEEEWEDSDGSDYDEIIEVDED # KEESDEEDLPGVQVTYGDSQYELVLPSGARIGHRGMRRYYAQSFPGTPRGEVDPNSGAAIVRRLLGDKKSLLVPRKGGFGAFGAGTDVVKARNRGEAR # EAGRHIREFRDQARRENFKTKVGFRHKCPKALQRST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g918 ### # start gene g919 Scaffold_7 AUGUSTUS gene 4187727 4188561 0.21 - . g919 Scaffold_7 AUGUSTUS transcript 4187727 4188561 0.21 - . g919.t1 Scaffold_7 AUGUSTUS stop_codon 4187727 4187729 . - 0 transcript_id "g919.t1"; gene_id "g919"; Scaffold_7 AUGUSTUS CDS 4187727 4188280 0.74 - 2 transcript_id "g919.t1"; gene_id "g919"; Scaffold_7 AUGUSTUS CDS 4188336 4188561 0.22 - 0 transcript_id "g919.t1"; gene_id "g919"; Scaffold_7 AUGUSTUS start_codon 4188559 4188561 . - 0 transcript_id "g919.t1"; gene_id "g919"; # protein sequence = [MVPLQDTHTGNSIIESDRMLMISGVLDDSSFGNASTALFDGASFIPYFVSSTVSGTAGSVSSLFHSFSTFSFTQQHFL # ATGVVILISIAISAGAVFLLALIGILWTLFARRDRDDKKQFDAADDDDDDSIHHRPSSLLEHINAATRGTIIGASPFAPHSSEKEEEKLEGDGMEPEY # THDGDNYVRAETPSAYGGAMGTEEASRPAHARYSFDGAGEGELALTAGAEVEILDDRDHAYVIECLRSAWLIFCSPDGGMLEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g919 ### # start gene g920 Scaffold_7 AUGUSTUS gene 4188999 4190602 0.95 - . g920 Scaffold_7 AUGUSTUS transcript 4188999 4190602 0.95 - . g920.t1 Scaffold_7 AUGUSTUS stop_codon 4188999 4189001 . - 0 transcript_id "g920.t1"; gene_id "g920"; Scaffold_7 AUGUSTUS CDS 4188999 4190203 0.98 - 2 transcript_id "g920.t1"; gene_id "g920"; Scaffold_7 AUGUSTUS CDS 4190290 4190602 0.95 - 0 transcript_id "g920.t1"; gene_id "g920"; Scaffold_7 AUGUSTUS start_codon 4190600 4190602 . - 0 transcript_id "g920.t1"; gene_id "g920"; # protein sequence = [MTLAANPTGSGSNGQYEIVADRIELVLTSANATSSNSSGSASSDSSGSNQGFGFFEWPLSSTSSVDATSTLANSTETS # ADQAAIGLFNGIGGNGTISSENAAIANGSISALPENGLDGSVTALALDGDNLFVGGSFMDTSSASTNGLKGVALYNVQSQKWSALGAGVNGKVSSLAV # SGSQLFVAGNFTQLFTSSSDTAGYDAPGFAVWNISNSVWVNSGGFVVGSMTFVANETSPQYIAGNVVVSESFGASGMVMVQNSASDVPSISPLGVQLD # GSIASASTTSTRRRSIVSRTSWIAHVRLSHLFFKRQTSSSTLVALPDALPAVAPAVLAGSFWTNSTSNDEVAIIGGNFSFLPSGSSFGSTEAANLGIY # DQSLATITALQGNQVNGTVRSLLVNGDTLYVGGQFTISGLNVDGFAIYDLAKQQWDVSGVQALQPSSGSSVVVRSITTSTSKSNTIIVAGTFAQAGSL # TCQAICSLDTSSNQWNSLGSGINGEVSSVSYAGVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g920 ### # start gene g921 Scaffold_7 AUGUSTUS gene 4191633 4191956 0.98 + . g921 Scaffold_7 AUGUSTUS transcript 4191633 4191956 0.98 + . g921.t1 Scaffold_7 AUGUSTUS start_codon 4191633 4191635 . + 0 transcript_id "g921.t1"; gene_id "g921"; Scaffold_7 AUGUSTUS CDS 4191633 4191956 0.98 + 0 transcript_id "g921.t1"; gene_id "g921"; Scaffold_7 AUGUSTUS stop_codon 4191954 4191956 . + 0 transcript_id "g921.t1"; gene_id "g921"; # protein sequence = [MNEPAKKRLESEELDVIERTRPSAPVKPLKGGLDQEFAEVSHTATAAPGEVNKPPTQTFLFFASQKMASISPFGPLDP # KDENLPEDDVYEAILEAEVEPMDENEPAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g921 ### # start gene g922 Scaffold_7 AUGUSTUS gene 4196556 4197206 0.69 - . g922 Scaffold_7 AUGUSTUS transcript 4196556 4197206 0.69 - . g922.t1 Scaffold_7 AUGUSTUS stop_codon 4196556 4196558 . - 0 transcript_id "g922.t1"; gene_id "g922"; Scaffold_7 AUGUSTUS CDS 4196556 4197206 0.69 - 0 transcript_id "g922.t1"; gene_id "g922"; Scaffold_7 AUGUSTUS start_codon 4197204 4197206 . - 0 transcript_id "g922.t1"; gene_id "g922"; # protein sequence = [MQKRKAARESISKPSQTAPDGGWRASSLWQKPSHRQRDLGKHTALGSEDSIEHLPLENLVNTPGPSPSPSPLPSPLPP # NLEEYPENPFANPPASPFEDSQQVTAVMSSSEPPSDISTLAVVAPTPERPTLLAKSASFSRPPPPKPINIPPPKTPPPPVNVPPLAVSPLSLEGAPPH # HHQEPEKETRWWHEWLCGCGEDRDADNQVSFMWTIFSSNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g922 ### # start gene g923 Scaffold_7 AUGUSTUS gene 4197276 4197656 0.61 - . g923 Scaffold_7 AUGUSTUS transcript 4197276 4197656 0.61 - . g923.t1 Scaffold_7 AUGUSTUS stop_codon 4197276 4197278 . - 0 transcript_id "g923.t1"; gene_id "g923"; Scaffold_7 AUGUSTUS CDS 4197276 4197656 0.61 - 0 transcript_id "g923.t1"; gene_id "g923"; Scaffold_7 AUGUSTUS start_codon 4197654 4197656 . - 0 transcript_id "g923.t1"; gene_id "g923"; # protein sequence = [MQLHPRNLTTQFYLTPPPGTTRDSTTKRRPTMTSISSMETITADTHPHLLSSPSDDEDLGRRRIWENGDEDHTPRVSS # KGKQKENGFTDTDRDGSEETVLEPPDSGLYPPTTDEEAETRRIEEVSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g923 ### # start gene g924 Scaffold_7 AUGUSTUS gene 4202679 4203440 0.39 + . g924 Scaffold_7 AUGUSTUS transcript 4202679 4203440 0.39 + . g924.t1 Scaffold_7 AUGUSTUS start_codon 4202679 4202681 . + 0 transcript_id "g924.t1"; gene_id "g924"; Scaffold_7 AUGUSTUS CDS 4202679 4203223 0.6 + 0 transcript_id "g924.t1"; gene_id "g924"; Scaffold_7 AUGUSTUS CDS 4203425 4203440 0.42 + 1 transcript_id "g924.t1"; gene_id "g924"; Scaffold_7 AUGUSTUS stop_codon 4203438 4203440 . + 0 transcript_id "g924.t1"; gene_id "g924"; # protein sequence = [MLLVSAARSVPFARIAGRRSVSAIASKYSNAVYNAALAKSPQTLTQVHTELSSFTATLKQNKDVEAFVHNPTLSAKDR # ATGLASVFKTLEGAGSKKESVSDITKNLLTVLSENGRLAEVEGVVDGFNELVSQYNGELNVTVTSAAPLPKDILSRLESTLKQSQTAQKAKTLKVTNK # VCSSALVRLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g924 ### # start gene g925 Scaffold_7 AUGUSTUS gene 4206086 4206631 0.6 + . g925 Scaffold_7 AUGUSTUS transcript 4206086 4206631 0.6 + . g925.t1 Scaffold_7 AUGUSTUS start_codon 4206086 4206088 . + 0 transcript_id "g925.t1"; gene_id "g925"; Scaffold_7 AUGUSTUS CDS 4206086 4206631 0.6 + 0 transcript_id "g925.t1"; gene_id "g925"; Scaffold_7 AUGUSTUS stop_codon 4206629 4206631 . + 0 transcript_id "g925.t1"; gene_id "g925"; # protein sequence = [MNHSGAPPSSSPLLLPDTLTAMEVEYSSISPSIQPDSVEEPTSPSLAVPEIRMKGSSWYEPEPDREFSKSLTIPQTTK # PRFSGIVVTDLDSSDDEYENDSDPVRPLVSPTLLERIRQRELSNVLPLPSSLDQHALVLYRPLTRPSNNLEPEDTELVSNQDAVPNAVSLSSTAQDVE # MMDVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g925 ### # start gene g926 Scaffold_7 AUGUSTUS gene 4207490 4207981 0.83 - . g926 Scaffold_7 AUGUSTUS transcript 4207490 4207981 0.83 - . g926.t1 Scaffold_7 AUGUSTUS stop_codon 4207490 4207492 . - 0 transcript_id "g926.t1"; gene_id "g926"; Scaffold_7 AUGUSTUS CDS 4207490 4207981 0.83 - 0 transcript_id "g926.t1"; gene_id "g926"; Scaffold_7 AUGUSTUS start_codon 4207979 4207981 . - 0 transcript_id "g926.t1"; gene_id "g926"; # protein sequence = [MRRPRGPGGRFLTAEEIAAQRSGQEGEAGPTLNTNAHDNDEDMAEDDHSPPTEPILQRSTSELQSQHIHSHEESPPDP # ISILNLSHSSTPIHHMQHNINVSLPSSVPIAVSPQAMYIQQQQQPQHPQVRNGHQHSLPQPNVDGMTSSAPVTLTSPYPYRMVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g926 ### # start gene g927 Scaffold_7 AUGUSTUS gene 4208449 4209857 0.31 + . g927 Scaffold_7 AUGUSTUS transcript 4208449 4209857 0.31 + . g927.t1 Scaffold_7 AUGUSTUS start_codon 4208449 4208451 . + 0 transcript_id "g927.t1"; gene_id "g927"; Scaffold_7 AUGUSTUS CDS 4208449 4208644 0.48 + 0 transcript_id "g927.t1"; gene_id "g927"; Scaffold_7 AUGUSTUS CDS 4208731 4208858 1 + 2 transcript_id "g927.t1"; gene_id "g927"; Scaffold_7 AUGUSTUS CDS 4208914 4209120 0.82 + 0 transcript_id "g927.t1"; gene_id "g927"; Scaffold_7 AUGUSTUS CDS 4209182 4209369 0.73 + 0 transcript_id "g927.t1"; gene_id "g927"; Scaffold_7 AUGUSTUS CDS 4209458 4209857 0.72 + 1 transcript_id "g927.t1"; gene_id "g927"; Scaffold_7 AUGUSTUS stop_codon 4209855 4209857 . + 0 transcript_id "g927.t1"; gene_id "g927"; # protein sequence = [MEAKLKSLKVVDLKQILTRASAVPAGKANKADLIAKIIATPAAVDAFNALHPSKPAPHSHDDLVRSHSPDFPLEISLD # WTVDEVPPSKSDEAASEPTTETPAPLAAELTTAPISAQDIAPEPQVANTAESTSYPADAELEKRKQRAARFGIPLVETQPRQRLATAIKTNVTATQPS # DDAEKIKARAERFGLKIAANGKTGPSKDNQTSPGSKRKRGAVAPPPEVEVDLEELERRRKRAERFPVRTFIIMGCCINSTTYVVTRYAFVIVECVSAT # VEVGIFTRKLLSFSTLMNGSEKEEQPLLARSAGRAKSKYVLIIHGGAGTMSRKKSTDAQLKAYHDALCVALKAGHEVLKSEGEAMDAAVAAVVALEGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g927 ### # start gene g928 Scaffold_7 AUGUSTUS gene 4210494 4210937 0.28 + . g928 Scaffold_7 AUGUSTUS transcript 4210494 4210937 0.28 + . g928.t1 Scaffold_7 AUGUSTUS start_codon 4210494 4210496 . + 0 transcript_id "g928.t1"; gene_id "g928"; Scaffold_7 AUGUSTUS CDS 4210494 4210629 0.35 + 0 transcript_id "g928.t1"; gene_id "g928"; Scaffold_7 AUGUSTUS CDS 4210705 4210937 0.65 + 2 transcript_id "g928.t1"; gene_id "g928"; Scaffold_7 AUGUSTUS stop_codon 4210935 4210937 . + 0 transcript_id "g928.t1"; gene_id "g928"; # protein sequence = [MSAGYWAEEWEIKSGWLKKAWNTFTGKENPSKMAVGISGTGDGDVPTASTIARRVQLLGEPIATAAQVAVETLRRDGG # IGGVIVLDIEGNVATPLNCEGMYRGLIREDGVAKTAIFEDEVLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g928 ### # start gene g929 Scaffold_7 AUGUSTUS gene 4210981 4211897 0.68 - . g929 Scaffold_7 AUGUSTUS transcript 4210981 4211897 0.68 - . g929.t1 Scaffold_7 AUGUSTUS stop_codon 4210981 4210983 . - 0 transcript_id "g929.t1"; gene_id "g929"; Scaffold_7 AUGUSTUS CDS 4210981 4211448 0.88 - 0 transcript_id "g929.t1"; gene_id "g929"; Scaffold_7 AUGUSTUS CDS 4211496 4211897 0.68 - 0 transcript_id "g929.t1"; gene_id "g929"; Scaffold_7 AUGUSTUS start_codon 4211895 4211897 . - 0 transcript_id "g929.t1"; gene_id "g929"; # protein sequence = [MDPVEEKFWSTPGASDKPLQFIDNSSLLDEEAEFGNLSMGSSISSPLPSRRVPKTRMPSFSPDALSPDVPKTPPEIES # KQEESEAVKETPSSPFSEIVSDEPDTFVPDPESSKVLDTPHREKKIRINMDIERAVAKIWSTVGELIMPGNTFNRTKNLPPVANATMCVWITLNHHAF # ADTYPTSSHLQTLSNMTPTVASPTHSVSTVSNSSNTPPTAQQILTAHLLIALLSSETLSLPLNKVKELLAAKASTSGSAAMVSGHPKALYGCVAKRLL # KIERGAAGQVVRFDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g929 ### # start gene g930 Scaffold_7 AUGUSTUS gene 4212356 4212721 0.95 - . g930 Scaffold_7 AUGUSTUS transcript 4212356 4212721 0.95 - . g930.t1 Scaffold_7 AUGUSTUS stop_codon 4212356 4212358 . - 0 transcript_id "g930.t1"; gene_id "g930"; Scaffold_7 AUGUSTUS CDS 4212356 4212721 0.95 - 0 transcript_id "g930.t1"; gene_id "g930"; Scaffold_7 AUGUSTUS start_codon 4212719 4212721 . - 0 transcript_id "g930.t1"; gene_id "g930"; # protein sequence = [MSALSDHIDRLAQSTRSIKSISASCGSSATGLFTRAILSAELGDLIRDVDSSELGLFTITTPSTVVAHDKETRNQSGV # EITRVEFHGATPLRRPTGRRDELKSKEIPPDVYAEAALKYMER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g930 ### # start gene g931 Scaffold_7 AUGUSTUS gene 4212891 4214663 0.99 + . g931 Scaffold_7 AUGUSTUS transcript 4212891 4214663 0.99 + . g931.t1 Scaffold_7 AUGUSTUS start_codon 4212891 4212893 . + 0 transcript_id "g931.t1"; gene_id "g931"; Scaffold_7 AUGUSTUS CDS 4212891 4214663 0.99 + 0 transcript_id "g931.t1"; gene_id "g931"; Scaffold_7 AUGUSTUS stop_codon 4214661 4214663 . + 0 transcript_id "g931.t1"; gene_id "g931"; # protein sequence = [MWEPLPLIAYGYAVHPLIPSTRRDTRYSTRSHHTIGSADAGDEQIHRDVVSLEVGDEIYAFEKYTPKGKETEGIWYRG # YAEFAFDFYSIVLIISLTLYHSYVVCTARRPPVTWALSGEASSSKSIPKIEEPQQVFIGIFPASHVYVRDELSDAEGTLQNLAKSLDGGSQINGFSNS # TTDSYSQWSRSNFMSVLREEDEDLDAASIMTGVRLPRMDQKTLSHAGAPVYSSSRSARSLRSSSPTESQMMKPLPPRPSLKSGDDTASGVAQPIIDEI # ASALREWHIFLFQYLARRDYRLFQIVREHIEALHLGRRQLLAQTLSTEETINMRQDCVVRLVKGNLVQGLDVIVRHPTWGGLVTVDIQGEIDSRTWVS # AVRMYSMQVALAYLNVDEPPLVLPNPGPLPTPAHSVFPELAHKSRMRSLTKLGPPSSLKASTAKFYHVFLDLRAFVASFCSPGETAELLFSLYRLGSQ # AQFTQFITEDFCAVLNHNGVLARNPTARIRTLFTDLSLSDLQEPIYLVCRVIRNGALKIGATFSSECHQKAEEEDRKHGLTPIRRVIGLMLMDLFPRA # VLGCTRLVILNFADLLVVLFSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g931 ### # start gene g932 Scaffold_7 AUGUSTUS gene 4215611 4216243 0.99 + . g932 Scaffold_7 AUGUSTUS transcript 4215611 4216243 0.99 + . g932.t1 Scaffold_7 AUGUSTUS start_codon 4215611 4215613 . + 0 transcript_id "g932.t1"; gene_id "g932"; Scaffold_7 AUGUSTUS CDS 4215611 4216243 0.99 + 0 transcript_id "g932.t1"; gene_id "g932"; Scaffold_7 AUGUSTUS stop_codon 4216241 4216243 . + 0 transcript_id "g932.t1"; gene_id "g932"; # protein sequence = [MLDQVHSNPVLLSLLNWEKLSDKKLLSQVLAAFTFVGEVEIVKFLRDIFDSLFGILVSPDNQVGDMEHLVFNAIVIVL # GIVQDRRFSNFRPVVELYIEKHFGWAAASSHIIHSMNRLLSNPATTENATQLRNALKVWHYIIKFIARSRELQKSKELGMGSDATAEHLESAFKRELR # APFIRSYPYDVDYNSTVDDRHSNHCSSKLHFSPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g932 ### # start gene g933 Scaffold_7 AUGUSTUS gene 4216747 4217927 0.7 + . g933 Scaffold_7 AUGUSTUS transcript 4216747 4217927 0.7 + . g933.t1 Scaffold_7 AUGUSTUS start_codon 4216747 4216749 . + 0 transcript_id "g933.t1"; gene_id "g933"; Scaffold_7 AUGUSTUS CDS 4216747 4217286 0.94 + 0 transcript_id "g933.t1"; gene_id "g933"; Scaffold_7 AUGUSTUS CDS 4217526 4217927 1 + 0 transcript_id "g933.t1"; gene_id "g933"; Scaffold_7 AUGUSTUS stop_codon 4217925 4217927 . + 0 transcript_id "g933.t1"; gene_id "g933"; # protein sequence = [MAPESVRALERTPSTKSIVPVVFPESYPFSLLIYLPQPPSNSKRITSEAHSFNPGLAEAAVVLLVLILSSPPKAISEF # LESSLDIEGRDRFVALLSHFFTVSISILENECFPKTWLNINILAHQVLVKMMNPISTLLNHEFIPPQEAEATFDPSLWKEAFTMLLKLLSSEQLCIEE # FSPQGYQVYLNTLVGSVVSLCLSHHEQLRNNAVQMLYSMIVSEYHTSGNFEEIENELVTRLDFLFMSESSKDDISGAFFVGQLRHLFESTEGDEQLRD # RVSSFLDSVDLFLELLLSVRALPEGDEFADERVIATVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g933 ### # start gene g934 Scaffold_7 AUGUSTUS gene 4218869 4219381 0.87 + . g934 Scaffold_7 AUGUSTUS transcript 4218869 4219381 0.87 + . g934.t1 Scaffold_7 AUGUSTUS start_codon 4218869 4218871 . + 0 transcript_id "g934.t1"; gene_id "g934"; Scaffold_7 AUGUSTUS CDS 4218869 4219381 0.87 + 0 transcript_id "g934.t1"; gene_id "g934"; Scaffold_7 AUGUSTUS stop_codon 4219379 4219381 . + 0 transcript_id "g934.t1"; gene_id "g934"; # protein sequence = [MLTSISDINLFSYSRPVKRIARDGTEEFWIEKVYFTTEESFPTVLRRSQVIDLTVVDISPVENALSEVEMKTKELSAL # KLRYENVAKTTQEVSTNALSMALNSAVDTPLNTGISAYRHMFFNPARNPDQAELVEKLRGAIDEQVGLCGSAILTICELTKNGFRSRLLTAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g934 ### # start gene g935 Scaffold_7 AUGUSTUS gene 4224056 4224454 0.92 - . g935 Scaffold_7 AUGUSTUS transcript 4224056 4224454 0.92 - . g935.t1 Scaffold_7 AUGUSTUS stop_codon 4224056 4224058 . - 0 transcript_id "g935.t1"; gene_id "g935"; Scaffold_7 AUGUSTUS CDS 4224056 4224454 0.92 - 0 transcript_id "g935.t1"; gene_id "g935"; Scaffold_7 AUGUSTUS start_codon 4224452 4224454 . - 0 transcript_id "g935.t1"; gene_id "g935"; # protein sequence = [MTDLDRVSNAHTHKRHPSQPNTDPSANAKITNDILPILHRLNPALPQIPHILTRLRTLSTLHTSAGEFGKDLESLEDE # QAQIKESLEELESAVETVEKSLEENRKIVGGNVEGLERRVDDLSRRLDELERIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g935 ### # start gene g936 Scaffold_7 AUGUSTUS gene 4230474 4230830 0.4 + . g936 Scaffold_7 AUGUSTUS transcript 4230474 4230830 0.4 + . g936.t1 Scaffold_7 AUGUSTUS start_codon 4230474 4230476 . + 0 transcript_id "g936.t1"; gene_id "g936"; Scaffold_7 AUGUSTUS CDS 4230474 4230830 0.4 + 0 transcript_id "g936.t1"; gene_id "g936"; Scaffold_7 AUGUSTUS stop_codon 4230828 4230830 . + 0 transcript_id "g936.t1"; gene_id "g936"; # protein sequence = [MDYGRGSKSVRPRSFPTHERTLTAWSDNFDDYWRVASKVTPTTAPTRAQSPAPPSSSASMVNRPPSADPGGPSERDGA # YNVRSIPVRLYLPDGPVIQDLVPPMVDDSKFVTSSSRCAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g936 ### # start gene g937 Scaffold_7 AUGUSTUS gene 4237474 4238367 0.5 - . g937 Scaffold_7 AUGUSTUS transcript 4237474 4238367 0.5 - . g937.t1 Scaffold_7 AUGUSTUS stop_codon 4237474 4237476 . - 0 transcript_id "g937.t1"; gene_id "g937"; Scaffold_7 AUGUSTUS CDS 4237474 4238367 0.5 - 0 transcript_id "g937.t1"; gene_id "g937"; Scaffold_7 AUGUSTUS start_codon 4238365 4238367 . - 0 transcript_id "g937.t1"; gene_id "g937"; # protein sequence = [MLLPIVVPNLFRRFSGLSVKRSPWNFTIPLDHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNA # STGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGP # FKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDVFSWVA # ADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g937 ### # start gene g938 Scaffold_7 AUGUSTUS gene 4240075 4243021 0.09 - . g938 Scaffold_7 AUGUSTUS transcript 4240075 4243021 0.09 - . g938.t1 Scaffold_7 AUGUSTUS stop_codon 4240075 4240077 . - 0 transcript_id "g938.t1"; gene_id "g938"; Scaffold_7 AUGUSTUS CDS 4240075 4240555 0.83 - 1 transcript_id "g938.t1"; gene_id "g938"; Scaffold_7 AUGUSTUS CDS 4241337 4241675 0.89 - 1 transcript_id "g938.t1"; gene_id "g938"; Scaffold_7 AUGUSTUS CDS 4242337 4242687 0.17 - 1 transcript_id "g938.t1"; gene_id "g938"; Scaffold_7 AUGUSTUS CDS 4242729 4243021 0.8 - 0 transcript_id "g938.t1"; gene_id "g938"; Scaffold_7 AUGUSTUS start_codon 4243019 4243021 . - 0 transcript_id "g938.t1"; gene_id "g938"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPG # GPGGPGGPRLPYLLTSPTSNVLCWNSSRGSRVPLRPLVPLGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRM # KNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDRKTNPQLLACKDAGMEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEY # AEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKK # DRYPLPLIRSSRRSEKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g938 ### # start gene g939 Scaffold_7 AUGUSTUS gene 4252128 4253245 0.67 + . g939 Scaffold_7 AUGUSTUS transcript 4252128 4253245 0.67 + . g939.t1 Scaffold_7 AUGUSTUS start_codon 4252128 4252130 . + 0 transcript_id "g939.t1"; gene_id "g939"; Scaffold_7 AUGUSTUS CDS 4252128 4252643 0.74 + 0 transcript_id "g939.t1"; gene_id "g939"; Scaffold_7 AUGUSTUS CDS 4252748 4253245 0.91 + 0 transcript_id "g939.t1"; gene_id "g939"; Scaffold_7 AUGUSTUS stop_codon 4253243 4253245 . + 0 transcript_id "g939.t1"; gene_id "g939"; # protein sequence = [MPCSSAWAWSGPFAWQHKYPRSESPSPLVAMGSSPSKPVKPSSVLQQQHAENEKHAPAEIATAFSALSVSTPTSVDGS # VSLQNVSSWESDISHDPKARLARTVLSHSDIRDALVSRKATVATTHIFNNEIDFKTGPITNQKSSGRCWLFATTNVLRYEVMKKLKLKDFQLSQLMIE # NADLSVDDRVISHLSGDLISDGGQWDMAVNLLETYGVVPQSVYPESFHSSLSSPLNALLKTKLREDALILRKLVVDMKAAGASAQATISATRAEKEKL # MKEIYTIMTAALGVPPLPDATFTWEYYDENDKAGTWSGTPLEYYKTFAAKPYSVSALTRDLNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g939 ### # start gene g940 Scaffold_7 AUGUSTUS gene 4253435 4253818 0.94 + . g940 Scaffold_7 AUGUSTUS transcript 4253435 4253818 0.94 + . g940.t1 Scaffold_7 AUGUSTUS start_codon 4253435 4253437 . + 0 transcript_id "g940.t1"; gene_id "g940"; Scaffold_7 AUGUSTUS CDS 4253435 4253818 0.94 + 0 transcript_id "g940.t1"; gene_id "g940"; Scaffold_7 AUGUSTUS stop_codon 4253816 4253818 . + 0 transcript_id "g940.t1"; gene_id "g940"; # protein sequence = [MKATVIKVCTSVPSINALTDHIHNCTQMVKAGVPVFFGCDVGKSSERNLGLMDTTLFQYEDTFDITLGLTKAQRLEIG # ESAMTHAMVISGVHLDANGKPVRYKVENSWGEVPGNKGYFVMTDEWFNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g940 ### # start gene g941 Scaffold_7 AUGUSTUS gene 4255101 4255946 1 + . g941 Scaffold_7 AUGUSTUS transcript 4255101 4255946 1 + . g941.t1 Scaffold_7 AUGUSTUS start_codon 4255101 4255103 . + 0 transcript_id "g941.t1"; gene_id "g941"; Scaffold_7 AUGUSTUS CDS 4255101 4255946 1 + 0 transcript_id "g941.t1"; gene_id "g941"; Scaffold_7 AUGUSTUS stop_codon 4255944 4255946 . + 0 transcript_id "g941.t1"; gene_id "g941"; # protein sequence = [MPVFSESLGCLDASYLYNGGETTISIPVGDRYDHAVDVHGDGVGTFTVTEAPADITEVQYKLTIQTNDQSLLDQVTLQ # YPAAKSDGTSDGNSRLLIGTPRLNQDSSSCIRYDVTMYIPKTLKKLHILPHTVAQVRFDPQAHIDLEDTFVTLYKMDRLNIIEPHENLRSTSLALEVY # RGWIVGHAAIVNETAITTQRGDGVMNVHIHPTAPADPTNPEPVSLRTTTGAGRTDLFYDNDKAYPHRPIRSVHLSSRNADVYLTYKNAEFDGNVKLDS # SSFTTGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g941 ### # start gene g942 Scaffold_7 AUGUSTUS gene 4259544 4260578 0.99 - . g942 Scaffold_7 AUGUSTUS transcript 4259544 4260578 0.99 - . g942.t1 Scaffold_7 AUGUSTUS stop_codon 4259544 4259546 . - 0 transcript_id "g942.t1"; gene_id "g942"; Scaffold_7 AUGUSTUS CDS 4259544 4260578 0.99 - 0 transcript_id "g942.t1"; gene_id "g942"; Scaffold_7 AUGUSTUS start_codon 4260576 4260578 . - 0 transcript_id "g942.t1"; gene_id "g942"; # protein sequence = [MKSSPLFTLADTGSAPDLSNIVRKRWGAVQGFTDTQAEFRKTRNKADSLIDLEADLDFTPPFEQSSDSYRGRIDGLAK # ELQSVIRPGTLEPPLPPWIARRDSDTCQESPFSLPAASKSSLLLGNKTSSRPAYHQSTQKQSVPSPALYSFPSSSSSSVKNVSTPSERLPQLVLPRRI # SKMRSLKFAPECNPSSDRLDISNHDSKPHKPLFRGRSISMDFNNNSRSRPLSMFAGNQGMSASTSYLSKMGRTPPTGPLVKESSDYPLNRGRDVGLST # PFLHRPVNSNTPVRHQRRLHHSMMPSPGLKSFMDITPEQVQRKPTAHKDKVRKLLSRASQVFDWRKKKGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g942 ### # start gene g943 Scaffold_7 AUGUSTUS gene 4261336 4262127 0.96 - . g943 Scaffold_7 AUGUSTUS transcript 4261336 4262127 0.96 - . g943.t1 Scaffold_7 AUGUSTUS stop_codon 4261336 4261338 . - 0 transcript_id "g943.t1"; gene_id "g943"; Scaffold_7 AUGUSTUS CDS 4261336 4262127 0.96 - 0 transcript_id "g943.t1"; gene_id "g943"; Scaffold_7 AUGUSTUS start_codon 4262125 4262127 . - 0 transcript_id "g943.t1"; gene_id "g943"; # protein sequence = [MADAPRGRGGFGRGRGDRGRGRRGPRRGARKDDEKEWYVESTGVEGCIGSSSYRVPVTKLGRLVKDGKIKSMEEIYLF # SLPVKEYQIVDFFLPKLKDEVMKIMPVQKQTRAGQRTRFKAFVAIGDSDGHVGLGVKCAKEVATAIRGAIILAKLSVIPVRRGYWGTALGEPHTVPSK # VSGKVGSVMCRLIPAPRGTGIVAAPASKRLLELAGVQDVYTQSKGSTATMGNFLKATFAAVSFCSYSLFFSQCFAIVDHKNICLPYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g943 ### # start gene g944 Scaffold_7 AUGUSTUS gene 4265751 4266916 0.14 - . g944 Scaffold_7 AUGUSTUS transcript 4265751 4266916 0.14 - . g944.t1 Scaffold_7 AUGUSTUS stop_codon 4265751 4265753 . - 0 transcript_id "g944.t1"; gene_id "g944"; Scaffold_7 AUGUSTUS CDS 4265751 4266254 0.49 - 0 transcript_id "g944.t1"; gene_id "g944"; Scaffold_7 AUGUSTUS CDS 4266614 4266916 0.21 - 0 transcript_id "g944.t1"; gene_id "g944"; Scaffold_7 AUGUSTUS start_codon 4266914 4266916 . - 0 transcript_id "g944.t1"; gene_id "g944"; # protein sequence = [MQKHVSSFIRRLSFLLLATMFFIIKGIRSLIKAFCGSSSQQEPSQQQQQQQWHPQQQQPQYPTVQQPTPVYPPTQPLS # QQPHPKPTRPQQHPSPYPHSPRPKITRFVVSCLRNIHHAAASIQDSKPGEIDLHGLYVKEAIERTDYAIQDAKRRGDTEVHLIVGTLSFEVSISTVLY # QSAAAGKGLHSSGGVAKIKPAIEELMQKSVLLGYGIKALTNMGPSRHQLVAELDPNNAGVLLVQLGGHRDRAVGPDEIARRLNRDEEGCIVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g944 ### # start gene g945 Scaffold_7 AUGUSTUS gene 4267192 4268768 0.39 - . g945 Scaffold_7 AUGUSTUS transcript 4267192 4268768 0.39 - . g945.t1 Scaffold_7 AUGUSTUS stop_codon 4267192 4267194 . - 0 transcript_id "g945.t1"; gene_id "g945"; Scaffold_7 AUGUSTUS CDS 4267192 4268019 0.64 - 0 transcript_id "g945.t1"; gene_id "g945"; Scaffold_7 AUGUSTUS CDS 4268338 4268603 0.64 - 2 transcript_id "g945.t1"; gene_id "g945"; Scaffold_7 AUGUSTUS CDS 4268747 4268768 0.75 - 0 transcript_id "g945.t1"; gene_id "g945"; Scaffold_7 AUGUSTUS start_codon 4268766 4268768 . - 0 transcript_id "g945.t1"; gene_id "g945"; # protein sequence = [MDISSILAAAVLPTSISSVTDTTSIIIPSTTSSTTSSTPDVSSTTTSTSIFTTTSSSSSPSSIDSSSTSSSTVSPTTS # SITLTSTVLPTSSTSSTPENEAAAAEAANATAPAFLDDDDHPIYRRDYLHAGDMSSGGYSGYEGGGPIYTGAVPSASSHGTFNQPPMGIQPNENYPMA # EFGSLLYPGASPYPITMAPGQNPQQNNYYDHGFVGNEPLSASTMKTVRPTSGDFDILEQQQQRNEGGSDATNYTSTGTPHTTPSVSRGHSTTTSTSHS # RTDLFRNKSQGSRSLIDGYYSKAPSTTGGHDMVSPHSGESYAAHYQPGFSGMPKSSSSRRSTFGYDEAPPLPNLFWKTIDDEAVDESDDEVFQQKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g945 ### # start gene g946 Scaffold_7 AUGUSTUS gene 4272536 4273642 0.83 - . g946 Scaffold_7 AUGUSTUS transcript 4272536 4273642 0.83 - . g946.t1 Scaffold_7 AUGUSTUS stop_codon 4272536 4272538 . - 0 transcript_id "g946.t1"; gene_id "g946"; Scaffold_7 AUGUSTUS CDS 4272536 4273642 0.83 - 0 transcript_id "g946.t1"; gene_id "g946"; Scaffold_7 AUGUSTUS start_codon 4273640 4273642 . - 0 transcript_id "g946.t1"; gene_id "g946"; # protein sequence = [MKRIEESHDVTFEEGEPHRTRQKTSEDEGEDSVAVTAPTTPDENPGPNTDTEHPANGNFPPTMGADRAAQHDATQEPP # HGATLQPQTPEQRPPEPPRRSERGHVPSRRYLESAEYEGREDEARKKGEQWTTEQPADETFALITQSPYSFAATSGELWIPQSFKQAMKRADLWFTPM # EQEYQTLLAKQCWELVPLPPNANLTGGRWTYAIKFDAHGNLLKRKARYVAQGYTQIQGQDYDKTYGGVARMESVRLVLAIAAALKLSIFQVDFTAAFL # NSPINHDVYMKQPDGFVKPGSEHLVCKLKKSIYGTMQGSHDWQETLAAGYVADGYTASRADPCIRYRRVGNEYTITSTYGDDVCGGLRQRQGGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g946 ### # start gene g947 Scaffold_7 AUGUSTUS gene 4274822 4276039 0.77 - . g947 Scaffold_7 AUGUSTUS transcript 4274822 4276039 0.77 - . g947.t1 Scaffold_7 AUGUSTUS stop_codon 4274822 4274824 . - 0 transcript_id "g947.t1"; gene_id "g947"; Scaffold_7 AUGUSTUS CDS 4274822 4276039 0.77 - 0 transcript_id "g947.t1"; gene_id "g947"; Scaffold_7 AUGUSTUS start_codon 4276037 4276039 . - 0 transcript_id "g947.t1"; gene_id "g947"; # protein sequence = [MSTGSMVNIPRLPDEKQLVGEDNWRPFKREISFAVQSRGLTGYMDGTIPKPTPTTENYPRPIYQVVPTPAYSVTPYPE # EWELRDRLVAGAIVSNIVDPIGLGIDETKRASEIWQSLIKRFEKRDEQRIHLAETSLRNEVFDPLTDMMEAHEKKMRNLLKKVHDLGGTTTDAQFRRI # TIFSMPPDWRQDVRTVPGTSSAEAFTYLQTLWYQREEERKEEERDTKRVKALMAAHSHPQTTQDQPRTGGRSSIICHNCNKAGHIAKKCWAKGGGMEG # QGPRGNGKSKANANANATITNETEITSPMATYVMSVKASGSKQSTSETHQRPVPDADPTNRQAHTVLKGRDQHKVTGNGIEDVHSFSLVSPKDCIICL # GHTSLYSPPLPTIKTFLDSGASEHCLGQQGRLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g947 ### # start gene g948 Scaffold_7 AUGUSTUS gene 4277862 4278914 0.68 - . g948 Scaffold_7 AUGUSTUS transcript 4277862 4278914 0.68 - . g948.t1 Scaffold_7 AUGUSTUS stop_codon 4277862 4277864 . - 0 transcript_id "g948.t1"; gene_id "g948"; Scaffold_7 AUGUSTUS CDS 4277862 4278914 0.68 - 0 transcript_id "g948.t1"; gene_id "g948"; Scaffold_7 AUGUSTUS start_codon 4278912 4278914 . - 0 transcript_id "g948.t1"; gene_id "g948"; # protein sequence = [MSPTFLLPQAQPTQINNKDIALITLMAIFILLIGAAAIRLAHLVYFKEDASYGPRVISSSKTFTESSSTLPLTSSSTP # RVSSSIKFIASDDMDDPFDFPNDKIERDITFLFPFARPETPPCPPRRPPAFLREEEEDIAAMLSIRAGQESVCRRGHREKKESESSLTTTTSTVQDSL # CPSEQRSSVTSVYSISIRSEDEEEEDMEEAVEVYEVKRVQTQSMEVKRGVLMSWRTSRPQSPAPDMPTVVISESSSDTGALDTIIRSDNAFLQPLPSL # LITHPSEISLVSTTSTVSVDLDEFPLPPNLPILPKIQSVDLPLMIIVPDVDGSTSRMSREEKRSTVDQVITMYEGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g948 ### # start gene g949 Scaffold_7 AUGUSTUS gene 4279583 4281172 0.29 - . g949 Scaffold_7 AUGUSTUS transcript 4279583 4281172 0.29 - . g949.t1 Scaffold_7 AUGUSTUS stop_codon 4279583 4279585 . - 0 transcript_id "g949.t1"; gene_id "g949"; Scaffold_7 AUGUSTUS CDS 4279583 4280267 0.51 - 1 transcript_id "g949.t1"; gene_id "g949"; Scaffold_7 AUGUSTUS CDS 4280691 4281172 0.3 - 0 transcript_id "g949.t1"; gene_id "g949"; Scaffold_7 AUGUSTUS start_codon 4281170 4281172 . - 0 transcript_id "g949.t1"; gene_id "g949"; # protein sequence = [MKPAAKTSKAPTPPTTNGTPSTRLTPNMRRLPGSGYKLPTKAVDLSRSQNQSKDGSITPSISSSSAASKDVDVAMKDM # TRRPNEDKQKDDQRLPTSRSNIKKEEGELSTSSSGTGGIGARTNDGPAPVKRVKHLRDEAMESDQDKIKDNSKGKNRERAEGRDRERDSPQKGRDARS # NKFVNEPTTDRKSSANSQSHSGKGKTMKKEPSLPPLPAKKVKKELSPVPRHTSPISNHSNKSSSTKGAKFRRKSPIYTSSEDEDNQRHPSPALPTPTA # SSSSAGSRRSHLSTNDALTDGNLNEHSHEADHRNALRSKYTASYVKYLSTFQTLVSQKQEIERLLNRASSRSSDSDGDVELLDFEGLTKTLSQNKQQW # EELQSIQLEHEREMLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g949 ### # start gene g950 Scaffold_7 AUGUSTUS gene 4286226 4288060 0.86 - . g950 Scaffold_7 AUGUSTUS transcript 4286226 4288060 0.86 - . g950.t1 Scaffold_7 AUGUSTUS stop_codon 4286226 4286228 . - 0 transcript_id "g950.t1"; gene_id "g950"; Scaffold_7 AUGUSTUS CDS 4286226 4287737 0.9 - 0 transcript_id "g950.t1"; gene_id "g950"; Scaffold_7 AUGUSTUS CDS 4288028 4288060 0.92 - 0 transcript_id "g950.t1"; gene_id "g950"; Scaffold_7 AUGUSTUS start_codon 4288058 4288060 . - 0 transcript_id "g950.t1"; gene_id "g950"; # protein sequence = [MWYLAPVELLCLSLGHRAYGAESKKSASNPRINGPKPPSPPSDASERYTVLQRKVDDLEKVHNDGKKAVCDPSLMLVP # SGTNTCSQHQAEVERLKLELARLQKANAELTDRLDKQKKQKEALDLRVDELRKNSNADKAEIKDLGVKLRMSEHQRTQMTAKHGNVADVKKSLQSLET # RRKEEMKERDRTIADLEKSLLTDKKKREMVESQLKETKAKHDFEIDKMKDTVEKLKREIVAARDEVQEIQHRLEATISKTSSNEESLLAQLEDHKLML # NEVAEHYGLLASNTVSRLAFERLTFENYALRIQAARSSRKLGNTEGQVSELANLIRQSQEENQILRRNSKDMMQELSSFIENATSKPPSPPSYDDLDE # IITHLDRDHEAFQEEETRINIETLQLEAELHHLQHDALFFAYAEAETELHEALAIASKLPEVEQQRDIAQELLQATNITAQSLRLSSDKFKLQVAELE # EKLKTETRKSDEALQKEQANAHRLTTTVQKLRMAEDGLRAENEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g950 ### # start gene g951 Scaffold_7 AUGUSTUS gene 4288143 4288442 0.52 - . g951 Scaffold_7 AUGUSTUS transcript 4288143 4288442 0.52 - . g951.t1 Scaffold_7 AUGUSTUS stop_codon 4288143 4288145 . - 0 transcript_id "g951.t1"; gene_id "g951"; Scaffold_7 AUGUSTUS CDS 4288143 4288442 0.52 - 0 transcript_id "g951.t1"; gene_id "g951"; Scaffold_7 AUGUSTUS start_codon 4288440 4288442 . - 0 transcript_id "g951.t1"; gene_id "g951"; # protein sequence = [MLSLIGSLQRDPFSSVHIPSNSTQNHREVEEEQEEQDVVDGFLNGMDEDHEGSDEDIESDQDGFEALNRKQNDVNAER # SWQTATEREKGEEEKEEEKES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g951 ### # start gene g952 Scaffold_7 AUGUSTUS gene 4294007 4295839 0.14 + . g952 Scaffold_7 AUGUSTUS transcript 4294007 4295839 0.14 + . g952.t1 Scaffold_7 AUGUSTUS start_codon 4294007 4294009 . + 0 transcript_id "g952.t1"; gene_id "g952"; Scaffold_7 AUGUSTUS CDS 4294007 4294177 0.26 + 0 transcript_id "g952.t1"; gene_id "g952"; Scaffold_7 AUGUSTUS CDS 4294721 4295839 0.49 + 0 transcript_id "g952.t1"; gene_id "g952"; Scaffold_7 AUGUSTUS stop_codon 4295837 4295839 . + 0 transcript_id "g952.t1"; gene_id "g952"; # protein sequence = [MFPPSLTLKPGGVPDQGYFQFVRDDFDDKTRRTFEIKYYGAKKAPTQSGHIILGTTVQLRRVAIEALPDTTIPDVPDG # EFEPFEGNKINLRNPGVSSSQAVRDVVEQTQDTVRKQLEAAEGNLPLDVSQLQKVNLKELVNPTLGQSKDSDILYLWIKQKEARGLDAVVITDGRLEA # PLGSTAGERFTDQQLDALRVGNGDFTAGYDSYDSTEIPGFASNMTSSEMVTLFDKSTDLTQTQRGALVHHIRVASEQEFRESVWQKTDNIVGMFQEAG # GATKPMPQDLLLNAVPDEYGGRCYPLVRAMSVALAQSDFAVDQLGIKLVSISTLSNADLLNAELFRQCLKDLHSSYPAAEASTLVGPTNLQDAVSKLS # AEEGSSTIFALNTNIHAMLLGATNRGGKISYHFYDPNFTLATFASQQELVDATTKFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g952 ### # start gene g953 Scaffold_7 AUGUSTUS gene 4295969 4298261 0.39 + . g953 Scaffold_7 AUGUSTUS transcript 4295969 4298261 0.39 + . g953.t1 Scaffold_7 AUGUSTUS start_codon 4295969 4295971 . + 0 transcript_id "g953.t1"; gene_id "g953"; Scaffold_7 AUGUSTUS CDS 4295969 4296842 0.41 + 0 transcript_id "g953.t1"; gene_id "g953"; Scaffold_7 AUGUSTUS CDS 4296895 4298261 0.96 + 2 transcript_id "g953.t1"; gene_id "g953"; Scaffold_7 AUGUSTUS stop_codon 4298259 4298261 . + 0 transcript_id "g953.t1"; gene_id "g953"; # protein sequence = [MSPRLSRDHHYQGSPELYLPDPARFTENRALSSGASLLEASELAEAWRDATAKLEASTGLGEHWMPILETLEDLDSGG # YRVQFVNLEDLSETQWISTDDPEIKDFKAYLDERLKALDHAYEFEGGTFVQKEDVTSAEAIDGLNAMFVVKTLIEHFNSRNNASEGNGNTNSNLAMAL # KVQSYLNLTQLGQQSLGDVVKVVELTQTIIRSEQAAQSSLSTVVRAFGRISEGAGFLFGAANVVFDAYELSNAQNEIQKAVFGTQLAFDSASFLASAG # SVGAGMLGASSAAAVLGAFGQVAEDAQTVGRYFGDTEAAYKAGGYKYDEEHKILVPLVGAVISELDLTGDVQYDSQYIYRTHHGSTGSGYINYFFWVG # DFPQMVRDKSQAINIREGIGAPASGKLANTADYTTVILPATPKSYISYEYMILPFATTRHDYGFDIIRRLEVDKRFDYDFYIFPSEYLIRRISHEYVE # TSVAVKLDGRSVRVQAPSLPDNMHNVLKYTLQGAGADYTVGLMAGVGITLSSVENTRWILDCRDLANDTITVGDDTVSVGGVQVIVSNRDFSSMLAIN # KNAEVLQVDFDNHTTFVVEEDASKFPAGNENILAYLNDLNDKHLLRGMFITVENYTTPSGQAVGRAFYDVTNKRLLYTVDAPTELTENVQFGAEISTG # EVYLYNVEHPGIWRVDPATGTCLAKYDALCPSPNRTLIRVWQEGKRSSSDCKYHILIIFQKMIMPMLYSVTSSRKTNSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g953 ### # start gene g954 Scaffold_7 AUGUSTUS gene 4298767 4300125 0.54 + . g954 Scaffold_7 AUGUSTUS transcript 4298767 4300125 0.54 + . g954.t1 Scaffold_7 AUGUSTUS start_codon 4298767 4298769 . + 0 transcript_id "g954.t1"; gene_id "g954"; Scaffold_7 AUGUSTUS CDS 4298767 4300125 0.54 + 0 transcript_id "g954.t1"; gene_id "g954"; Scaffold_7 AUGUSTUS stop_codon 4300123 4300125 . + 0 transcript_id "g954.t1"; gene_id "g954"; # protein sequence = [MGYVLRLTSQGELFLEAVNRQWFTQFQGSGEHNEPWWTVLKSFAESHGSTTVSILGLHSVDHGAVPAWFCNGRIVITS # PHLRGQQLQIAGLTNGGGEAWLCHWKTEESGQLFSQPLIPNDKLATVLSPTTPDVISDQIPEGTRVLEAYPFKTVLMTNNGLQYSTTDGVIFIIMDRD # TITLYGVDKSWQESHLENLEADLGELAKQWRHGEVVVMQGLVPTTTPAWYLVPAGKIAVVTNNSITWGDNPLWLGTDLNGTTGYFYVVSQGAIYSIGV # GEPPRLQQYVSMTVRFNDLLVLIPRPGEFCASIALWNVRYSMLSQRGGTDNTLYFLQQPSWAYYNANVVEWKGPGTVQIQVILFEDAGALLAKKIGED # LVIFDVAADTRSLTMRKAFQGADTGYGKFNVNFAAAGLGFGITPAVVQGAQLWLQDTAKLDYLPDVTVKTIGYYLQNLGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g954 ### # start gene g955 Scaffold_7 AUGUSTUS gene 4304205 4304738 0.76 - . g955 Scaffold_7 AUGUSTUS transcript 4304205 4304738 0.76 - . g955.t1 Scaffold_7 AUGUSTUS stop_codon 4304205 4304207 . - 0 transcript_id "g955.t1"; gene_id "g955"; Scaffold_7 AUGUSTUS CDS 4304205 4304418 0.76 - 1 transcript_id "g955.t1"; gene_id "g955"; Scaffold_7 AUGUSTUS CDS 4304680 4304738 0.76 - 0 transcript_id "g955.t1"; gene_id "g955"; Scaffold_7 AUGUSTUS start_codon 4304736 4304738 . - 0 transcript_id "g955.t1"; gene_id "g955"; # protein sequence = [MYFSPSSSLPSLCNDNPNSPGREGILGVGGGEGEGGDVGEGEGGDEDGDVDGDGVDADADADVKISPNHRVGPTSSNS # YSNSNSTSDSGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g955 ### # start gene g956 Scaffold_7 AUGUSTUS gene 4311343 4312812 0.32 + . g956 Scaffold_7 AUGUSTUS transcript 4311343 4312812 0.32 + . g956.t1 Scaffold_7 AUGUSTUS start_codon 4311343 4311345 . + 0 transcript_id "g956.t1"; gene_id "g956"; Scaffold_7 AUGUSTUS CDS 4311343 4311855 0.33 + 0 transcript_id "g956.t1"; gene_id "g956"; Scaffold_7 AUGUSTUS CDS 4311919 4312812 0.33 + 0 transcript_id "g956.t1"; gene_id "g956"; Scaffold_7 AUGUSTUS stop_codon 4312810 4312812 . + 0 transcript_id "g956.t1"; gene_id "g956"; # protein sequence = [MLIGSSPPTPHVISWVSPLPILARQEVKLLLSFKIFHTTSQHSYPHRKFAGTNISSTCSTPSSTNSPNSYLASIDSED # EVNGTFPNAGVTHYYTQWYESPVLDDGLHTVNLSKFVVDVDYAIITVGLTTPVGSTSTIIVDDSNTEIKHQGSGWNMSGRIFNDERRLGTWATCVAPF # FSGLFFSQCLSNLCPGSSIAVFAVFGWTGAGSLTLDFALDNQTTTSVVSIPSGSTPPHQETPNYQFLSSNLTSGNHTLFANDTDTIGNQTFVFDYLTY # IPSFELLANKPDFTDTGTVLPTPGAVAAPTQGNGNCKHVNTSVIVGCVVGGLVGLTFLAALAIIIARRWHKLKAESALVSPRPMDTQNMNIRLFNLST # CSLILLNNAAYASTNSTGAQAQSPSVQSFASPVNDKIKTLRHNGPPWPTPSPVLYPLRYGESTMTSLPGSAVSGRDTNPTQAQINELRRRPDDITS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g956 ### # start gene g957 Scaffold_7 AUGUSTUS gene 4315483 4319235 0.06 + . g957 Scaffold_7 AUGUSTUS transcript 4315483 4319235 0.06 + . g957.t1 Scaffold_7 AUGUSTUS start_codon 4315483 4315485 . + 0 transcript_id "g957.t1"; gene_id "g957"; Scaffold_7 AUGUSTUS CDS 4315483 4317373 0.28 + 0 transcript_id "g957.t1"; gene_id "g957"; Scaffold_7 AUGUSTUS CDS 4317441 4317925 0.37 + 2 transcript_id "g957.t1"; gene_id "g957"; Scaffold_7 AUGUSTUS CDS 4318026 4318294 0.17 + 0 transcript_id "g957.t1"; gene_id "g957"; Scaffold_7 AUGUSTUS CDS 4318413 4319235 0.83 + 1 transcript_id "g957.t1"; gene_id "g957"; Scaffold_7 AUGUSTUS stop_codon 4319233 4319235 . + 0 transcript_id "g957.t1"; gene_id "g957"; # protein sequence = [MDCHNERMIKIRKHTQKKAERDRERQAAQAAAYNELGVGGANKGGSVSTSHRDRELRAREMLGKDTSSQTLQSSRSTE # FSLNGHPSHPLRAPHANKASEFSRNNQSSVFHPPPRTSSVDSASQRPTPSKNHSMPVALEEPSLSNHPAVPSLSVPLTTNGGLHVTSTRDKRRSINPG # LVIKPPGEPSTASSSLSPIQREPPSPVNDLFGGSPISVKATSPFRENFPSSRPSSAASNNSANVHRQRSRPTSAMSSSSVGAATSTNGDESTVTMRPS # PSPLRPTTPHVSSSTRPNSANSLQKPERFSGRLSSRPGSAAGRDRPPSRADVPRSVESATDEDDDDEEKQEIKGSRFDRAPQRSMTDDSAKYSLIDAY # SGVAADSTTYTDKEPHQRTFSVESVPPMPPPKDSKVDPPAPLSTLPKRVSSSSHGPISAMSDPPSLTPEPHALLSVPSPKSLNTPTGTAGLSVPVMSR # NDSSHSNTSASTSGPGEVSDTETTETTAEDKELLDAEIEAEENGEESGNRATATFIAPALPPIRFSLNAADFSDLFTSVGGNMNSLKNFDTLATVAEN # HSSERKLWDTTPSTPPPSAASVQPNTMSQTLNVQSVRVVPDLPGPEPTSSSTLMPVHNEFSEQDGHSSNSDHHSKKEKGGLLRKVSFGKRNKLDRSAS # SSRALREREKRVTEAMPVPLNSKAGLTAPPLSRTISEPQVKNISDETLPSTTIMVSPPADAKEEAKEPISAADLVLQRLQDVLADATDRGAQQMKFDR # GFVEAIVNAMATKKADYVEARKQIDSMKTEYDRELKARRDAEAEVTRLRVLLSGQAARLTALTGDSRRQELRQQMSKELHENLNGLERDLSKLKVERD # VTLAEVEELNAVRCEQSSRSRSLTKRLDNLKSQYQRDLVPLTQQREALTREVMELKAARDVFLKKTTVLNARNEELAQLSAQYSRRVAMAPPNAPSNS # NGTETPSKNIGPMIVETPVRIDSRNIQQQQTPQQTHQLSAYSSVEEFDARKTKVEETHTPSRGPVKVFKWGSRAKEVSALIAQSVTEKVKIGHMEHSF # QPLSLLRFTRCDHCGEKMWGSQLRCMGCSISVHTRCVNQVHSACSPQTHNSNGGGNNEDSQLLRECVLSPLSVSFLTVPFRISTINVRSRSDRASPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g957 ### # start gene g958 Scaffold_7 AUGUSTUS gene 4320880 4321530 0.71 + . g958 Scaffold_7 AUGUSTUS transcript 4320880 4321530 0.71 + . g958.t1 Scaffold_7 AUGUSTUS start_codon 4320880 4320882 . + 0 transcript_id "g958.t1"; gene_id "g958"; Scaffold_7 AUGUSTUS CDS 4320880 4321530 0.71 + 0 transcript_id "g958.t1"; gene_id "g958"; Scaffold_7 AUGUSTUS stop_codon 4321528 4321530 . + 0 transcript_id "g958.t1"; gene_id "g958"; # protein sequence = [MVDGSDDEPPKLKTKQPRKSALISSSEDETPHNEPAPTTKSPSNRLVKATARTSLSAKVVIHSGDEADPRPVKKRKKL # SVPISDSEDEGGKMLSPPKKKAAIAGGSSSKPKARASLPAKKMKSDDGDYEMVSGDEGKKPIAHKTIIKTKVNTKKGFSSDGDEPGMKTKAKAPVQRT # VKKKLDNDSNRSKGKGKDKAEPQEPKKQKCVIRVLAHITF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g958 ### # start gene g959 Scaffold_7 AUGUSTUS gene 4321732 4322476 0.37 + . g959 Scaffold_7 AUGUSTUS transcript 4321732 4322476 0.37 + . g959.t1 Scaffold_7 AUGUSTUS start_codon 4321732 4321734 . + 0 transcript_id "g959.t1"; gene_id "g959"; Scaffold_7 AUGUSTUS CDS 4321732 4322036 0.38 + 0 transcript_id "g959.t1"; gene_id "g959"; Scaffold_7 AUGUSTUS CDS 4322092 4322476 0.96 + 1 transcript_id "g959.t1"; gene_id "g959"; Scaffold_7 AUGUSTUS stop_codon 4322474 4322476 . + 0 transcript_id "g959.t1"; gene_id "g959"; # protein sequence = [MISRLLMVTRRVVGQPSSKTNYVVLGEDAGPSKLKAIQKHGLKTLDEDQFLDLIATRKGSGKGLDEKTRKKMEKEQDA # IKAVAQEMEKKEKKAMKEAESGTGSSKVVDPSTQLWTTRYAPQSLKDVCGNKSAVEKLELWLKEWYITFVSTVLLIPNLFFRPQSYRASFKKPGKNGM # NMYRAVLISGSPGIGKTTSAHLCAKLAGYTPIELNASDTRSKKLVEVCFPHSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g959 ### # start gene g960 Scaffold_7 AUGUSTUS gene 4328422 4329246 0.57 - . g960 Scaffold_7 AUGUSTUS transcript 4328422 4329246 0.57 - . g960.t1 Scaffold_7 AUGUSTUS stop_codon 4328422 4328424 . - 0 transcript_id "g960.t1"; gene_id "g960"; Scaffold_7 AUGUSTUS CDS 4328422 4328670 0.88 - 0 transcript_id "g960.t1"; gene_id "g960"; Scaffold_7 AUGUSTUS CDS 4328725 4328877 0.9 - 0 transcript_id "g960.t1"; gene_id "g960"; Scaffold_7 AUGUSTUS CDS 4328953 4329246 0.58 - 0 transcript_id "g960.t1"; gene_id "g960"; Scaffold_7 AUGUSTUS start_codon 4329244 4329246 . - 0 transcript_id "g960.t1"; gene_id "g960"; # protein sequence = [MPAITSTPAPAPDVAPVAPAASTPSGESPATPPTYAESPSASTPVPASTTPTESHAAGSSFLSGSALQTSIQSMVDMG # FEREQVMRALRASYNNPERAGIPAHLEAEAVGPAAATSRTPAATAPATPAAAPAPAPAAATPSNQPQNLFQLAQQQQQQGAGAGAGLSAGAAAGAGAG # GGQQLDLAALASSPRCSNSVNTSLRIRRPYSLWFNLSLLKILVSHSSLHLTRRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g960 ### # start gene g961 Scaffold_7 AUGUSTUS gene 4329833 4332258 0.39 + . g961 Scaffold_7 AUGUSTUS transcript 4329833 4332258 0.39 + . g961.t1 Scaffold_7 AUGUSTUS start_codon 4329833 4329835 . + 0 transcript_id "g961.t1"; gene_id "g961"; Scaffold_7 AUGUSTUS CDS 4329833 4332008 0.39 + 0 transcript_id "g961.t1"; gene_id "g961"; Scaffold_7 AUGUSTUS CDS 4332125 4332258 0.62 + 2 transcript_id "g961.t1"; gene_id "g961"; Scaffold_7 AUGUSTUS stop_codon 4332256 4332258 . + 0 transcript_id "g961.t1"; gene_id "g961"; # protein sequence = [MQNEHGDDYIRRIAAFIRGNERNLAELGFVRRRNPRRPAETNGSAFYNPLTWFGSESTGPPPKSVVMSIDTHHLFYLL # MRLEALNLPVGTLDVRVDSPSRPLSYINLFPDTDKTETLSLSSFRSTFSAVSALSLGVGWWGRPEPPNVDTELKYIYSSFTKLPALSVTAPTRNLIAE # LANEPPNENAIPMDSFKNLQSLECTDIDPRSLLGWDYLAESLISLRIKKSGLEDVSDIFIGAVLDDQARRAGSASRKRMRRIPYGPERHTSFYSAQLP # DTVQEVADEETSSPTNSIPPTTPPELSSRKWASLRFLSLSGNDLTFFPTELTLYLTSITHLDLSSNLLNSVPEGLSALYNLVSLNLCDNMIESVLGIY # TQLGSVTSINLSRNRLESICGLERLHGLERVDLRHNAIEESSEIGRLAPLPNISNVWIEGNPFTEYEESYRVTCFDFFWKEGKTILLDGSPPGFYEKK # NLTAPPPEQAHTSRPVSAAHSPPTIAIGHTHPHSHPHSQANSPPVEVADGSNHSPTAAPPPALSSTSPQLGPVGAVGVSGKSRKKKVKRIVDLDGDHV # SEDSASIKGSNHKRTTSNGSYAFKHKPQKVNAPQPVGHPSFGQFISLLATPQNLPPTTSSTGETQQPEASASTSTATTRSESSTSPKFFLPPLSRTET # GFASGTLSSRPNRRSRHTRYQTEFALPTEGDSAESSPTLGPPIVKSSIPPSSPAVPSFRRGQTNTIVDEAEAFRRRIEALKQDMGDGWLKIFSQTQMK # TPSPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g961 ### # start gene g962 Scaffold_7 AUGUSTUS gene 4335106 4335375 0.69 - . g962 Scaffold_7 AUGUSTUS transcript 4335106 4335375 0.69 - . g962.t1 Scaffold_7 AUGUSTUS stop_codon 4335106 4335108 . - 0 transcript_id "g962.t1"; gene_id "g962"; Scaffold_7 AUGUSTUS CDS 4335106 4335375 0.69 - 0 transcript_id "g962.t1"; gene_id "g962"; Scaffold_7 AUGUSTUS start_codon 4335373 4335375 . - 0 transcript_id "g962.t1"; gene_id "g962"; # protein sequence = [MAFYATGLAESVGHAYKPPNLAFLARRWFESSSMLNAHVEIDLTLGAHLPLAGELRHSVRLLFDAAVIKLTDEETNTI # VGEWQHQREIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g962 ### # start gene g963 Scaffold_7 AUGUSTUS gene 4341791 4344014 0.38 + . g963 Scaffold_7 AUGUSTUS transcript 4341791 4344014 0.38 + . g963.t1 Scaffold_7 AUGUSTUS start_codon 4341791 4341793 . + 0 transcript_id "g963.t1"; gene_id "g963"; Scaffold_7 AUGUSTUS CDS 4341791 4342097 0.49 + 0 transcript_id "g963.t1"; gene_id "g963"; Scaffold_7 AUGUSTUS CDS 4342888 4344014 0.73 + 2 transcript_id "g963.t1"; gene_id "g963"; Scaffold_7 AUGUSTUS stop_codon 4344012 4344014 . + 0 transcript_id "g963.t1"; gene_id "g963"; # protein sequence = [MLGADVYPVPAVAYENPANYNHQARDFAKDIPNAIWTDQFDNTANANAHYESTGPEIWEQTKGQVDGFICATGTGGTL # AGVGKFLHEKSQAKTQIWLADPPGTVHKPATEASTNQVDSQPVLDQLTATERPESSGEEASTTPLEADNTPSEQPRSSSPVPSAKFAAKDVSSAPEVK # STEKPVEKAEDGSSSPTTPNGSHRRKAQMSSTSETVAPPESPKTKSARPKPPFLSRLLRVLIPCIPSSPHSQPIEIDEPKTAPVSTLEKPKPLKEVPE # VTSASEPSPSKATPNASTSEPNIPLPLSITPPVAITPTIQDGDVILPPTPTNQLLPQAETEGMTSGAVVPPGSSGTVDSKRSSHYSTSRTNGAADGED # SDGTSSFTDDDELEDVHNLDDFEDEEDRLISNGGAGIPVGPVCALFIPYKVHAFNVALFRMVFQGRYYLLLPLNMQGESVLCLTLMKLSSTVVLRYSS # GGYKAYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g963 ### # start gene g964 Scaffold_7 AUGUSTUS gene 4349387 4350007 1 - . g964 Scaffold_7 AUGUSTUS transcript 4349387 4350007 1 - . g964.t1 Scaffold_7 AUGUSTUS stop_codon 4349387 4349389 . - 0 transcript_id "g964.t1"; gene_id "g964"; Scaffold_7 AUGUSTUS CDS 4349387 4350007 1 - 0 transcript_id "g964.t1"; gene_id "g964"; Scaffold_7 AUGUSTUS start_codon 4350005 4350007 . - 0 transcript_id "g964.t1"; gene_id "g964"; # protein sequence = [MTYWGVHTARKPDVSSTVSSIIEAVGSIDNVPGSSNSPPTDFLNPFYSAIGTSQRSKEIPETLQTVFKPVAHDADAWS # LPSFLRHKRTENTRAKELRPVKTFHAEKLKARLFEVGSGAPVGDPQPRYQKRFYADQGETGPSKKKQKIALAISPEKEREQSAPLRKLDGFDPGFDDI # LPGESFMSWEQLRIISLKIGRARVRQAQTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g964 ### # start gene g965 Scaffold_7 AUGUSTUS gene 4350092 4350880 0.9 - . g965 Scaffold_7 AUGUSTUS transcript 4350092 4350880 0.9 - . g965.t1 Scaffold_7 AUGUSTUS stop_codon 4350092 4350094 . - 0 transcript_id "g965.t1"; gene_id "g965"; Scaffold_7 AUGUSTUS CDS 4350092 4350880 0.9 - 0 transcript_id "g965.t1"; gene_id "g965"; Scaffold_7 AUGUSTUS start_codon 4350878 4350880 . - 0 transcript_id "g965.t1"; gene_id "g965"; # protein sequence = [MNVYRPSRYKPTSVPRLPRIPPALPPLGPGHLQSGDTSFVQQVIPESSQFRPAPPTPAQRRRPEPNSYQTPEETRPFS # MSNPAGVKSFIPSSSILPHAITKLTSAATAPSNLMNTKFQRKIPPPPPPPIRDGEGSPKVLAPNSDTSGTQSQSHFGSQSQSQSQEFRNSFWHPQPLG # KVPDPGRVSQTESDSQPLDVYTQKPLLTSEVAYEEFDPFNDDHDSLFSEPDDDDISHHSSSEADSQHSNLAQNDFFAVIRGSSTQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g965 ### # start gene g966 Scaffold_7 AUGUSTUS gene 4360702 4361310 0.47 + . g966 Scaffold_7 AUGUSTUS transcript 4360702 4361310 0.47 + . g966.t1 Scaffold_7 AUGUSTUS start_codon 4360702 4360704 . + 0 transcript_id "g966.t1"; gene_id "g966"; Scaffold_7 AUGUSTUS CDS 4360702 4361310 0.47 + 0 transcript_id "g966.t1"; gene_id "g966"; Scaffold_7 AUGUSTUS stop_codon 4361308 4361310 . + 0 transcript_id "g966.t1"; gene_id "g966"; # protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD # HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS # DRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g966 ### # start gene g967 Scaffold_7 AUGUSTUS gene 4361340 4362539 0.94 + . g967 Scaffold_7 AUGUSTUS transcript 4361340 4362539 0.94 + . g967.t1 Scaffold_7 AUGUSTUS start_codon 4361340 4361342 . + 0 transcript_id "g967.t1"; gene_id "g967"; Scaffold_7 AUGUSTUS CDS 4361340 4362539 0.94 + 0 transcript_id "g967.t1"; gene_id "g967"; Scaffold_7 AUGUSTUS stop_codon 4362537 4362539 . + 0 transcript_id "g967.t1"; gene_id "g967"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAISSVIRETF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g967 ### # start gene g968 Scaffold_7 AUGUSTUS gene 4363310 4364535 0.6 + . g968 Scaffold_7 AUGUSTUS transcript 4363310 4364535 0.6 + . g968.t1 Scaffold_7 AUGUSTUS start_codon 4363310 4363312 . + 0 transcript_id "g968.t1"; gene_id "g968"; Scaffold_7 AUGUSTUS CDS 4363310 4363493 0.86 + 0 transcript_id "g968.t1"; gene_id "g968"; Scaffold_7 AUGUSTUS CDS 4363604 4364535 0.62 + 2 transcript_id "g968.t1"; gene_id "g968"; Scaffold_7 AUGUSTUS stop_codon 4364533 4364535 . + 0 transcript_id "g968.t1"; gene_id "g968"; # protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEEQEVFTKYKPVDKKVNPI # KATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIP # HEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVG # YDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g968 ### # start gene g969 Scaffold_7 AUGUSTUS gene 4364649 4365525 0.47 + . g969 Scaffold_7 AUGUSTUS transcript 4364649 4365525 0.47 + . g969.t1 Scaffold_7 AUGUSTUS start_codon 4364649 4364651 . + 0 transcript_id "g969.t1"; gene_id "g969"; Scaffold_7 AUGUSTUS CDS 4364649 4365084 0.47 + 0 transcript_id "g969.t1"; gene_id "g969"; Scaffold_7 AUGUSTUS CDS 4365164 4365525 0.53 + 2 transcript_id "g969.t1"; gene_id "g969"; Scaffold_7 AUGUSTUS stop_codon 4365523 4365525 . + 0 transcript_id "g969.t1"; gene_id "g969"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEAKLRRFERKYRHTIKDWDFKPGQLVQVRNSGI # EKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDSMVEDEDEYWMTPEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g969 ### # start gene g970 Scaffold_7 AUGUSTUS gene 4365868 4367319 0.33 - . g970 Scaffold_7 AUGUSTUS transcript 4365868 4367319 0.33 - . g970.t1 Scaffold_7 AUGUSTUS stop_codon 4365868 4365870 . - 0 transcript_id "g970.t1"; gene_id "g970"; Scaffold_7 AUGUSTUS CDS 4365868 4366295 1 - 2 transcript_id "g970.t1"; gene_id "g970"; Scaffold_7 AUGUSTUS CDS 4366379 4366511 0.99 - 0 transcript_id "g970.t1"; gene_id "g970"; Scaffold_7 AUGUSTUS CDS 4366926 4367093 0.4 - 0 transcript_id "g970.t1"; gene_id "g970"; Scaffold_7 AUGUSTUS CDS 4367152 4367319 0.9 - 0 transcript_id "g970.t1"; gene_id "g970"; Scaffold_7 AUGUSTUS start_codon 4367317 4367319 . - 0 transcript_id "g970.t1"; gene_id "g970"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTPHSHVRQVSNLTARQSI # IDTLCLGHKLFPDIVSDSHFEQHLKFTAFANDARNRRSTPYPTGSNKGSNKVEKFAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSTNLD # TPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSSSDSSASDASFATAQSIPTTGSEDTVVTPTENAVPVLKT # VERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g970 ### # start gene g971 Scaffold_7 AUGUSTUS gene 4373352 4375805 0.59 - . g971 Scaffold_7 AUGUSTUS transcript 4373352 4375805 0.59 - . g971.t1 Scaffold_7 AUGUSTUS stop_codon 4373352 4373354 . - 0 transcript_id "g971.t1"; gene_id "g971"; Scaffold_7 AUGUSTUS CDS 4373352 4375805 0.59 - 0 transcript_id "g971.t1"; gene_id "g971"; Scaffold_7 AUGUSTUS start_codon 4375803 4375805 . - 0 transcript_id "g971.t1"; gene_id "g971"; # protein sequence = [MFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEY # LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPT # RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYL # SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDN # GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLIT # QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQE # VEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRK # AHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEE # ILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g971 ### # start gene g972 Scaffold_7 AUGUSTUS gene 4377114 4378280 0.84 - . g972 Scaffold_7 AUGUSTUS transcript 4377114 4378280 0.84 - . g972.t1 Scaffold_7 AUGUSTUS stop_codon 4377114 4377116 . - 0 transcript_id "g972.t1"; gene_id "g972"; Scaffold_7 AUGUSTUS CDS 4377114 4378280 0.84 - 0 transcript_id "g972.t1"; gene_id "g972"; Scaffold_7 AUGUSTUS start_codon 4378278 4378280 . - 0 transcript_id "g972.t1"; gene_id "g972"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g972 ### # start gene g973 Scaffold_7 AUGUSTUS gene 4381203 4381667 0.74 + . g973 Scaffold_7 AUGUSTUS transcript 4381203 4381667 0.74 + . g973.t1 Scaffold_7 AUGUSTUS start_codon 4381203 4381205 . + 0 transcript_id "g973.t1"; gene_id "g973"; Scaffold_7 AUGUSTUS CDS 4381203 4381667 0.74 + 0 transcript_id "g973.t1"; gene_id "g973"; Scaffold_7 AUGUSTUS stop_codon 4381665 4381667 . + 0 transcript_id "g973.t1"; gene_id "g973"; # protein sequence = [MEPILLRAIHSEVAARAAARSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELIALKDFIDKQLATGAITPSSSPHGAPVLLSRRKAANFAFASIFRGLNRITQKGSLPTPTHIRSSRRSEKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g973 ### # start gene g974 Scaffold_7 AUGUSTUS gene 4387254 4388304 0.92 + . g974 Scaffold_7 AUGUSTUS transcript 4387254 4388304 0.92 + . g974.t1 Scaffold_7 AUGUSTUS start_codon 4387254 4387256 . + 0 transcript_id "g974.t1"; gene_id "g974"; Scaffold_7 AUGUSTUS CDS 4387254 4387794 0.92 + 0 transcript_id "g974.t1"; gene_id "g974"; Scaffold_7 AUGUSTUS CDS 4387976 4388304 0.98 + 2 transcript_id "g974.t1"; gene_id "g974"; Scaffold_7 AUGUSTUS stop_codon 4388302 4388304 . + 0 transcript_id "g974.t1"; gene_id "g974"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK # DEMAPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEE # TPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g974 ### # start gene g975 Scaffold_7 AUGUSTUS gene 4399903 4400466 0.69 + . g975 Scaffold_7 AUGUSTUS transcript 4399903 4400466 0.69 + . g975.t1 Scaffold_7 AUGUSTUS start_codon 4399903 4399905 . + 0 transcript_id "g975.t1"; gene_id "g975"; Scaffold_7 AUGUSTUS CDS 4399903 4400466 0.69 + 0 transcript_id "g975.t1"; gene_id "g975"; Scaffold_7 AUGUSTUS stop_codon 4400464 4400466 . + 0 transcript_id "g975.t1"; gene_id "g975"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLAIAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLSKVKDRQLRNSLRSSRISEIGLKCLILTCGNVSSLH # YSQRSDNTSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g975 ### # start gene g976 Scaffold_7 AUGUSTUS gene 4413643 4414158 0.98 + . g976 Scaffold_7 AUGUSTUS transcript 4413643 4414158 0.98 + . g976.t1 Scaffold_7 AUGUSTUS start_codon 4413643 4413645 . + 0 transcript_id "g976.t1"; gene_id "g976"; Scaffold_7 AUGUSTUS CDS 4413643 4414158 0.98 + 0 transcript_id "g976.t1"; gene_id "g976"; Scaffold_7 AUGUSTUS stop_codon 4414156 4414158 . + 0 transcript_id "g976.t1"; gene_id "g976"; # protein sequence = [MFALSTALPHSDGAGRWDDIVPALPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSL # EAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPLLLGSVASLSIDLTGDDDELYETEESYAGRIAVAREGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g976 ### # start gene g977 Scaffold_7 AUGUSTUS gene 4414397 4416286 0.66 - . g977 Scaffold_7 AUGUSTUS transcript 4414397 4416286 0.66 - . g977.t1 Scaffold_7 AUGUSTUS stop_codon 4414397 4414399 . - 0 transcript_id "g977.t1"; gene_id "g977"; Scaffold_7 AUGUSTUS CDS 4414397 4416286 0.66 - 0 transcript_id "g977.t1"; gene_id "g977"; Scaffold_7 AUGUSTUS start_codon 4416284 4416286 . - 0 transcript_id "g977.t1"; gene_id "g977"; # protein sequence = [MISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGR # LGAKPDALTRRSDVYPKKGASRDQVLAGRGVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDELIKRGGRIYVPDVGTL # RREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILV # VVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQ # DDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNM # ENVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYL # VKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g977 ### # start gene g978 Scaffold_7 AUGUSTUS gene 4419713 4420495 0.89 - . g978 Scaffold_7 AUGUSTUS transcript 4419713 4420495 0.89 - . g978.t1 Scaffold_7 AUGUSTUS stop_codon 4419713 4419715 . - 0 transcript_id "g978.t1"; gene_id "g978"; Scaffold_7 AUGUSTUS CDS 4419713 4420495 0.89 - 0 transcript_id "g978.t1"; gene_id "g978"; Scaffold_7 AUGUSTUS start_codon 4420493 4420495 . - 0 transcript_id "g978.t1"; gene_id "g978"; # protein sequence = [MGDQKEERTRWKTREEAKAVLTPLLEYLPHIFLVNREIENDLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSN # SEGSNEGEQNQSSRNGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAW # KTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g978 ### # start gene g979 Scaffold_7 AUGUSTUS gene 4422352 4423074 0.67 - . g979 Scaffold_7 AUGUSTUS transcript 4422352 4423074 0.67 - . g979.t1 Scaffold_7 AUGUSTUS stop_codon 4422352 4422354 . - 0 transcript_id "g979.t1"; gene_id "g979"; Scaffold_7 AUGUSTUS CDS 4422352 4423074 0.67 - 0 transcript_id "g979.t1"; gene_id "g979"; Scaffold_7 AUGUSTUS start_codon 4423072 4423074 . - 0 transcript_id "g979.t1"; gene_id "g979"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPYNPCPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g979 ### # start gene g980 Scaffold_7 AUGUSTUS gene 4430798 4432874 0.09 - . g980 Scaffold_7 AUGUSTUS transcript 4430798 4432874 0.09 - . g980.t1 Scaffold_7 AUGUSTUS stop_codon 4430798 4430800 . - 0 transcript_id "g980.t1"; gene_id "g980"; Scaffold_7 AUGUSTUS CDS 4430798 4431498 0.49 - 2 transcript_id "g980.t1"; gene_id "g980"; Scaffold_7 AUGUSTUS CDS 4431555 4431792 0.54 - 0 transcript_id "g980.t1"; gene_id "g980"; Scaffold_7 AUGUSTUS CDS 4432099 4432410 0.45 - 0 transcript_id "g980.t1"; gene_id "g980"; Scaffold_7 AUGUSTUS CDS 4432572 4432760 0.52 - 0 transcript_id "g980.t1"; gene_id "g980"; Scaffold_7 AUGUSTUS CDS 4432815 4432874 0.97 - 0 transcript_id "g980.t1"; gene_id "g980"; Scaffold_7 AUGUSTUS start_codon 4432872 4432874 . - 0 transcript_id "g980.t1"; gene_id "g980"; # protein sequence = [MVIDSDHEEDEAYQASDSEVSLASSVSQTSTHTSKAFDVEEAKHNLPSASRVTCPDTGPGDLQHDPEYVKLIGRIQDS # TRRTPHAERVAAQTDEDSSDANFNMVHFLKLKERFEEKEPSKATLMGSDYNKDQLAQMCKFYGIPPFSTDSLVTPVIPSKLEMATKLILWVPSILLIN # TGTDYTVSAPGLLNLHETSSQIRQDYHSLILKYLRTVLVLFPDVSLKPNHHYAIHIAEDLELMGPVHAHNTPVFERTNHTLQELNSNKHLEVEATMLK # VYCQQGNLEMMLAHCPDDKDDIQEALDALLEIKRESHRGMFAGTDLSSWSSPDRKFKSSPIIMDSSTLDQIIELLCVEYQVPHSTWEGALTRDALLLA # GVAHDGVVFSPKTRENSIVFKKLDEGGYGAGTVQRIISHRHRHPARQTSEAVTYLEALDMNSIDDIEDLYRRLKCGWLCSQLPGRRRLVPLPNVVSHF # VRTNLIIQDTPVTHVYPMPRVRASFGHGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g980 ### # start gene g981 Scaffold_7 AUGUSTUS gene 4433783 4434154 0.39 + . g981 Scaffold_7 AUGUSTUS transcript 4433783 4434154 0.39 + . g981.t1 Scaffold_7 AUGUSTUS start_codon 4433783 4433785 . + 0 transcript_id "g981.t1"; gene_id "g981"; Scaffold_7 AUGUSTUS CDS 4433783 4434154 0.39 + 0 transcript_id "g981.t1"; gene_id "g981"; Scaffold_7 AUGUSTUS stop_codon 4434152 4434154 . + 0 transcript_id "g981.t1"; gene_id "g981"; # protein sequence = [MAVELCEPLALIWKGLKESKPRLIRSRSSGDPEAPMCVLMNGCPSLPMNSLKIRDSLKSPIFSDEVVGFRCAVNNVSI # PGMARRRPIHSFKLWKTCFWTGTTNILGPMDRVFHKEVPQIAEVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g981 ### # start gene g982 Scaffold_7 AUGUSTUS gene 4434735 4435127 1 - . g982 Scaffold_7 AUGUSTUS transcript 4434735 4435127 1 - . g982.t1 Scaffold_7 AUGUSTUS stop_codon 4434735 4434737 . - 0 transcript_id "g982.t1"; gene_id "g982"; Scaffold_7 AUGUSTUS CDS 4434735 4435127 1 - 0 transcript_id "g982.t1"; gene_id "g982"; Scaffold_7 AUGUSTUS start_codon 4435125 4435127 . - 0 transcript_id "g982.t1"; gene_id "g982"; # protein sequence = [MTNDRAYSGAPVAGVSSDSTPSSHDIVALSSSVSPSTQETAPYNQSEDPAIVDHGMKPETLEEELHIRLAALQDTDSR # LDFVQQPSSEQSFIFPDPETILKVNWRAFYFVAYASTQIAASLKQRQGFASY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g982 ### # start gene g983 Scaffold_7 AUGUSTUS gene 4451067 4452494 0.98 - . g983 Scaffold_7 AUGUSTUS transcript 4451067 4452494 0.98 - . g983.t1 Scaffold_7 AUGUSTUS stop_codon 4451067 4451069 . - 0 transcript_id "g983.t1"; gene_id "g983"; Scaffold_7 AUGUSTUS CDS 4451067 4452494 0.98 - 0 transcript_id "g983.t1"; gene_id "g983"; Scaffold_7 AUGUSTUS start_codon 4452492 4452494 . - 0 transcript_id "g983.t1"; gene_id "g983"; # protein sequence = [MDYERFLQTNIIPRPSSSSTFQASGSRNRRGVATADANGSSHNSQTPPSPRASRAAVRAGGGIITSARAHAAERRAER # ERNAQLRASGAARPRFRARRPTAAPGDNMHFVGLIRYDVFDPFDPRNYAAFNNIGFERYGPGFVHPIVQRKTDEPDYLAEYTHPQPATPGFCFDFEPP # EKAETIDPSSYNKPIPVSSQDNPFVLDDDGEIVQEPEPQEVDVDVGGSSNMKSSAPSPTVVSFVCSKCLEPLLLGEGASATALKMAAAGASAEQVEME # RKARKVWGLKCGHLIDGKCLDALGYPAGALDAQPKDVKGKGKGKSFSEEVDLADACDGELEAEKAKGATDEDVHPSLVPPSESNSIRSRLRSAAHSNN # ASASVSGATIGTSTGGGSTTPSPQFSTFAHRYLPTPIAHLFGHGPGSSSTSPKSKSHRKPRVQQTYSWKCPVNNCGRVHTSVRLEGVWGPEKVKGEGA # IPLFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g983 ### # start gene g984 Scaffold_7 AUGUSTUS gene 4454542 4454910 0.69 - . g984 Scaffold_7 AUGUSTUS transcript 4454542 4454910 0.69 - . g984.t1 Scaffold_7 AUGUSTUS stop_codon 4454542 4454544 . - 0 transcript_id "g984.t1"; gene_id "g984"; Scaffold_7 AUGUSTUS CDS 4454542 4454910 0.69 - 0 transcript_id "g984.t1"; gene_id "g984"; Scaffold_7 AUGUSTUS start_codon 4454908 4454910 . - 0 transcript_id "g984.t1"; gene_id "g984"; # protein sequence = [MPGFTAHAAENWMMFNGINTGFNGSGTFTPMTPVETAFAEELIAYWLSFVRSGDPNTFKQEKSPIWPEYFITGPTSEF # KQRIVFQQDQNNSTILSGSFVEMEPESESTRCKFVASKAQEEQN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g984 ### # start gene g985 Scaffold_7 AUGUSTUS gene 4468292 4468789 0.96 - . g985 Scaffold_7 AUGUSTUS transcript 4468292 4468789 0.96 - . g985.t1 Scaffold_7 AUGUSTUS stop_codon 4468292 4468294 . - 0 transcript_id "g985.t1"; gene_id "g985"; Scaffold_7 AUGUSTUS CDS 4468292 4468610 0.99 - 1 transcript_id "g985.t1"; gene_id "g985"; Scaffold_7 AUGUSTUS CDS 4468731 4468789 0.96 - 0 transcript_id "g985.t1"; gene_id "g985"; Scaffold_7 AUGUSTUS start_codon 4468787 4468789 . - 0 transcript_id "g985.t1"; gene_id "g985"; # protein sequence = [MPKQEDARGNTLESPRRRRSLGISDFPTSPVAIVSAEQLRVTSLPPYDPRTASALAGSSTSELSEQSIVDEPTNFHDL # YDAELEQIIDGIETSSASSSSLSATVYIPPGNAYCIDFVTEFELIQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g985 ### # start gene g986 Scaffold_7 AUGUSTUS gene 4469939 4470769 0.36 - . g986 Scaffold_7 AUGUSTUS transcript 4469939 4470769 0.36 - . g986.t1 Scaffold_7 AUGUSTUS stop_codon 4469939 4469941 . - 0 transcript_id "g986.t1"; gene_id "g986"; Scaffold_7 AUGUSTUS CDS 4469939 4470769 0.36 - 0 transcript_id "g986.t1"; gene_id "g986"; Scaffold_7 AUGUSTUS start_codon 4470767 4470769 . - 0 transcript_id "g986.t1"; gene_id "g986"; # protein sequence = [MLCDFTQGVLVEAINLRSRSRGGPGPGGPGRGPGGPGGGPGGPGRHLEELLPPPEIHPHHESSYTRKAHVNSSAFPNI # GFSESTNSGSWHRYYPGETRIQLDLTRLVSFYDTDLVPSLVAERYGKERIRHRLLGISPEDIHTVVRKVEELIAVSEAGSGIDWATLIRLIVKRYSER # LEMVQYILNSTNPANSAAENKVLAENIQVQLTAMLQPYMLFTIKPPQNSTSTNWVSPMYELCATTYTNYITTSSLHSRLTASENLILDGVQRQPGRYA # EL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g986 ### # start gene g987 Scaffold_7 AUGUSTUS gene 4478850 4479884 0.8 + . g987 Scaffold_7 AUGUSTUS transcript 4478850 4479884 0.8 + . g987.t1 Scaffold_7 AUGUSTUS start_codon 4478850 4478852 . + 0 transcript_id "g987.t1"; gene_id "g987"; Scaffold_7 AUGUSTUS CDS 4478850 4479884 0.8 + 0 transcript_id "g987.t1"; gene_id "g987"; Scaffold_7 AUGUSTUS stop_codon 4479882 4479884 . + 0 transcript_id "g987.t1"; gene_id "g987"; # protein sequence = [MISHSLIRSSYSTQAIFTSGQPVDFQEKKAPQTNKTGERQKNPKNTENYINRLSNDLLLEILRHFCDSRTAERFKRTC # KYPDFDANFLAVSFVNKRWRSIILATPSLWGKIYVALDSISPEKTPPFINSLVNLYLERSKGAALDICVLYSDYGVEDEDYNSEQEGEEGGNAGLLFP # VLPKLFQHAFRWRSAVLRLPQSSVLDSMRVPSDFPVLQKLDIKCVPAPDMDAGTTSFPGFLSPLLRKLSVTKFAFEGDFGSTCLDDISLTWVTPATAV # DFFENASSKCTANIHTLFSPYRYFGSSHVTSKLMALTVTATREENMAPDPLGNLLDCLTLPNVEKLTFCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g987 ### # start gene g988 Scaffold_7 AUGUSTUS gene 4480026 4480508 0.78 + . g988 Scaffold_7 AUGUSTUS transcript 4480026 4480508 0.78 + . g988.t1 Scaffold_7 AUGUSTUS start_codon 4480026 4480028 . + 0 transcript_id "g988.t1"; gene_id "g988"; Scaffold_7 AUGUSTUS CDS 4480026 4480508 0.78 + 0 transcript_id "g988.t1"; gene_id "g988"; Scaffold_7 AUGUSTUS stop_codon 4480506 4480508 . + 0 transcript_id "g988.t1"; gene_id "g988"; # protein sequence = [MKILDRLPALKHLVFKEASPKIDESNPLTEHFFQSFVARYNPVKDHSNDVGISAPFLPDLTHIELGFNSKSFPSIALA # EFIKSRLPPLSEDVGQSDPLPQNGISNWNIVSVQIYELMQDAPQLADALKQSLSKYRSGKAVIEITAECYDECGSEDSATVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g988 ### # start gene g989 Scaffold_7 AUGUSTUS gene 4482733 4483101 0.56 - . g989 Scaffold_7 AUGUSTUS transcript 4482733 4483101 0.56 - . g989.t1 Scaffold_7 AUGUSTUS stop_codon 4482733 4482735 . - 0 transcript_id "g989.t1"; gene_id "g989"; Scaffold_7 AUGUSTUS CDS 4482733 4482968 0.85 - 2 transcript_id "g989.t1"; gene_id "g989"; Scaffold_7 AUGUSTUS CDS 4483068 4483101 0.56 - 0 transcript_id "g989.t1"; gene_id "g989"; Scaffold_7 AUGUSTUS start_codon 4483099 4483101 . - 0 transcript_id "g989.t1"; gene_id "g989"; # protein sequence = [MLGNAGMQSTAEGDELKDIPWQKQPPLGSFLGDSEPLSDESNDSSLRTSLLFGGPWSDLTFFPLDFELDWEELGLGGG # AILSEGRDECF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g989 ### # start gene g990 Scaffold_7 AUGUSTUS gene 4484548 4485042 0.97 + . g990 Scaffold_7 AUGUSTUS transcript 4484548 4485042 0.97 + . g990.t1 Scaffold_7 AUGUSTUS start_codon 4484548 4484550 . + 0 transcript_id "g990.t1"; gene_id "g990"; Scaffold_7 AUGUSTUS CDS 4484548 4485042 0.97 + 0 transcript_id "g990.t1"; gene_id "g990"; Scaffold_7 AUGUSTUS stop_codon 4485040 4485042 . + 0 transcript_id "g990.t1"; gene_id "g990"; # protein sequence = [MEIKPVATAPPRNQSRFDKRQTEALIDEGDDELWAGQISIGSPAQKFLVDIDSTFPFSLYYFHARFLNTLVTAGSSDL # WIPSSSCKSSVCSSKHKYNAGNSSTSKKLSGTFSIQYGDGSSVSGPIYDDTVTVAGITVTEQTLSGVTELSSDFENDPTDGCVCTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g990 ### # start gene g991 Scaffold_7 AUGUSTUS gene 4492294 4493651 0.39 - . g991 Scaffold_7 AUGUSTUS transcript 4492294 4493651 0.39 - . g991.t1 Scaffold_7 AUGUSTUS stop_codon 4492294 4492296 . - 0 transcript_id "g991.t1"; gene_id "g991"; Scaffold_7 AUGUSTUS CDS 4492294 4492934 0.9 - 2 transcript_id "g991.t1"; gene_id "g991"; Scaffold_7 AUGUSTUS CDS 4493111 4493651 0.39 - 0 transcript_id "g991.t1"; gene_id "g991"; Scaffold_7 AUGUSTUS start_codon 4493649 4493651 . - 0 transcript_id "g991.t1"; gene_id "g991"; # protein sequence = [MGPEHIQTGDAASGTLESPMQAEYDTLIEKDCWMLVDLPLNANLTGRRWVYAIKWSKDGEVAKRKARYVAQGFTQIEG # VDYDKTYGAVARMESVRIVLAIIAVLGMFMFQVDFKAAFLNSPINHDVYMKQPEGFVKEGEEHKVCKLNKSIYGTMQGSHDWQDTLGKGYEDDGYIAS # KADPYPISKSITISQKAYFERMLEHFGLETVRIRHTPLDPKMKVTESPNPLPEDDRRFMSNKPYRAFIGSLLWGACSTRPDIAFASNFLARFQLNPGI # IHWKACEWLAGYIGDYRLLYHLSSSQAWRCPSWLWPCSFGYSDSDWASCLVTRRSTAGYVFFMGGAPVSWASKRQGSVALSTVEANILVSRKPVNRRA # GYALSFRRLISTQWSYDYSWG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g991 ### # start gene g992 Scaffold_7 AUGUSTUS gene 4495208 4495648 0.68 - . g992 Scaffold_7 AUGUSTUS transcript 4495208 4495648 0.68 - . g992.t1 Scaffold_7 AUGUSTUS stop_codon 4495208 4495210 . - 0 transcript_id "g992.t1"; gene_id "g992"; Scaffold_7 AUGUSTUS CDS 4495208 4495648 0.68 - 0 transcript_id "g992.t1"; gene_id "g992"; Scaffold_7 AUGUSTUS start_codon 4495646 4495648 . - 0 transcript_id "g992.t1"; gene_id "g992"; # protein sequence = [MELFDLCTSSPTPILSTQLPNAHTCRDCVPVSTGYGADKEVTYHVDTFNSSISDSIPDFDEYTACSAHNARAFLYAAS # KPQTPQTFLDSAASDHFWVRRADFIEYENLYGKAGKSAIAGKAGEFEIHGKGIVEFETAVNGIRRNAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g992 ### # start gene g993 Scaffold_7 AUGUSTUS gene 4498026 4498343 0.72 - . g993 Scaffold_7 AUGUSTUS transcript 4498026 4498343 0.72 - . g993.t1 Scaffold_7 AUGUSTUS stop_codon 4498026 4498028 . - 0 transcript_id "g993.t1"; gene_id "g993"; Scaffold_7 AUGUSTUS CDS 4498026 4498343 0.72 - 0 transcript_id "g993.t1"; gene_id "g993"; Scaffold_7 AUGUSTUS start_codon 4498341 4498343 . - 0 transcript_id "g993.t1"; gene_id "g993"; # protein sequence = [MEARGMDLTVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAKILDSKLDRRYKRCPLRYYIRWAGYEGTDDEF # SWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g993 ### # start gene g994 Scaffold_7 AUGUSTUS gene 4498778 4499449 0.63 - . g994 Scaffold_7 AUGUSTUS transcript 4498778 4499449 0.63 - . g994.t1 Scaffold_7 AUGUSTUS stop_codon 4498778 4498780 . - 0 transcript_id "g994.t1"; gene_id "g994"; Scaffold_7 AUGUSTUS CDS 4498778 4499449 0.63 - 0 transcript_id "g994.t1"; gene_id "g994"; Scaffold_7 AUGUSTUS start_codon 4499447 4499449 . - 0 transcript_id "g994.t1"; gene_id "g994"; # protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTCLMSSSSQTIFAE # FTRYLLRSCTPCNRAKVTRCLSAEDEWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g994 ### # start gene g995 Scaffold_7 AUGUSTUS gene 4503327 4503986 1 - . g995 Scaffold_7 AUGUSTUS transcript 4503327 4503986 1 - . g995.t1 Scaffold_7 AUGUSTUS stop_codon 4503327 4503329 . - 0 transcript_id "g995.t1"; gene_id "g995"; Scaffold_7 AUGUSTUS CDS 4503327 4503986 1 - 0 transcript_id "g995.t1"; gene_id "g995"; Scaffold_7 AUGUSTUS start_codon 4503984 4503986 . - 0 transcript_id "g995.t1"; gene_id "g995"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL # DTGDHDDQDPPVDPDDPGADNNNDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSS # ESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPSTSPTNGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g995 ### # start gene g996 Scaffold_7 AUGUSTUS gene 4504809 4505597 0.97 - . g996 Scaffold_7 AUGUSTUS transcript 4504809 4505597 0.97 - . g996.t1 Scaffold_7 AUGUSTUS stop_codon 4504809 4504811 . - 0 transcript_id "g996.t1"; gene_id "g996"; Scaffold_7 AUGUSTUS CDS 4504809 4505597 0.97 - 0 transcript_id "g996.t1"; gene_id "g996"; Scaffold_7 AUGUSTUS start_codon 4505595 4505597 . - 0 transcript_id "g996.t1"; gene_id "g996"; # protein sequence = [MSSTASSLSIPRFPESSQLAGENTWRIFKDQVLAHIEVRELEGYLDGTIIRPPAGGYVSTSTLYPPASTTTPAYSPTP # FPHEWRQRDRMAASIIYLNIVDPVGLGVEREKPAYHIWAELKKKYERRDEMRVHQADTKLRSARFDPSNTTIEEHEKTMKNHLKELRNLGGSCLDSQF # RLIVIASMPKSWRDLLINVKGISSDDAFIHLRQVYDNKKEDEEDTRQRSQVRALIAQEMASFQSANTASAPKKDCPTCTNPNCPPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g996 ### # start gene g997 Scaffold_7 AUGUSTUS gene 4508185 4508646 0.96 + . g997 Scaffold_7 AUGUSTUS transcript 4508185 4508646 0.96 + . g997.t1 Scaffold_7 AUGUSTUS start_codon 4508185 4508187 . + 0 transcript_id "g997.t1"; gene_id "g997"; Scaffold_7 AUGUSTUS CDS 4508185 4508214 0.96 + 0 transcript_id "g997.t1"; gene_id "g997"; Scaffold_7 AUGUSTUS CDS 4508311 4508646 0.98 + 0 transcript_id "g997.t1"; gene_id "g997"; Scaffold_7 AUGUSTUS stop_codon 4508644 4508646 . + 0 transcript_id "g997.t1"; gene_id "g997"; # protein sequence = [MHLTFPYFVFPRVAGPPQRTEPKFHLKFIEPSVGSLKPEELIRDRIRAAIKTAPNYGSIFEYVVYDNQCNIEDPRFAG # EITVKFWTNVKDATDGCTEKSPCTGKVVQNGDSNSLIRVVEGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g997 ### # start gene g998 Scaffold_7 AUGUSTUS gene 4514768 4515706 0.57 + . g998 Scaffold_7 AUGUSTUS transcript 4514768 4515706 0.57 + . g998.t1 Scaffold_7 AUGUSTUS start_codon 4514768 4514770 . + 0 transcript_id "g998.t1"; gene_id "g998"; Scaffold_7 AUGUSTUS CDS 4514768 4515706 0.57 + 0 transcript_id "g998.t1"; gene_id "g998"; Scaffold_7 AUGUSTUS stop_codon 4515704 4515706 . + 0 transcript_id "g998.t1"; gene_id "g998"; # protein sequence = [MGARDVTVSSSQVPSSAQREEASRRNEPPRSAHIPSTEEVPSRLSEGTINLPTGVGTGGPALISAPGQIDPTMLAPSM # QGFPLPTGTNPERPSTPLRIHHVSDSVTYFATPSSHHSGSYTGALPVDESHTVEEAYRYLQMDLEAVRILPVEKWALCCLNIDINKGREKLLPGVKKA # FDKYLEIVDDAKNEKDPRLYPALVATFDLCTNGDSDTLVFYRQDPSKIAGSLVLESPDIGAVFKELLEDPTKVKRKNLELKEGERTMWAHMHGLIEVK # HQHGVIVDGECKCLLTLSLSLCSHWSFQSEEMQARYTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g998 ### # start gene g999 Scaffold_7 AUGUSTUS gene 4534035 4534445 0.53 - . g999 Scaffold_7 AUGUSTUS transcript 4534035 4534445 0.53 - . g999.t1 Scaffold_7 AUGUSTUS stop_codon 4534035 4534037 . - 0 transcript_id "g999.t1"; gene_id "g999"; Scaffold_7 AUGUSTUS CDS 4534035 4534374 0.53 - 1 transcript_id "g999.t1"; gene_id "g999"; Scaffold_7 AUGUSTUS CDS 4534438 4534445 0.55 - 0 transcript_id "g999.t1"; gene_id "g999"; Scaffold_7 AUGUSTUS start_codon 4534443 4534445 . - 0 transcript_id "g999.t1"; gene_id "g999"; # protein sequence = [MRGIVERERKRDSFGSYKSITNLNGDAGRLNFGSIESVSNVQALIPNNNAEVDERAPLLGSRTLTPTTITARDYAHVP # QRRDDDSVVSDGENGPIYGSYKSQRSQISQGTETGGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g999 ### # start gene g1000 Scaffold_7 AUGUSTUS gene 4543959 4544882 0.1 - . g1000 Scaffold_7 AUGUSTUS transcript 4543959 4544882 0.1 - . g1000.t1 Scaffold_7 AUGUSTUS stop_codon 4543959 4543961 . - 0 transcript_id "g1000.t1"; gene_id "g1000"; Scaffold_7 AUGUSTUS CDS 4543959 4544273 1 - 0 transcript_id "g1000.t1"; gene_id "g1000"; Scaffold_7 AUGUSTUS CDS 4544402 4544433 0.48 - 2 transcript_id "g1000.t1"; gene_id "g1000"; Scaffold_7 AUGUSTUS CDS 4544635 4544758 0.96 - 0 transcript_id "g1000.t1"; gene_id "g1000"; Scaffold_7 AUGUSTUS CDS 4544844 4544882 0.24 - 0 transcript_id "g1000.t1"; gene_id "g1000"; Scaffold_7 AUGUSTUS start_codon 4544880 4544882 . - 0 transcript_id "g1000.t1"; gene_id "g1000"; # protein sequence = [MLSLIGDEATCWVPKAKTGASKKPAAAPFGSKTTKTKKNPLFEASPKNFGIGAPTVQAFEQVPSRETKKPLFVKYGLN # HIVALIEAKKAALVVIAHDVDPIELVVFLPALCRKMGVPYVIVKGKARLGTVTHKKTAAVVALQEVKSEDQRELATLVSAAKANLYVIIIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1000 ### # start gene g1001 Scaffold_7 AUGUSTUS gene 4551321 4552604 0.99 - . g1001 Scaffold_7 AUGUSTUS transcript 4551321 4552604 0.99 - . g1001.t1 Scaffold_7 AUGUSTUS stop_codon 4551321 4551323 . - 0 transcript_id "g1001.t1"; gene_id "g1001"; Scaffold_7 AUGUSTUS CDS 4551321 4552604 0.99 - 0 transcript_id "g1001.t1"; gene_id "g1001"; Scaffold_7 AUGUSTUS start_codon 4552602 4552604 . - 0 transcript_id "g1001.t1"; gene_id "g1001"; # protein sequence = [MCKIKWKNRKRAQSKSDTSAFPEPSISPRPKISRFVSLKRAKVDNNIPQSNDNNDDESQPLPVIPASPPLPNTVDLEH # DPTSTSTTLSVYVHPSDVRLPAAAPRNKLERTLGDAVPSRMLLSANANHIPDIPLGKPDRRRSRGSIHSLSSLSSTAKSNHRRSVARSLSSLGSFIRL # SNSRPSSDVFVYSEEGGNDVFDVIEGDDDKEEVCWIDNEFDSYSREGTVTPISPMVFSVRPPSPMPPSKPKLIVDSNISADGTSASVVSVGTEADGQD # SSVLSSDDDHRSAHSEVHTQATSLNDSSLSDTPFSFTDVCDTAPQPASPIIFFSEPEPESERPSSTVHPFSPRSDAESDVTESTPRTQLEALLSEPIQ # SLTNSPSSTSLFRSSFPFHPRREEREVVEPHAHGWTGEWNRKNMQDVIRSLRELK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1001 ### # start gene g1002 Scaffold_7 AUGUSTUS gene 4553073 4553612 0.99 - . g1002 Scaffold_7 AUGUSTUS transcript 4553073 4553612 0.99 - . g1002.t1 Scaffold_7 AUGUSTUS stop_codon 4553073 4553075 . - 0 transcript_id "g1002.t1"; gene_id "g1002"; Scaffold_7 AUGUSTUS CDS 4553073 4553612 0.99 - 0 transcript_id "g1002.t1"; gene_id "g1002"; Scaffold_7 AUGUSTUS start_codon 4553610 4553612 . - 0 transcript_id "g1002.t1"; gene_id "g1002"; # protein sequence = [MIASSELLQEPWYKATTNGSDLSSVDGLSASAGSITRPTPKPNRKASLYSLIAGKDNSLFSNSSQQTVTPYTSLQSST # TSFSTLSSNISPLEKFRLKKAKSSFNMQGPASPSAIAGPSDLSRIHSVTAISQSNLRKDLWAPAHDNDTNAVLRIIRYATQFYLIQSFLIMKQTAHQT # VTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1002 ### # start gene g1003 Scaffold_7 AUGUSTUS gene 4555335 4556231 1 - . g1003 Scaffold_7 AUGUSTUS transcript 4555335 4556231 1 - . g1003.t1 Scaffold_7 AUGUSTUS stop_codon 4555335 4555337 . - 0 transcript_id "g1003.t1"; gene_id "g1003"; Scaffold_7 AUGUSTUS CDS 4555335 4556231 1 - 0 transcript_id "g1003.t1"; gene_id "g1003"; Scaffold_7 AUGUSTUS start_codon 4556229 4556231 . - 0 transcript_id "g1003.t1"; gene_id "g1003"; # protein sequence = [MAHNHSADSSDDDEAPETLTLTESKGAFRKRNAEIREVEEARKKMRKDKRRERERILKERKQQREREELKAVKSRRVS # DNAEEEEDDGGEGDEEEDGENDVEKRMLRAMQQAEEEEEEEESGNEVDSVEEGESVDEDVDEDDIDAETREDVDEDEEDKEMVVDEDDDGGHEDEHEE # GSDAEMFSVDSSPPRSKSKSTLNAKSSMPKLKTNHLPDYLFASAFSSGSQKNQSKNNNLSFTGLSTTKKLQEKKTRRRKRSGGIARDHIIGYVLCTAS # TNTCIRYCSLITRSLHVLLIVSTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1003 ### # start gene g1004 Scaffold_7 AUGUSTUS gene 4560830 4561332 0.37 + . g1004 Scaffold_7 AUGUSTUS transcript 4560830 4561332 0.37 + . g1004.t1 Scaffold_7 AUGUSTUS start_codon 4560830 4560832 . + 0 transcript_id "g1004.t1"; gene_id "g1004"; Scaffold_7 AUGUSTUS CDS 4560830 4560835 0.4 + 0 transcript_id "g1004.t1"; gene_id "g1004"; Scaffold_7 AUGUSTUS CDS 4561057 4561332 0.92 + 0 transcript_id "g1004.t1"; gene_id "g1004"; Scaffold_7 AUGUSTUS stop_codon 4561330 4561332 . + 0 transcript_id "g1004.t1"; gene_id "g1004"; # protein sequence = [MEKAEALALEELEKESKHAQELEEQLMLDSARQQVAREREYKARKRASSEATEVPMTNEYPTESFADEIEFQGIRFDT # VKYFHPRIGTPFLLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1004 ### # start gene g1005 Scaffold_7 AUGUSTUS gene 4575286 4575609 0.5 + . g1005 Scaffold_7 AUGUSTUS transcript 4575286 4575609 0.5 + . g1005.t1 Scaffold_7 AUGUSTUS start_codon 4575286 4575288 . + 0 transcript_id "g1005.t1"; gene_id "g1005"; Scaffold_7 AUGUSTUS CDS 4575286 4575609 0.5 + 0 transcript_id "g1005.t1"; gene_id "g1005"; Scaffold_7 AUGUSTUS stop_codon 4575607 4575609 . + 0 transcript_id "g1005.t1"; gene_id "g1005"; # protein sequence = [MVPSMKTKPVTPAVLQLVNNGVAADDEDGDDAVVDAAGAVVGPCPAVVSEFFVLVVLVPFRLSGGNVLIVVEAEAGDV # DEDPAPALALTLEARDERTKTAQWQGTAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1005 ### # start gene g1006 Scaffold_7 AUGUSTUS gene 4580650 4581186 0.82 + . g1006 Scaffold_7 AUGUSTUS transcript 4580650 4581186 0.82 + . g1006.t1 Scaffold_7 AUGUSTUS start_codon 4580650 4580652 . + 0 transcript_id "g1006.t1"; gene_id "g1006"; Scaffold_7 AUGUSTUS CDS 4580650 4581186 0.82 + 0 transcript_id "g1006.t1"; gene_id "g1006"; Scaffold_7 AUGUSTUS stop_codon 4581184 4581186 . + 0 transcript_id "g1006.t1"; gene_id "g1006"; # protein sequence = [MFHPYSVFQTAIAIGAASTVLAIPLPPAPGAVNVAGIPGLQGVNSFSTRDEPEVRGLKNEAVYGLSRRDHHRDGDLFA # VDVELNEQQARRYGENGLDIEAESSPHYDDEEFTHHDVSRSCLFCLYHFYLVNTPSSSLCHQDDASVVPTEFVNVEESEHGVRSLSLCMYAVHVINMF # TG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1006 ### # start gene g1007 Scaffold_7 AUGUSTUS gene 4582351 4582686 0.98 - . g1007 Scaffold_7 AUGUSTUS transcript 4582351 4582686 0.98 - . g1007.t1 Scaffold_7 AUGUSTUS stop_codon 4582351 4582353 . - 0 transcript_id "g1007.t1"; gene_id "g1007"; Scaffold_7 AUGUSTUS CDS 4582351 4582686 0.98 - 0 transcript_id "g1007.t1"; gene_id "g1007"; Scaffold_7 AUGUSTUS start_codon 4582684 4582686 . - 0 transcript_id "g1007.t1"; gene_id "g1007"; # protein sequence = [MSANAIPSVEQALDKEEENWDAYTESSLAPSDSVSRVVWSFSQGKKKVRPLATSTALATQSSTAANDSRESKPDATPD # SGRYRSANIDLPYKIPMIIMTTATPSPPSTTVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1007 ### # start gene g1008 Scaffold_7 AUGUSTUS gene 4589392 4590732 0.13 + . g1008 Scaffold_7 AUGUSTUS transcript 4589392 4590732 0.13 + . g1008.t1 Scaffold_7 AUGUSTUS start_codon 4589392 4589394 . + 0 transcript_id "g1008.t1"; gene_id "g1008"; Scaffold_7 AUGUSTUS CDS 4589392 4589903 0.34 + 0 transcript_id "g1008.t1"; gene_id "g1008"; Scaffold_7 AUGUSTUS CDS 4590047 4590342 0.33 + 1 transcript_id "g1008.t1"; gene_id "g1008"; Scaffold_7 AUGUSTUS CDS 4590410 4590732 0.83 + 2 transcript_id "g1008.t1"; gene_id "g1008"; Scaffold_7 AUGUSTUS stop_codon 4590730 4590732 . + 0 transcript_id "g1008.t1"; gene_id "g1008"; # protein sequence = [MASHNQVHFQPQARPIHPSHLNSASDPELYSPSHSLTILNNDYDAFDALLHNIYEKTLQDNWFKPAGDTDSTGVCLRV # DPTSFRCFPYENPKLIPFEEGVRRLNVEVAVKIRSASVHAAVSRSPPTAREILIDSNTRIQILPDISALGDAERNNVLPSFARTIPLWSGRFRLPDLA # STVTSAAPSTIALPQYSSTRLSTAAGPFGMEDVDRSAADTMVVDFGFGAADEQDQEEKVVQPKKVSKKPKKSSFWSFLSWWKLQPPAPAQSEKDAFNL # EEGSDTGPEPRQLVLLGPFYAGCGAALTMYFAAAGISNLIEEWVLDGDTRRFGLVVVLPVVAAVSIVSNVYVFQCQVSEIQLLFPSFFAYNSLEIFLL # FLDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1008 ### # start gene g1009 Scaffold_7 AUGUSTUS gene 4591154 4591819 0.35 + . g1009 Scaffold_7 AUGUSTUS transcript 4591154 4591819 0.35 + . g1009.t1 Scaffold_7 AUGUSTUS start_codon 4591154 4591156 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; Scaffold_7 AUGUSTUS CDS 4591154 4591819 0.35 + 0 transcript_id "g1009.t1"; gene_id "g1009"; Scaffold_7 AUGUSTUS stop_codon 4591817 4591819 . + 0 transcript_id "g1009.t1"; gene_id "g1009"; # protein sequence = [MVYTGISSHLLTALSPYRLEFYANHNIGWVARPRHSSGPGGFKRAGKFKKASNMNYGLALSIAMEQQLAKLIGDASSN # NTTLSSSEPREASRPNTSASSPSTFSSQPHFESIESLEERALQLAIEQIYQESGTVKKVIDESGKETEEVVYHRPWAGGARSLRVGEIILIIDADTVV # PEDCFRDAAREMGEEEGRRLRSFSMRVVSPTSSFGLLYQIFTISF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1009 ### # start gene g1010 Scaffold_7 AUGUSTUS gene 4594348 4594674 0.57 - . g1010 Scaffold_7 AUGUSTUS transcript 4594348 4594674 0.57 - . g1010.t1 Scaffold_7 AUGUSTUS stop_codon 4594348 4594350 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; Scaffold_7 AUGUSTUS CDS 4594348 4594674 0.57 - 0 transcript_id "g1010.t1"; gene_id "g1010"; Scaffold_7 AUGUSTUS start_codon 4594672 4594674 . - 0 transcript_id "g1010.t1"; gene_id "g1010"; # protein sequence = [MNMHLAPHKFATTALAFHYDQLEASAFREEFNPDAFEDLTEPNVDLIHAVSDYLLSINEFQLSGAQKAGKLLKEWKVE # LANDHSATLVIPVTGSKRKPVCIPISQLRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1010 ### # start gene g1011 Scaffold_7 AUGUSTUS gene 4603507 4605269 0.51 + . g1011 Scaffold_7 AUGUSTUS transcript 4603507 4605269 0.51 + . g1011.t1 Scaffold_7 AUGUSTUS start_codon 4603507 4603509 . + 0 transcript_id "g1011.t1"; gene_id "g1011"; Scaffold_7 AUGUSTUS CDS 4603507 4603564 0.53 + 0 transcript_id "g1011.t1"; gene_id "g1011"; Scaffold_7 AUGUSTUS CDS 4603611 4603635 0.96 + 2 transcript_id "g1011.t1"; gene_id "g1011"; Scaffold_7 AUGUSTUS CDS 4604615 4605269 0.94 + 1 transcript_id "g1011.t1"; gene_id "g1011"; Scaffold_7 AUGUSTUS stop_codon 4605267 4605269 . + 0 transcript_id "g1011.t1"; gene_id "g1011"; # protein sequence = [MRSRGYTSVSGNRVSRGRGRFLATCYACPSSPNFPSTCLSPTQPGYGQVVASAPGRRRAPRKSSLPNVSTSTNSAWSV # VTPHTTDASFEPHPGALPPSAYTSYPPQYIPFNAHSEDFQQEILPTSDRHSLSLPPSTQRDRAYSRYAPYPDPSPPPTFRLPARENPIALHIPSTDFT # KHNSHNISLPPISPAASNRYGPSSAYALPPISALEDLRGVDVNDSAAVLRRLSQNDEADIWPSRSTNNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1011 ### # start gene g1012 Scaffold_7 AUGUSTUS gene 4608876 4609276 0.61 - . g1012 Scaffold_7 AUGUSTUS transcript 4608876 4609276 0.61 - . g1012.t1 Scaffold_7 AUGUSTUS stop_codon 4608876 4608878 . - 0 transcript_id "g1012.t1"; gene_id "g1012"; Scaffold_7 AUGUSTUS CDS 4608876 4609177 0.61 - 2 transcript_id "g1012.t1"; gene_id "g1012"; Scaffold_7 AUGUSTUS CDS 4609261 4609276 0.61 - 0 transcript_id "g1012.t1"; gene_id "g1012"; Scaffold_7 AUGUSTUS start_codon 4609274 4609276 . - 0 transcript_id "g1012.t1"; gene_id "g1012"; # protein sequence = [MTISKIGRPSDVATDSIFIPLLDKELKKVALFYENQEKELFDELAELEALVQNQDELGLDGDHYADDDEYDEEDDESL # SRSPERHRRRRLSSSVNVNRGTSGPGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1012 ### # start gene g1013 Scaffold_7 AUGUSTUS gene 4619626 4620837 1 - . g1013 Scaffold_7 AUGUSTUS transcript 4619626 4620837 1 - . g1013.t1 Scaffold_7 AUGUSTUS stop_codon 4619626 4619628 . - 0 transcript_id "g1013.t1"; gene_id "g1013"; Scaffold_7 AUGUSTUS CDS 4619626 4620837 1 - 0 transcript_id "g1013.t1"; gene_id "g1013"; Scaffold_7 AUGUSTUS start_codon 4620835 4620837 . - 0 transcript_id "g1013.t1"; gene_id "g1013"; # protein sequence = [MDGLSDHQPRRRRRHPWTPWLRKVNPEIDWEKGRLSVKPPRVAIEEVPDKEISYSHLAAANTESPIPELPNPEPPAEP # PHVEVPLEATLEESESAVVEEPPIHRIRANHKTRQAWVKAGILEEQTEEVWCATGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERL # PAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLHFIQDYRKLNEYTVKNHYPLPLVADIISW # LQGARYFTKFDVRWGYNNVRIKEGHEWKGAFATTQGLFEPKVMFFGLTNSPATFQALMNAIFADLNAAGKVAVYLDDIFIFSSDLQEHQRVVREVLTR # LEKHDLYLRLEKCEFEQQQIEYLGLYYIGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1013 ### # start gene g1014 Scaffold_7 AUGUSTUS gene 4622674 4623468 1 - . g1014 Scaffold_7 AUGUSTUS transcript 4622674 4623468 1 - . g1014.t1 Scaffold_7 AUGUSTUS stop_codon 4622674 4622676 . - 0 transcript_id "g1014.t1"; gene_id "g1014"; Scaffold_7 AUGUSTUS CDS 4622674 4623468 1 - 0 transcript_id "g1014.t1"; gene_id "g1014"; Scaffold_7 AUGUSTUS start_codon 4623466 4623468 . - 0 transcript_id "g1014.t1"; gene_id "g1014"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAEECSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKSQ # AKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGDWEEFLKEFVQRFESVDPGMKARSEIKNLKQGKGQTVAEFAQKFKDIGDPTGMSDIDLRECFF # TALLPEIQQNLIIVNIAQGLAPTLKEAIKRAISVDVYMHDPTMTGRNSGHAPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1014 ### # start gene g1015 Scaffold_7 AUGUSTUS gene 4625666 4626265 0.98 + . g1015 Scaffold_7 AUGUSTUS transcript 4625666 4626265 0.98 + . g1015.t1 Scaffold_7 AUGUSTUS start_codon 4625666 4625668 . + 0 transcript_id "g1015.t1"; gene_id "g1015"; Scaffold_7 AUGUSTUS CDS 4625666 4626265 0.98 + 0 transcript_id "g1015.t1"; gene_id "g1015"; Scaffold_7 AUGUSTUS stop_codon 4626263 4626265 . + 0 transcript_id "g1015.t1"; gene_id "g1015"; # protein sequence = [MGRRGYRVWIPETRKIEELHDVTFEEGRAHRTREPTKVEDIREDVGGEENAETTGLEPEKSDEVPTITTEDTGSNQQR # QISPEPIQSTEPNRTEVINTPMTTRQSARGHLLSRRYLESAEYSEQEETARSGGEEWSTDTLGTENTLAMITQSPYSFATSSGDLWVPQFYKQAMRYA # DLWREPMETEFKTLMAKQCWELV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1015 ### # start gene g1016 Scaffold_7 AUGUSTUS gene 4626343 4627131 0.72 + . g1016 Scaffold_7 AUGUSTUS transcript 4626343 4627131 0.72 + . g1016.t1 Scaffold_7 AUGUSTUS start_codon 4626343 4626345 . + 0 transcript_id "g1016.t1"; gene_id "g1016"; Scaffold_7 AUGUSTUS CDS 4626343 4627131 0.72 + 0 transcript_id "g1016.t1"; gene_id "g1016"; Scaffold_7 AUGUSTUS stop_codon 4627129 4627131 . + 0 transcript_id "g1016.t1"; gene_id "g1016"; # protein sequence = [MQGMVHGPGYIQIQGQDYDKTYGGVAQMESVRLVLAIIAVLRLLIFQVNFTATFLNSPIMHDIYLKQPEGFVKLGTKH # LVCKLKKSIYGTMQGSHEWQATLAEGYKADRYVMSRADPCIRYWKEGDSYTITSTYGDDVCGGSSTTEGRSKAVSDLGKQWEANKVKSQVLLGMTICQ # DPESKAVTISQKAYFQWMLVHFGLDQVRRRTTPLPPHVKLRESLSPLPEQEAIFMRDKLYCAIVGSILWGQVCTRPDLAFTGSLLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1016 ### # start gene g1017 Scaffold_7 AUGUSTUS gene 4633780 4634418 0.92 + . g1017 Scaffold_7 AUGUSTUS transcript 4633780 4634418 0.92 + . g1017.t1 Scaffold_7 AUGUSTUS start_codon 4633780 4633782 . + 0 transcript_id "g1017.t1"; gene_id "g1017"; Scaffold_7 AUGUSTUS CDS 4633780 4634418 0.92 + 0 transcript_id "g1017.t1"; gene_id "g1017"; Scaffold_7 AUGUSTUS stop_codon 4634416 4634418 . + 0 transcript_id "g1017.t1"; gene_id "g1017"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGLLHRKCWRLGNSPSVTLQCRESPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRNASSRL # TSGDPTTPYHRKHRPRNRSDFERGNQTSHIGGCLPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1017 ### # start gene g1018 Scaffold_7 AUGUSTUS gene 4635744 4636919 0.83 + . g1018 Scaffold_7 AUGUSTUS transcript 4635744 4636919 0.83 + . g1018.t1 Scaffold_7 AUGUSTUS start_codon 4635744 4635746 . + 0 transcript_id "g1018.t1"; gene_id "g1018"; Scaffold_7 AUGUSTUS CDS 4635744 4636919 0.83 + 0 transcript_id "g1018.t1"; gene_id "g1018"; Scaffold_7 AUGUSTUS stop_codon 4636917 4636919 . + 0 transcript_id "g1018.t1"; gene_id "g1018"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAILKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1018 ### # start gene g1019 Scaffold_7 AUGUSTUS gene 4637833 4638678 0.36 + . g1019 Scaffold_7 AUGUSTUS transcript 4637833 4638678 0.36 + . g1019.t1 Scaffold_7 AUGUSTUS start_codon 4637833 4637835 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; Scaffold_7 AUGUSTUS CDS 4637833 4638678 0.36 + 0 transcript_id "g1019.t1"; gene_id "g1019"; Scaffold_7 AUGUSTUS stop_codon 4638676 4638678 . + 0 transcript_id "g1019.t1"; gene_id "g1019"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK # HPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1019 ### # start gene g1020 Scaffold_7 AUGUSTUS gene 4647597 4648396 0.09 + . g1020 Scaffold_7 AUGUSTUS transcript 4647597 4648396 0.09 + . g1020.t1 Scaffold_7 AUGUSTUS start_codon 4647597 4647599 . + 0 transcript_id "g1020.t1"; gene_id "g1020"; Scaffold_7 AUGUSTUS CDS 4647597 4647932 0.09 + 0 transcript_id "g1020.t1"; gene_id "g1020"; Scaffold_7 AUGUSTUS CDS 4647989 4648396 0.88 + 0 transcript_id "g1020.t1"; gene_id "g1020"; Scaffold_7 AUGUSTUS stop_codon 4648394 4648396 . + 0 transcript_id "g1020.t1"; gene_id "g1020"; # protein sequence = [MKNITVDTVTGNAIIEPGNRLGDVALVLNDAGRGLPHGRCTYVGIGGHSGKCHMFWGPGVTTLTSRFSGFGGWGFASR # MWGMTLDNVLSATVVLANGSIVTASEDSNPELYWGIRGSSASFGIVASLEFRTYAVPSSATAFEFIWEMDIPTASNAFMEFQSWALSGNVPLEFGGEI # GFLKGLAYGQVQFAFLGNYFGPADSFNSTIAPFFDKLPIPNTTNVTQGTWIEALTAIAAGNMNTTVLPDTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1020 ### # start gene g1021 Scaffold_7 AUGUSTUS gene 4653295 4654663 0.25 - . g1021 Scaffold_7 AUGUSTUS transcript 4653295 4654663 0.25 - . g1021.t1 Scaffold_7 AUGUSTUS stop_codon 4653295 4653297 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; Scaffold_7 AUGUSTUS CDS 4653295 4653880 0.65 - 1 transcript_id "g1021.t1"; gene_id "g1021"; Scaffold_7 AUGUSTUS CDS 4654051 4654227 0.34 - 1 transcript_id "g1021.t1"; gene_id "g1021"; Scaffold_7 AUGUSTUS CDS 4654557 4654663 0.66 - 0 transcript_id "g1021.t1"; gene_id "g1021"; Scaffold_7 AUGUSTUS start_codon 4654661 4654663 . - 0 transcript_id "g1021.t1"; gene_id "g1021"; # protein sequence = [MLPESQLITGDTKAKAKAQTMVRLIQNSDFWKALARAGLLTLLTCLYNRFFGSEDVAVDIFHNLNDYYNSQGVFSGVK # QLQAVLIDSAIKQVCTITFGNILTKLRNRLGTKTLTMLAELKMHVRDEQLAAQTAKHHLKRHFGQARDEGNEVVQTSATQQPSQPQNPVAGASSHSDD # PDLEVEDEFQELTSSLTAMANDDEISDNLEFPSELSIPLGSLFDFTSKVGLTFIISVLFEVWMKSLNFMSLLMQMEMGVQVLMLLLTKLSIVSVMICT # MYSIVSCNDMYNVNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1021 ### # start gene g1022 Scaffold_7 AUGUSTUS gene 4660633 4660944 0.86 - . g1022 Scaffold_7 AUGUSTUS transcript 4660633 4660944 0.86 - . g1022.t1 Scaffold_7 AUGUSTUS stop_codon 4660633 4660635 . - 0 transcript_id "g1022.t1"; gene_id "g1022"; Scaffold_7 AUGUSTUS CDS 4660633 4660944 0.86 - 0 transcript_id "g1022.t1"; gene_id "g1022"; Scaffold_7 AUGUSTUS start_codon 4660942 4660944 . - 0 transcript_id "g1022.t1"; gene_id "g1022"; # protein sequence = [MVVDISSDRGYNGLLKAVTTDNQSNPADILDDLKESYDTANLDISSNQSSDYLSGLNDAVRDISKGVSEKTAQEYLRY # VLQIVQYGFVNLVYKPHETMSSISD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1022 ### # start gene g1023 Scaffold_7 AUGUSTUS gene 4674745 4675530 0.78 - . g1023 Scaffold_7 AUGUSTUS transcript 4674745 4675530 0.78 - . g1023.t1 Scaffold_7 AUGUSTUS stop_codon 4674745 4674747 . - 0 transcript_id "g1023.t1"; gene_id "g1023"; Scaffold_7 AUGUSTUS CDS 4674745 4675530 0.78 - 0 transcript_id "g1023.t1"; gene_id "g1023"; Scaffold_7 AUGUSTUS start_codon 4675528 4675530 . - 0 transcript_id "g1023.t1"; gene_id "g1023"; # protein sequence = [MSSSRSNAMARSHYSTFDRTSGYRQTVPLSFYPGLSGSIPASRFYHDDNDEPDSRSVVERVVLANENAINSIADLWVA # AALNVEGNDDDGTHIDTSHNIFEFEDGFHVDVHSHRGRSDHPSHLYSTTKSPSRRRSSRRPSTTRPMDASLSVYQSAGGTSTPRQFPSIFTNSGVSTP # HDVFENPACNSETDLTTNLERELPPILESRQPSAMHLNEGETAALLDAGISSPSAPLPWLVITQFGLLALHTTTHDQIFMSYLVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1023 ### # start gene g1024 Scaffold_7 AUGUSTUS gene 4677694 4678396 0.29 - . g1024 Scaffold_7 AUGUSTUS transcript 4677694 4678396 0.29 - . g1024.t1 Scaffold_7 AUGUSTUS stop_codon 4677694 4677696 . - 0 transcript_id "g1024.t1"; gene_id "g1024"; Scaffold_7 AUGUSTUS CDS 4677694 4678149 0.95 - 0 transcript_id "g1024.t1"; gene_id "g1024"; Scaffold_7 AUGUSTUS CDS 4678247 4678396 0.29 - 0 transcript_id "g1024.t1"; gene_id "g1024"; Scaffold_7 AUGUSTUS start_codon 4678394 4678396 . - 0 transcript_id "g1024.t1"; gene_id "g1024"; # protein sequence = [MVVRARAIVPVNATKDEIPPPLAAVSTDAVLTSYHAMKDLRAGETVLVMGNLKRAQTVIAVDLRDEMLQEALEVGADY # AVKPEDLGPLLYSHNLNVDTAYDFVGIGPTFKSVLEHIRPRGTIIIVGLGATCLELPLVPVTRKEVTIKTSMWGTKKELEEVLAILKDKKVRPVIETR # PLVQALEAFEDLRNSKLKGRVVLVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1024 ### # start gene g1025 Scaffold_7 AUGUSTUS gene 4681014 4681484 0.5 + . g1025 Scaffold_7 AUGUSTUS transcript 4681014 4681484 0.5 + . g1025.t1 Scaffold_7 AUGUSTUS start_codon 4681014 4681016 . + 0 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_7 AUGUSTUS CDS 4681014 4681484 0.5 + 0 transcript_id "g1025.t1"; gene_id "g1025"; Scaffold_7 AUGUSTUS stop_codon 4681482 4681484 . + 0 transcript_id "g1025.t1"; gene_id "g1025"; # protein sequence = [MVSGGFLTPGSSPARARYSIEELCVIAEVAHAHGIPVTTHATGVEGIERAIDAGFDCIEHCSWSVGNDLTSILSWSLL # KISCAEGGTKFDEEIAKKLVAQNVAVCPTMNTACMEKDYFCPWDTRETVLKNLTSLREHGVQIVVGTDNGIGKYDVSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1025 ### # start gene g1026 Scaffold_7 AUGUSTUS gene 4689176 4690626 0.43 - . g1026 Scaffold_7 AUGUSTUS transcript 4689176 4690626 0.43 - . g1026.t1 Scaffold_7 AUGUSTUS stop_codon 4689176 4689178 . - 0 transcript_id "g1026.t1"; gene_id "g1026"; Scaffold_7 AUGUSTUS CDS 4689176 4690003 0.69 - 0 transcript_id "g1026.t1"; gene_id "g1026"; Scaffold_7 AUGUSTUS CDS 4690096 4690626 0.65 - 0 transcript_id "g1026.t1"; gene_id "g1026"; Scaffold_7 AUGUSTUS start_codon 4690624 4690626 . - 0 transcript_id "g1026.t1"; gene_id "g1026"; # protein sequence = [MGYPSQYYSASQYGNTATNSNYLPQVDVGQSQHWTQSMPPQSIQDSNYESSPGQARIYYRDQYQYRSDTAGTYHSSSS # SSGHNSYESLPDASSVETSRRQETIENVRRRYNIPDGIPVNLNAIPDPPLGQKPSEKHAKLVHLAIAGSPNLRLSLREIYHAIEERFPYYKNLADKKW # QAEFISTPRPITEPGQGQYWSLNMNMTGDKRVRKRRSRPRHRAESTDSQNEDEAEPDPASPSAESQDSMSSRGGARSSPNITSTTFRHQNRTSPYIAN # DVNLPRPNSRASTSRFRETLRRSDSESNLLTNVESLNIRSTARAIYPQTYMGPPPVQAPYRGTWSSQHSHHAIPPREPAIGYNYPNPPYYSSLPSPVI # QRPSFPMPAMNSYPPIPSAPTRGLMSGPETSSTSGSSSGRMVASQAARPIFIPRAEGSSDSSSDASRSASANAQGKSRAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1026 ### # start gene g1027 Scaffold_7 AUGUSTUS gene 4692434 4693182 1 - . g1027 Scaffold_7 AUGUSTUS transcript 4692434 4693182 1 - . g1027.t1 Scaffold_7 AUGUSTUS stop_codon 4692434 4692436 . - 0 transcript_id "g1027.t1"; gene_id "g1027"; Scaffold_7 AUGUSTUS CDS 4692434 4692619 1 - 0 transcript_id "g1027.t1"; gene_id "g1027"; Scaffold_7 AUGUSTUS CDS 4692718 4693182 1 - 0 transcript_id "g1027.t1"; gene_id "g1027"; Scaffold_7 AUGUSTUS start_codon 4693180 4693182 . - 0 transcript_id "g1027.t1"; gene_id "g1027"; # protein sequence = [MSASSPYSDYFRRRTIGRAASPPTWACYEQIPYDEDYSDSDSEPCSEDDEDYHNASADNEHMNDLEHEQAGHRLPADD # SNDLDMDIDEGTDKIEGIEKETSTEPQKDAKGKQKAIEAEVEAEPPKRHHRRRQRHNTYTLRPILTIQRSQGFVWNQVSSLSDASSNKYPSDVASTSP # PNSSGFISTSVSSTNSALTDYEIEVVEIRVQEGDLEHIIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1027 ### # start gene g1028 Scaffold_7 AUGUSTUS gene 4719853 4720452 0.43 + . g1028 Scaffold_7 AUGUSTUS transcript 4719853 4720452 0.43 + . g1028.t1 Scaffold_7 AUGUSTUS start_codon 4719853 4719855 . + 0 transcript_id "g1028.t1"; gene_id "g1028"; Scaffold_7 AUGUSTUS CDS 4719853 4719900 0.44 + 0 transcript_id "g1028.t1"; gene_id "g1028"; Scaffold_7 AUGUSTUS CDS 4719976 4720452 0.99 + 0 transcript_id "g1028.t1"; gene_id "g1028"; Scaffold_7 AUGUSTUS stop_codon 4720450 4720452 . + 0 transcript_id "g1028.t1"; gene_id "g1028"; # protein sequence = [MLGFIFHRSTQKYLWITELLDTFQTRPHSTSSAASDELGIPVTAPPTPFPTQEIGFRNVAFSWSNDYSGNSDEYQSDL # STPTSTRSKPFERSISSSVTPTSQSPRSIKCQFTLKIPDEIIFQRNTIDLIVGSTGSGKTSLLMALLGEVHFTPQGSGLHQSWFNLPRGRGVAYAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1028 ### # start gene g1029 Scaffold_7 AUGUSTUS gene 4720847 4721503 0.95 + . g1029 Scaffold_7 AUGUSTUS transcript 4720847 4721503 0.95 + . g1029.t1 Scaffold_7 AUGUSTUS start_codon 4720847 4720849 . + 0 transcript_id "g1029.t1"; gene_id "g1029"; Scaffold_7 AUGUSTUS CDS 4720847 4720951 0.99 + 0 transcript_id "g1029.t1"; gene_id "g1029"; Scaffold_7 AUGUSTUS CDS 4721057 4721503 0.96 + 0 transcript_id "g1029.t1"; gene_id "g1029"; Scaffold_7 AUGUSTUS stop_codon 4721501 4721503 . + 0 transcript_id "g1029.t1"; gene_id "g1029"; # protein sequence = [MLLTVFLVSSVHTSKWIVENCFKGDLVKDRTILLVTHNTFLTHPIAGYVVSLKDGQVAKQGTVAEVLGVSEIEQVVGS # SAENVENVETIETIEQIEDEIAGNHDGSGGSNGESDGTKSKKSPPVNGQGKRIVAEEIQIGNVGWPDGLFHTLVGLWLKFPVTVTTVSQLRVQIQRCN # FHQSAPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1029 ### # start gene g1030 Scaffold_7 AUGUSTUS gene 4725206 4725865 0.73 - . g1030 Scaffold_7 AUGUSTUS transcript 4725206 4725865 0.73 - . g1030.t1 Scaffold_7 AUGUSTUS stop_codon 4725206 4725208 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; Scaffold_7 AUGUSTUS CDS 4725206 4725865 0.73 - 0 transcript_id "g1030.t1"; gene_id "g1030"; Scaffold_7 AUGUSTUS start_codon 4725863 4725865 . - 0 transcript_id "g1030.t1"; gene_id "g1030"; # protein sequence = [MSEGYKSALFWTPVGKTWSRIEQAKNFTYGIFKILYVKSQRRLRIESLSILYVKWTSGLTVDSIELTVYDDVELTVYD # NDDELTVYDDVELTVYDDDDELTVYDDVKLTVYDNDDELTVYDDVKLTVYDNDDELTVYDNIELTVYDNDDELTVYDNIELTVYDNDDELTVYDDVKL # TVYNSNDKLTVSDNIELTVYDDDNKLTVYDNIELTVYNSNNKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1030 ### # start gene g1031 Scaffold_7 AUGUSTUS gene 4832556 4834325 0.23 + . g1031 Scaffold_7 AUGUSTUS transcript 4832556 4834325 0.23 + . g1031.t1 Scaffold_7 AUGUSTUS start_codon 4832556 4832558 . + 0 transcript_id "g1031.t1"; gene_id "g1031"; Scaffold_7 AUGUSTUS CDS 4832556 4834325 0.23 + 0 transcript_id "g1031.t1"; gene_id "g1031"; Scaffold_7 AUGUSTUS stop_codon 4834323 4834325 . + 0 transcript_id "g1031.t1"; gene_id "g1031"; # protein sequence = [MGAIDGSYDMIVIARTGSGKTMIPIIASLAAPHKIIIVAIPLRSLIHDYQRRLAQWQVPYQLVTSDSSEILPHSSLVL # VSADFAVHPSFRASVKHAHQSKPVGAFVFDEGQLVVTDSDFRDKLRNAMEIRCVNAPVIVATGTAPPIAVPIIAERFGLVEPYLVVRGPTDRPEIKLV # IEEQRSMGAITQRTLELVQKYISTFATKDRALIFVQNIQYGKDLAKALTCELYSGSQQDTPDRLGTYTRWIEGNNIVMVATSAFYAGNDYPHIRLAIF # AGTPGDMTGTIQGATRIARDHQLGTCILLPQKNAKGHLTKVGEVDYAGAKSILQLCNNSPKVCLRSQFTGWCDGYSILCKDSINPTHGTPTSTNSTSS # WCSNCLDLQSIQLPNWYKPPSSSLMPSSQHILIVGDTANSSPSSSKFTAAVHSIDKRRNEHSQTLDPLLHSFQRAFYLLKDKCTCCQSHKHALSACPK # VDQVQLKYLSRNIHYPSPSSESKKQWGSICYSCHLPQLPGDVLHPAFSKGGLLCEHLDFMLGLCLKIVTSHILLGKAITDLGLDSDNLHTWLATRPSS # HAAKYVSNFVRLIVWYIDNYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1031 ### # start gene g1032 Scaffold_7 AUGUSTUS gene 4834676 4836826 0.12 + . g1032 Scaffold_7 AUGUSTUS transcript 4834676 4836826 0.12 + . g1032.t1 Scaffold_7 AUGUSTUS start_codon 4834676 4834678 . + 0 transcript_id "g1032.t1"; gene_id "g1032"; Scaffold_7 AUGUSTUS CDS 4834676 4835161 0.86 + 0 transcript_id "g1032.t1"; gene_id "g1032"; Scaffold_7 AUGUSTUS CDS 4835320 4835358 0.57 + 0 transcript_id "g1032.t1"; gene_id "g1032"; Scaffold_7 AUGUSTUS CDS 4835946 4836167 0.18 + 0 transcript_id "g1032.t1"; gene_id "g1032"; Scaffold_7 AUGUSTUS CDS 4836275 4836826 0.81 + 0 transcript_id "g1032.t1"; gene_id "g1032"; Scaffold_7 AUGUSTUS stop_codon 4836824 4836826 . + 0 transcript_id "g1032.t1"; gene_id "g1032"; # protein sequence = [MSIKSLAVNLFDQNSSQVVDGRLQHLTPLSPTQQFLQRRKAIGKGSQNKNNNKDGDEDEEEEDEEEVEEEYEDESESK # GKDKGDDEDEDEDEEEDDDGADADADTDDDDELDEVVVEVEVQHVVENKGKDAHKKHDEAEDLREERRMRLRSLISQSLGPLATEDQASHESESNGKS # APIIQPEVKADILFFACNYLCLFSFFFFNKSISAKDVKKLAKKQAKKDKQIEEEAALDDFMRRLTTTSVSDHYDINTSLTTNFSEGNNLDAYYLGMAD # APILFDDFDGTGPQLKPLNKQRQLNPTTIQLISSSPTLYIHEYPLAVMIYPEAIHLSSLIQSYVPNQPVPLVQFTGENSAGPALLAAGNHRRASLGPF # LDLQDPVNRPWATYKQAMEKLQHCSEEEDTAEFSKQVNLLQGKLRTVGIWGVKFYDYSKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1032 ### # start gene g1033 Scaffold_7 AUGUSTUS gene 4836916 4839360 0.92 + . g1033 Scaffold_7 AUGUSTUS transcript 4836916 4839360 0.92 + . g1033.t1 Scaffold_7 AUGUSTUS start_codon 4836916 4836918 . + 0 transcript_id "g1033.t1"; gene_id "g1033"; Scaffold_7 AUGUSTUS CDS 4836916 4839360 0.92 + 0 transcript_id "g1033.t1"; gene_id "g1033"; Scaffold_7 AUGUSTUS stop_codon 4839358 4839360 . + 0 transcript_id "g1033.t1"; gene_id "g1033"; # protein sequence = [MNDKAAGHTILFQISDNNAMPQKPETDEELFEKLVDFLRQAQSPDDFKGLLKTALALTNKAPKIRALLQNHSKVMASY # ALHTSLPSLRSVNFTLDSLAAAAPIKWAYLAPVLNHSLISLRFLFDSNLSLKDIPMSHFYPASQHSHGKSSLSPEEEDHLDAVNDSISQYQRYFGDFK # SLYGDALMYWKPQGNFGKFISRFVTEVAEPAYSLTFEDNGGLKDWNGLYGTSTINDPFQEYMEENNLSFDKLLLPNHHQWDTLYSIYQAHVLKLFTQL # TRDWKSQGLLLSSQEKAIINSLPVRFSFLCRHSPVPPASGLNLIATPILCPSVFHALAEQLDDLTPGLQMISHLFVPGVHLSLSKTNVGSDSEPNPIR # TYQDAVVHTLAYNYKRSLATWKMDTEPLNYDAVLYYWYRLVDITLIFRHTLRCYANDIGKILQILKTPEPHPAYGSNHFIFRSHQEAFYHFMDTLRKH # VKKDASAAFKIPQNRVPPNPERFVDVIQLHDHAMKLDSPSQSLVEFLPFLPWNYCLSNNKRHLDSKLFELTAELYIMDSHWKPLLQHRSLAHFLEQIP # IHLAFGQVPLIAMQLWCSPIDPRDVVDDKRSAEQLQAGVTYPEASYLADRQSARSMALKETSTFLSNILKSALKPQNGGLVVMRHGSRKKIAVIDPTV # HEAFLRFAHTMLAQTYHTASAALGLVDDIPTSIRFAQQMAAFITDNQDAIGDTLDTSHQATDQEIRLYNDTIYMEADRASDGLWVGTESFDIEEKAFL # KTRAVDLAVGWKRRKSKLPRITENVHDHPLTVKRRILMRTLAWMLMMMMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1033 ### # start gene g1034 Scaffold_7 AUGUSTUS gene 4841258 4841506 0.57 + . g1034 Scaffold_7 AUGUSTUS transcript 4841258 4841506 0.57 + . g1034.t1 Scaffold_7 AUGUSTUS start_codon 4841258 4841260 . + 0 transcript_id "g1034.t1"; gene_id "g1034"; Scaffold_7 AUGUSTUS CDS 4841258 4841506 0.57 + 0 transcript_id "g1034.t1"; gene_id "g1034"; Scaffold_7 AUGUSTUS stop_codon 4841504 4841506 . + 0 transcript_id "g1034.t1"; gene_id "g1034"; # protein sequence = [MKSAFRNNLCHWLLPILQDPDMLYEAYKANEQTELEEEEDDDSTDGGIEDDTLEENWDQDWEETWEEEEERWDGGELW # EDEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1034 ### # start gene g1035 Scaffold_7 AUGUSTUS gene 4890308 4890700 0.69 - . g1035 Scaffold_7 AUGUSTUS transcript 4890308 4890700 0.69 - . g1035.t1 Scaffold_7 AUGUSTUS stop_codon 4890308 4890310 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; Scaffold_7 AUGUSTUS CDS 4890308 4890700 0.69 - 0 transcript_id "g1035.t1"; gene_id "g1035"; Scaffold_7 AUGUSTUS start_codon 4890698 4890700 . - 0 transcript_id "g1035.t1"; gene_id "g1035"; # protein sequence = [MERFTYQAPPQDRCATVIFCIIPRVHSLYVYPFRLGAHVTFLGSSLTSSTQFLKFAHLDLESALRDDIRARVEVEIWA # VALDERIEFEDEEEKIIVPPSISLSSITSLDAASITSNTPIDTPHKPPSTTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1035 ### # start gene g1036 Scaffold_7 AUGUSTUS gene 4892684 4892998 0.62 + . g1036 Scaffold_7 AUGUSTUS transcript 4892684 4892998 0.62 + . g1036.t1 Scaffold_7 AUGUSTUS start_codon 4892684 4892686 . + 0 transcript_id "g1036.t1"; gene_id "g1036"; Scaffold_7 AUGUSTUS CDS 4892684 4892998 0.62 + 0 transcript_id "g1036.t1"; gene_id "g1036"; Scaffold_7 AUGUSTUS stop_codon 4892996 4892998 . + 0 transcript_id "g1036.t1"; gene_id "g1036"; # protein sequence = [MTVKGTQALILAPTRELAQQIQKVVVALGDYMNIECHACVGGTNVREDMAKLQEGVQVVVGTPGRVFDMINRRALKTD # TIKIFCLDEADEMLSRGFKDQIYEGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1036 ### # start gene g1037 Scaffold_7 AUGUSTUS gene 4893145 4893768 0.4 + . g1037 Scaffold_7 AUGUSTUS transcript 4893145 4893768 0.4 + . g1037.t1 Scaffold_7 AUGUSTUS start_codon 4893145 4893147 . + 0 transcript_id "g1037.t1"; gene_id "g1037"; Scaffold_7 AUGUSTUS CDS 4893145 4893405 0.4 + 0 transcript_id "g1037.t1"; gene_id "g1037"; Scaffold_7 AUGUSTUS CDS 4893487 4893768 0.97 + 0 transcript_id "g1037.t1"; gene_id "g1037"; Scaffold_7 AUGUSTUS stop_codon 4893766 4893768 . + 0 transcript_id "g1037.t1"; gene_id "g1037"; # protein sequence = [MPADVLEVTKKFMRDPVRILVKRDELTLEGIKQFYIAVEKEEWKLDTLCDLYETVTITQAVIFCNTRRKVDWLTEKMH # SREFTVSAMKQREVLMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTTDDVRMLRDIERESWALPLL # SYGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1037 ### # start gene g1038 Scaffold_7 AUGUSTUS gene 4913040 4913515 0.52 + . g1038 Scaffold_7 AUGUSTUS transcript 4913040 4913515 0.52 + . g1038.t1 Scaffold_7 AUGUSTUS start_codon 4913040 4913042 . + 0 transcript_id "g1038.t1"; gene_id "g1038"; Scaffold_7 AUGUSTUS CDS 4913040 4913205 0.55 + 0 transcript_id "g1038.t1"; gene_id "g1038"; Scaffold_7 AUGUSTUS CDS 4913280 4913515 0.54 + 2 transcript_id "g1038.t1"; gene_id "g1038"; Scaffold_7 AUGUSTUS stop_codon 4913513 4913515 . + 0 transcript_id "g1038.t1"; gene_id "g1038"; # protein sequence = [MALKSKNTGSQEEYRGMPGGMVSIFHIPDPTLSLDFVVPYSAPNLSLTLNFFRSCTLTPVDPPPPQEPPAPASPAWRT # VHKRAERKPRTKKATGIPQSIPSPSQVPPLEIPKPNVPAWAQWRRECFIPFLFVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1038 ### # start gene g1039 Scaffold_7 AUGUSTUS gene 4915416 4916550 0.45 + . g1039 Scaffold_7 AUGUSTUS transcript 4915416 4916550 0.45 + . g1039.t1 Scaffold_7 AUGUSTUS start_codon 4915416 4915418 . + 0 transcript_id "g1039.t1"; gene_id "g1039"; Scaffold_7 AUGUSTUS CDS 4915416 4915813 0.45 + 0 transcript_id "g1039.t1"; gene_id "g1039"; Scaffold_7 AUGUSTUS CDS 4915872 4916550 0.94 + 1 transcript_id "g1039.t1"; gene_id "g1039"; Scaffold_7 AUGUSTUS stop_codon 4916548 4916550 . + 0 transcript_id "g1039.t1"; gene_id "g1039"; # protein sequence = [MEYAIWIAGEGYIDTANIVIEALCVHYPNDFPKQRTPCAWGFEFLWHKSRRRPAYIEPFWGAPPDDATLWAAYSDIQQ # PYPQTNVEKARALVVADAKILVGNLNFHTYNVNICAEVALEMGMKAKAEDYFDHSIRLLQAEGNPVSLWRELMRSFPLADMILSGRARKITGTTPEEA # MQRAKTIVQEIEQWRSTHAKRVAAARDRRAHLRALPLKDLLNQIGKDLCKDPASQSNIEAAEERLKITLPASYTEFLLLSDGMDFIPSINMPGLRSVT # ELKWESAEDLGLDEVPVDLGLAIPSLEDSAMEVPKLGRVLMISQEADDEYLWLLEPSQVENAWNVLRQDGVKASGWRFVLDGLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1039 ### # start gene g1040 Scaffold_7 AUGUSTUS gene 4959066 4959413 0.63 - . g1040 Scaffold_7 AUGUSTUS transcript 4959066 4959413 0.63 - . g1040.t1 Scaffold_7 AUGUSTUS stop_codon 4959066 4959068 . - 0 transcript_id "g1040.t1"; gene_id "g1040"; Scaffold_7 AUGUSTUS CDS 4959066 4959413 0.63 - 0 transcript_id "g1040.t1"; gene_id "g1040"; Scaffold_7 AUGUSTUS start_codon 4959411 4959413 . - 0 transcript_id "g1040.t1"; gene_id "g1040"; # protein sequence = [MEECSSSKSSINKPEVFKGKDSSEAHHFMAQFQNWASEQPHLAKSQVNLIKSALGFFTESTGDWATPHLLHFSAENPP # FGGNWDTFLKEFGQWFESMDPGMEARSEIKNLRQSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1040 ### # start gene g1041 Scaffold_7 AUGUSTUS gene 4963653 4964003 0.56 - . g1041 Scaffold_7 AUGUSTUS transcript 4963653 4964003 0.56 - . g1041.t1 Scaffold_7 AUGUSTUS stop_codon 4963653 4963655 . - 0 transcript_id "g1041.t1"; gene_id "g1041"; Scaffold_7 AUGUSTUS CDS 4963653 4964003 0.56 - 0 transcript_id "g1041.t1"; gene_id "g1041"; Scaffold_7 AUGUSTUS start_codon 4964001 4964003 . - 0 transcript_id "g1041.t1"; gene_id "g1041"; # protein sequence = [MSSKTAHTEKPPAVTVDAEDIWKQSAKTSSWDSDETEADASNLDANRYPLRDPRHSPYSQMNPSRSLLDPNICSCTVA # ATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1041 ### # start gene g1042 Scaffold_7 AUGUSTUS gene 4966183 4966566 0.92 - . g1042 Scaffold_7 AUGUSTUS transcript 4966183 4966566 0.92 - . g1042.t1 Scaffold_7 AUGUSTUS stop_codon 4966183 4966185 . - 0 transcript_id "g1042.t1"; gene_id "g1042"; Scaffold_7 AUGUSTUS CDS 4966183 4966566 0.92 - 0 transcript_id "g1042.t1"; gene_id "g1042"; Scaffold_7 AUGUSTUS start_codon 4966564 4966566 . - 0 transcript_id "g1042.t1"; gene_id "g1042"; # protein sequence = [MSATSMEQPSSSKLKLKKQKSALSRGNMTQAQKLNQAASFTAITVVAGQRLMSIPEQSFRDEPSSNVRTPEGRQPAVQ # EPPPVDPGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1042 ### # start gene g1043 Scaffold_7 AUGUSTUS gene 4969847 4970308 0.62 + . g1043 Scaffold_7 AUGUSTUS transcript 4969847 4970308 0.62 + . g1043.t1 Scaffold_7 AUGUSTUS start_codon 4969847 4969849 . + 0 transcript_id "g1043.t1"; gene_id "g1043"; Scaffold_7 AUGUSTUS CDS 4969847 4970308 0.62 + 0 transcript_id "g1043.t1"; gene_id "g1043"; Scaffold_7 AUGUSTUS stop_codon 4970306 4970308 . + 0 transcript_id "g1043.t1"; gene_id "g1043"; # protein sequence = [MNEKGVPTYFEHSSRGASSTIDLTFVNPVAHALDAAKEWTVDAKSSCGSNHHALRWVVDYGAEEVENVLGVKYNFKKT # DPTEWKLALSRELQNHKECWEVVQKLDQPRMAAELDEDVNILTDTLKVATVLRSCTPCNRARGHKVSKSGGRVGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1043 ### # start gene g1044 Scaffold_7 AUGUSTUS gene 4972068 4972586 0.85 + . g1044 Scaffold_7 AUGUSTUS transcript 4972068 4972586 0.85 + . g1044.t1 Scaffold_7 AUGUSTUS start_codon 4972068 4972070 . + 0 transcript_id "g1044.t1"; gene_id "g1044"; Scaffold_7 AUGUSTUS CDS 4972068 4972586 0.85 + 0 transcript_id "g1044.t1"; gene_id "g1044"; Scaffold_7 AUGUSTUS stop_codon 4972584 4972586 . + 0 transcript_id "g1044.t1"; gene_id "g1044"; # protein sequence = [MLTSRTTTTTQPAASTSSRPADPPSPGAPFDEDEDEIIREAQARVERVKARKAAEAVKKKAAEEVAARKAAEEAEKKK # RAAAARRQAAQDARDRATRAQEQEDGVVERRRKLVAAATARSQGGTSTGEASASPRRPIVEIPRVKSKGKAKAQVRFLSLSWSVLLMYFFPARW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1044 ### # start gene g1045 Scaffold_7 AUGUSTUS gene 4974153 4976307 0.08 - . g1045 Scaffold_7 AUGUSTUS transcript 4974153 4976307 0.08 - . g1045.t1 Scaffold_7 AUGUSTUS stop_codon 4974153 4974155 . - 0 transcript_id "g1045.t1"; gene_id "g1045"; Scaffold_7 AUGUSTUS CDS 4974153 4975037 0.32 - 0 transcript_id "g1045.t1"; gene_id "g1045"; Scaffold_7 AUGUSTUS CDS 4975780 4976307 0.54 - 0 transcript_id "g1045.t1"; gene_id "g1045"; Scaffold_7 AUGUSTUS start_codon 4976305 4976307 . - 0 transcript_id "g1045.t1"; gene_id "g1045"; # protein sequence = [MPFSLTNAPAAFQCFVNNIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRCLRKHRLYANPDKCKFNMDTVEYL # GYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRCFIYNYRDIVVPMTRLTRKGAPWIWDNDCQEAFENLKIAFTSAPILAHWEPNRPII # HGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTEHVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYH # RNITIRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHLKFPIGSEVFVLIKHIRSTHPTEKFSEKYLGPFKVISQPGTFSYEL # KLPDYLCRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLVLRSCTPGNRAKATGCLSAEDEWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1045 ### # start gene g1046 Scaffold_7 AUGUSTUS gene 4977658 4978411 0.6 - . g1046 Scaffold_7 AUGUSTUS transcript 4977658 4978411 0.6 - . g1046.t1 Scaffold_7 AUGUSTUS stop_codon 4977658 4977660 . - 0 transcript_id "g1046.t1"; gene_id "g1046"; Scaffold_7 AUGUSTUS CDS 4977658 4977958 0.61 - 1 transcript_id "g1046.t1"; gene_id "g1046"; Scaffold_7 AUGUSTUS CDS 4978095 4978411 0.89 - 0 transcript_id "g1046.t1"; gene_id "g1046"; Scaffold_7 AUGUSTUS start_codon 4978409 4978411 . - 0 transcript_id "g1046.t1"; gene_id "g1046"; # protein sequence = [MANIAVRFPSGKLLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTLHFDSPQTSVPSATNTVDAKVAV # PLPEPSPSVSPTILETPPGDSPRSRSRTACKDAGMEPILLRAIHSEVAARAADRSSTAPTVPPLPHSIPAEYAEFADVFNEIAADALPEHRPYDLKID # LEEGASPPLSRIYPLSEKELVALKDFIDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1046 ### # start gene g1047 Scaffold_7 AUGUSTUS gene 4979482 4980576 0.68 + . g1047 Scaffold_7 AUGUSTUS transcript 4979482 4980576 0.68 + . g1047.t1 Scaffold_7 AUGUSTUS start_codon 4979482 4979484 . + 0 transcript_id "g1047.t1"; gene_id "g1047"; Scaffold_7 AUGUSTUS CDS 4979482 4979943 0.68 + 0 transcript_id "g1047.t1"; gene_id "g1047"; Scaffold_7 AUGUSTUS CDS 4979995 4980576 0.69 + 0 transcript_id "g1047.t1"; gene_id "g1047"; Scaffold_7 AUGUSTUS stop_codon 4980574 4980576 . + 0 transcript_id "g1047.t1"; gene_id "g1047"; # protein sequence = [MSASRTITTTTSATAGPSRSRPVPPPPPPASDSAAQEEEGLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEAQERAKRARQQEEEVVERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEPVGGDPDDGDEGDDDDDDDKEP # CERCRAKKISCQMQAGKRSSIICKPCHDAKVRCSYSGRPSTVKREGGSNPTGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTDAA # RRRRTPPELPQAGPSELPKKRRRVMDSDEEEERGREQEMEEDGEGEEEEGGGMEVEGEVEAPAPTAKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1047 ### # start gene g1048 Scaffold_7 AUGUSTUS gene 4980945 4982618 0.62 - . g1048 Scaffold_7 AUGUSTUS transcript 4980945 4982618 0.62 - . g1048.t1 Scaffold_7 AUGUSTUS stop_codon 4980945 4980947 . - 0 transcript_id "g1048.t1"; gene_id "g1048"; Scaffold_7 AUGUSTUS CDS 4980945 4982618 0.62 - 0 transcript_id "g1048.t1"; gene_id "g1048"; Scaffold_7 AUGUSTUS start_codon 4982616 4982618 . - 0 transcript_id "g1048.t1"; gene_id "g1048"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAI # ILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGR # NKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFF # RALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFV # VNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEP # VTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1048 ### # start gene g1049 Scaffold_7 AUGUSTUS gene 4985529 4987544 0.53 - . g1049 Scaffold_7 AUGUSTUS transcript 4985529 4987544 0.53 - . g1049.t1 Scaffold_7 AUGUSTUS stop_codon 4985529 4985531 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; Scaffold_7 AUGUSTUS CDS 4985529 4986168 0.98 - 1 transcript_id "g1049.t1"; gene_id "g1049"; Scaffold_7 AUGUSTUS CDS 4987438 4987544 0.53 - 0 transcript_id "g1049.t1"; gene_id "g1049"; Scaffold_7 AUGUSTUS start_codon 4987542 4987544 . - 0 transcript_id "g1049.t1"; gene_id "g1049"; # protein sequence = [MLGSTLCMNSSFGISQWSIGLPLGLTLAFSSKITDFHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPD # DPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGVLVDLVDLVLQSPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEP # EVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1049 ### # start gene g1050 Scaffold_7 AUGUSTUS gene 4993044 4994735 0.63 + . g1050 Scaffold_7 AUGUSTUS transcript 4993044 4994735 0.63 + . g1050.t1 Scaffold_7 AUGUSTUS start_codon 4993044 4993046 . + 0 transcript_id "g1050.t1"; gene_id "g1050"; Scaffold_7 AUGUSTUS CDS 4993044 4993701 0.63 + 0 transcript_id "g1050.t1"; gene_id "g1050"; Scaffold_7 AUGUSTUS CDS 4993924 4994735 0.99 + 2 transcript_id "g1050.t1"; gene_id "g1050"; Scaffold_7 AUGUSTUS stop_codon 4994733 4994735 . + 0 transcript_id "g1050.t1"; gene_id "g1050"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDNDAGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSVGQPKNGLSLISSDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLK # MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFIARNPKKGSSDFKTGS # TNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAA # EVEETPEATIEVVEEDSEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1050 ### # start gene g1051 Scaffold_7 AUGUSTUS gene 4995286 4997255 0.91 + . g1051 Scaffold_7 AUGUSTUS transcript 4995286 4997255 0.91 + . g1051.t1 Scaffold_7 AUGUSTUS start_codon 4995286 4995288 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; Scaffold_7 AUGUSTUS CDS 4995286 4995880 0.97 + 0 transcript_id "g1051.t1"; gene_id "g1051"; Scaffold_7 AUGUSTUS CDS 4995958 4997255 0.93 + 2 transcript_id "g1051.t1"; gene_id "g1051"; Scaffold_7 AUGUSTUS stop_codon 4997253 4997255 . + 0 transcript_id "g1051.t1"; gene_id "g1051"; # protein sequence = [MQKVAVPLPELSPSVSPTILETPPGDSLRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSA # AVFNRACKDAGMEPILLRAIHSEVVARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVAL # KDFIDKQLATGAIPIILSSRRSGSLPTPTHIRSLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIF # SDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANF # YRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKCFHFCADTGPLGAESPTYRGTDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYD # THDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPH # NFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQLSFSLSRRSELRCCWFGTCKRSFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1051 ### # start gene g1052 Scaffold_7 AUGUSTUS gene 4997592 4998695 1 + . g1052 Scaffold_7 AUGUSTUS transcript 4997592 4998695 1 + . g1052.t1 Scaffold_7 AUGUSTUS start_codon 4997592 4997594 . + 0 transcript_id "g1052.t1"; gene_id "g1052"; Scaffold_7 AUGUSTUS CDS 4997592 4998695 1 + 0 transcript_id "g1052.t1"; gene_id "g1052"; Scaffold_7 AUGUSTUS stop_codon 4998693 4998695 . + 0 transcript_id "g1052.t1"; gene_id "g1052"; # protein sequence = [MAYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSG # YIRKPMGKLSVSIRLSNSTSGSIVPTNKMTGRLYFRSPSSPITTLPMLPLVLLHSSLTKDTTQITVRPEVDMKSDLARDFVVNLDELHVFLREEILLA # QSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPI # EVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELYPHSTPIPFETWTLITQNHFIPFPVFRRAPPKFTLCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1052 ### # start gene g1053 Scaffold_7 AUGUSTUS gene 5002757 5003617 1 - . g1053 Scaffold_7 AUGUSTUS transcript 5002757 5003617 1 - . g1053.t1 Scaffold_7 AUGUSTUS stop_codon 5002757 5002759 . - 0 transcript_id "g1053.t1"; gene_id "g1053"; Scaffold_7 AUGUSTUS CDS 5002757 5003617 1 - 0 transcript_id "g1053.t1"; gene_id "g1053"; Scaffold_7 AUGUSTUS start_codon 5003615 5003617 . - 0 transcript_id "g1053.t1"; gene_id "g1053"; # protein sequence = [MRLKGPQSYPSLATHQPRSYPSPPARGPRRYLPNNDFQNSRRSSIPSGLDESVLPSPPAASPEPEDELDEDDLNEQQV # EDAHASVYHRIFRKSPLHERGVGDGQGVIDGDEESDEEEEHEGSNENVGANLRLRIFASQMNLFNSCVKLPSRTVDLTNDNRRLRNPIEGPPDELDPD # TRLSIDLYLSITHASEATYSSVRNAILLRFPETNILSYHCVKSFIADTTGVISVYSDMCVNSCHAFTGPWTDLEHCFYCNEPRYDLDQLRRTGDKVPR # LQCSTNPPWSHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1053 ### # start gene g1054 Scaffold_7 AUGUSTUS gene 5008285 5010630 0.09 + . g1054 Scaffold_7 AUGUSTUS transcript 5008285 5010630 0.09 + . g1054.t1 Scaffold_7 AUGUSTUS start_codon 5008285 5008287 . + 0 transcript_id "g1054.t1"; gene_id "g1054"; Scaffold_7 AUGUSTUS CDS 5008285 5008879 0.19 + 0 transcript_id "g1054.t1"; gene_id "g1054"; Scaffold_7 AUGUSTUS CDS 5009190 5009715 0.21 + 2 transcript_id "g1054.t1"; gene_id "g1054"; Scaffold_7 AUGUSTUS CDS 5009760 5010630 0.96 + 1 transcript_id "g1054.t1"; gene_id "g1054"; Scaffold_7 AUGUSTUS stop_codon 5010628 5010630 . + 0 transcript_id "g1054.t1"; gene_id "g1054"; # protein sequence = [MSSPLSSASAASRAIRRDPDLEPDEQWKENLKAEIERNLTSMVKDAETQLKENLEKNPDDSERLRREFSVAMDNIRKL # ATEAFKEELERERHQRRWATGHELPPDLAETMKKEQQAILDQIQSGKSSNALGSNDGPIVSSVQENTIVSRSVAPPQSNHVYTDCNHQDSLNRRSSTS # SVSLNMNPTPPHNVLNGIKEPHXSTSTGSRRPTIVDTIPEIRPVVNSNSDISTKVEQERVRTQEVDQAWRDLDAAKERQLGRRRTLDNMKGPSSSSSA # VYVNDPPGTSPTTSNIVSSSPSKTRPPPPPLETKPIYRKASFVQENPAQLYRKTSFVHEAGPRNFDKVPIRTRSTQSHLSLSRPTEPTELYSNGERYS # RRNGRTYSQTPPVSATLAYAQAAEGYNPAYPGSASYIGSTSPLTDQDTDSRIRSRRPSNDPRYIPAPSSVGPVSSPNVQYSPYQGTPSYSSPPPSHPY # SSPSSRPFPQQQAPYSASPYSASHFSSQYPPYQSPSMYTTRTSDDVDATSYGNGSSHQQRAWSGNGPMAAPMSALPDTRHHSMRSSSASQEGWRLWSQ # HHPSQPQSLHSSMSNNNLREGKMPDRNQPVPTYTNDLVDDPEGSEEGSETMTDSESEDSHHQPTSTLSSSTSFSSPRHPIPYPTPNQARNYSEAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1054 ### # start gene g1055 Scaffold_7 AUGUSTUS gene 5010687 5011310 0.67 + . g1055 Scaffold_7 AUGUSTUS transcript 5010687 5011310 0.67 + . g1055.t1 Scaffold_7 AUGUSTUS start_codon 5010687 5010689 . + 0 transcript_id "g1055.t1"; gene_id "g1055"; Scaffold_7 AUGUSTUS CDS 5010687 5011310 0.67 + 0 transcript_id "g1055.t1"; gene_id "g1055"; Scaffold_7 AUGUSTUS stop_codon 5011308 5011310 . + 0 transcript_id "g1055.t1"; gene_id "g1055"; # protein sequence = [MRAAEAAKAVETEEARKKELARQAEFSRVEEAKIREESMQREAARAAEEARKQKLADEEEEAARRRKEQEAQRKKEAE # MKRKESARRKEEEKRKREEEERNKAEEKRREEEQRKRAEDEAKRKEEEDIRIRKIEEEEARLAQAKEEARIEEERRERLRRDEDELRRREDEIREERG # GTSTQVNGREAKGIRAPRKRSPSQRGGGEEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1055 ### # start gene g1056 Scaffold_7 AUGUSTUS gene 5011991 5012859 0.29 + . g1056 Scaffold_7 AUGUSTUS transcript 5011991 5012859 0.29 + . g1056.t1 Scaffold_7 AUGUSTUS start_codon 5011991 5011993 . + 0 transcript_id "g1056.t1"; gene_id "g1056"; Scaffold_7 AUGUSTUS CDS 5011991 5012575 0.29 + 0 transcript_id "g1056.t1"; gene_id "g1056"; Scaffold_7 AUGUSTUS CDS 5012617 5012859 0.84 + 0 transcript_id "g1056.t1"; gene_id "g1056"; Scaffold_7 AUGUSTUS stop_codon 5012857 5012859 . + 0 transcript_id "g1056.t1"; gene_id "g1056"; # protein sequence = [MAQQEEFRRREEEIRNRKRQDSAAAWENWTGSTSPGYQSQPNTPLSSANANGGTNTAQRSNSTTSASASGWSTNPAWS # KTRSTSSSASASASHTSNPPPSSASSIPTPKPRSGSTGAAGSTSSSATPITEEQWQRRHEEQFQAQQARFRQEQERKERERMAKSSQVKGPDELIKTF # EHHARLWEKLPEYTELRWDDITYAAVYAYLSSPYHPEKDKPQKDRIKEQIRRWHPDRFETKLLPKVIEEDKVKVKEGAGSVVRNLNSLLTKSNTPSFF # D] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1056 ### # start gene g1057 Scaffold_7 AUGUSTUS gene 5015304 5016911 0.61 + . g1057 Scaffold_7 AUGUSTUS transcript 5015304 5016911 0.61 + . g1057.t1 Scaffold_7 AUGUSTUS start_codon 5015304 5015306 . + 0 transcript_id "g1057.t1"; gene_id "g1057"; Scaffold_7 AUGUSTUS CDS 5015304 5015774 0.69 + 0 transcript_id "g1057.t1"; gene_id "g1057"; Scaffold_7 AUGUSTUS CDS 5016070 5016107 0.67 + 0 transcript_id "g1057.t1"; gene_id "g1057"; Scaffold_7 AUGUSTUS CDS 5016512 5016911 0.69 + 1 transcript_id "g1057.t1"; gene_id "g1057"; Scaffold_7 AUGUSTUS stop_codon 5016909 5016911 . + 0 transcript_id "g1057.t1"; gene_id "g1057"; # protein sequence = [MINQQHQVSTFSELGLSEPLLKTLEQLNFTKPTPIQIECIPPGIEGRDIIGIAPTGSGKTAAFVLPVLNHLWDNPQGM # FACVLAPTRELAYQIASQIDALGSAMGARTAVIVGGDEDRVKQAVMLARKPHIVVATPGRLLDHLKVTKGFNLRNIKFLLTPSCNTTFFAHCGLDIPS # VDVVINYDCPTHSKDYIHRVGRTARAGRSGKSILMASQYDIEFVQRLEKVLDKKLDLYPHDPEEAHLLRERVDEAGRVAANQLREDKRTKGDARKRRK # PLSSGDRDGEEDLDEVNRFAMKKKKRKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1057 ### # start gene g1058 Scaffold_7 AUGUSTUS gene 5017301 5019760 0.42 - . g1058 Scaffold_7 AUGUSTUS transcript 5017301 5019760 0.42 - . g1058.t1 Scaffold_7 AUGUSTUS stop_codon 5017301 5017303 . - 0 transcript_id "g1058.t1"; gene_id "g1058"; Scaffold_7 AUGUSTUS CDS 5017301 5019631 0.53 - 0 transcript_id "g1058.t1"; gene_id "g1058"; Scaffold_7 AUGUSTUS CDS 5019752 5019760 0.42 - 0 transcript_id "g1058.t1"; gene_id "g1058"; Scaffold_7 AUGUSTUS start_codon 5019758 5019760 . - 0 transcript_id "g1058.t1"; gene_id "g1058"; # protein sequence = [MNRATDIYNPLPSPASSDFTPPLTQSTSGSNNSRSNFGSICQSPPQPSTPPSRYTHAHPNNQTAATHRPRTRYPVDLA # RAGDGRTPLHRRGTSQKYEPFEDLLREAGYKETRIFTPETERTVSGADDGDGSSGGKNKIAGVVEFLSGFIPGSRTSSLRDDSNEARKKHYSPPTSPS # PMSTRRQNQRADPEPGREHQKRPIDNDATPRATRTRTSRSVQSLQNTTPSPAIRYTHNNHSYTSIGQSSSSKPMPPSRATAYLRHIASVPDMPGADLQ # RSHSNPTRRRRSNRRSGTNDSRHTDDGEDDDFDSVYEGRTRGNGEGEEDPNVPPLPKGWLETVARAVLFGPGASLASRATFGPSETTAGSRAVSQPYT # NSQPSSSYVRDVSPALRQLRQTRSVISRTGSLADATTTHIRHPHQHHNLIRTQSARSALSSRSGLSDRTNRTHGYWATMMPSPLSNIKSASADVYGAN # RPRPTLMTRLHSSSRSNASEGEIRRARVVCRSAPASRATSPNPNYLNPSSTTRQVQRKQSTQGRNKGNRSPKKWRSGKVADEPPSLTRTMVELEGDGA # GHMDSWLYSLPHTHEHQQGLNYSSNLRSEPSSESRYLSGWGWDSAQSSALPTSQPDYDSDGIGHFQNPPFSLSISATNISDEADQPVSEGEESSENEV # DLAKMLRPKPQRQESSNSTKSVSSLRSIRSLRKFLVPGVENHHIPPSPSSNGGGGSARDIIDITPPTSATGRWFLDSDGLYADGNDRYGTKGTRGKRG # SLPSGWTGHDMELAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1058 ### # start gene g1059 Scaffold_7 AUGUSTUS gene 5034256 5035412 0.87 + . g1059 Scaffold_7 AUGUSTUS transcript 5034256 5035412 0.87 + . g1059.t1 Scaffold_7 AUGUSTUS start_codon 5034256 5034258 . + 0 transcript_id "g1059.t1"; gene_id "g1059"; Scaffold_7 AUGUSTUS CDS 5034256 5034551 0.87 + 0 transcript_id "g1059.t1"; gene_id "g1059"; Scaffold_7 AUGUSTUS CDS 5034902 5035412 1 + 1 transcript_id "g1059.t1"; gene_id "g1059"; Scaffold_7 AUGUSTUS stop_codon 5035410 5035412 . + 0 transcript_id "g1059.t1"; gene_id "g1059"; # protein sequence = [MQADTRPASITRLHTSPERLRADSSGSGYLDRVPEDGSVEFDGRDEEENIEEIDEEFESQGLYRGIISLLMRPHNGRL # KQCDCLLIQDHTEDYWFCTHLRVWWVSLGWAAVEGIVAIKQGYANIALYRDVLVNDIYEEERIIEIEDGATKLGRIYGATDQITYTAEPSLAPFVVGS # SEHTSPAQSVPLRGLAATAISDADASSNLERVPLLLQRESRASDIDLETSLELQVEDDIDQLMAVRARDELGKYYGIPFIVRFIVAQKKSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1059 ### # start gene g1060 Scaffold_7 AUGUSTUS gene 5037867 5038749 0.39 + . g1060 Scaffold_7 AUGUSTUS transcript 5037867 5038749 0.39 + . g1060.t1 Scaffold_7 AUGUSTUS start_codon 5037867 5037869 . + 0 transcript_id "g1060.t1"; gene_id "g1060"; Scaffold_7 AUGUSTUS CDS 5037867 5037989 0.39 + 0 transcript_id "g1060.t1"; gene_id "g1060"; Scaffold_7 AUGUSTUS CDS 5038042 5038749 0.46 + 0 transcript_id "g1060.t1"; gene_id "g1060"; Scaffold_7 AUGUSTUS stop_codon 5038747 5038749 . + 0 transcript_id "g1060.t1"; gene_id "g1060"; # protein sequence = [MTDGCGISSLALHKVIHETYRERLQLSEVSTAIQFRLAGAKGMVLLANHDKVEDLQVVLRSSQIKICYSSVLLDPSHL # TMDILRFSHTKTPAKLSEEVIKNLHHNGVPASVFIGLLQQRLQQVVDGLTAWEGPDAMPKLWKAVEAAEGVIGARKARVSPTDSRVRGYGSYEDDEDD # EEGMKHETSSQPWWADPFSGCPSSIAETVMELLDSGFTPLNSPYLRDKLKQCVKTKIKTAAAKFNYVLTQSCSAFAVPGACGSQHCIDSCGCGVNTKK # MT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1060 ### # start gene g1061 Scaffold_7 AUGUSTUS gene 5039333 5040202 0.43 + . g1061 Scaffold_7 AUGUSTUS transcript 5039333 5040202 0.43 + . g1061.t1 Scaffold_7 AUGUSTUS start_codon 5039333 5039335 . + 0 transcript_id "g1061.t1"; gene_id "g1061"; Scaffold_7 AUGUSTUS CDS 5039333 5040202 0.43 + 0 transcript_id "g1061.t1"; gene_id "g1061"; Scaffold_7 AUGUSTUS stop_codon 5040200 5040202 . + 0 transcript_id "g1061.t1"; gene_id "g1061"; # protein sequence = [MWAIILGSMRMLFMSMAMLIGGQLISPTSESKDFPPKLPYHFHPDTTDEITDRFCLVLDSAKTGYRIKSETYLSDRKL # YSHPLGPSYKITEKKASISSNDLPLQRGEDLPKFIMDSLHIEAAKQRDYWLIEVDNRFSNAPLNLRPDPDLVFPWQNFCNEARERSEKAIVGDLNDIS # NHVEAMYKQRVETYVNPASGSFTSQPITVRQDKIRDLSQRFISFPGPRNLKTLMEPTAVARLRASYAYIYAIRRGGPAAQFPFDRAFRELCTIKAQAV # GGYKVCLQSMNDYRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1061 ### # start gene g1062 Scaffold_7 AUGUSTUS gene 5042844 5043518 0.92 + . g1062 Scaffold_7 AUGUSTUS transcript 5042844 5043518 0.92 + . g1062.t1 Scaffold_7 AUGUSTUS start_codon 5042844 5042846 . + 0 transcript_id "g1062.t1"; gene_id "g1062"; Scaffold_7 AUGUSTUS CDS 5042844 5043518 0.92 + 0 transcript_id "g1062.t1"; gene_id "g1062"; Scaffold_7 AUGUSTUS stop_codon 5043516 5043518 . + 0 transcript_id "g1062.t1"; gene_id "g1062"; # protein sequence = [MRQFLGPSKSPTPIPTPRAISSPSPSDAYATSPGRAPINPGLSSPVLSARQFHLPFSPSPVNDDHDPLGSCHSSTLEN # QDDTGSSVSSAFPTFAPPSNSGTPNPRESPGHDFVGYLAGFNPEYHFQSSHPAQAQARYSPTTGWNWNDHDDDVSSIDWTQCDTRNETNLNYVDAELD # YVSRMEKNQLNLGRAGDLEVADESRTGAKNSPSIYTPQHLARRSFDNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1062 ### # start gene g1063 Scaffold_7 AUGUSTUS gene 5044054 5044533 1 - . g1063 Scaffold_7 AUGUSTUS transcript 5044054 5044533 1 - . g1063.t1 Scaffold_7 AUGUSTUS stop_codon 5044054 5044056 . - 0 transcript_id "g1063.t1"; gene_id "g1063"; Scaffold_7 AUGUSTUS CDS 5044054 5044533 1 - 0 transcript_id "g1063.t1"; gene_id "g1063"; Scaffold_7 AUGUSTUS start_codon 5044531 5044533 . - 0 transcript_id "g1063.t1"; gene_id "g1063"; # protein sequence = [MIYIGTKKSTNGDYKKEAQINCVQHISDKELTSTTAPRYLSGEFDEFNGNKGGDTDINEDPGESALLLGIVVADIATD # NRGKRDREEKNRVRLSKSVVKLYLGSATFGASNVSSTWCNSSAEPKTRGFKLQVSIFNGIWDWIGTGYKLRDLYNDEVGIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1063 ### # start gene g1064 Scaffold_7 AUGUSTUS gene 5045628 5048007 0.88 + . g1064 Scaffold_7 AUGUSTUS transcript 5045628 5048007 0.88 + . g1064.t1 Scaffold_7 AUGUSTUS start_codon 5045628 5045630 . + 0 transcript_id "g1064.t1"; gene_id "g1064"; Scaffold_7 AUGUSTUS CDS 5045628 5046291 0.88 + 0 transcript_id "g1064.t1"; gene_id "g1064"; Scaffold_7 AUGUSTUS CDS 5046416 5048007 0.93 + 2 transcript_id "g1064.t1"; gene_id "g1064"; Scaffold_7 AUGUSTUS stop_codon 5048005 5048007 . + 0 transcript_id "g1064.t1"; gene_id "g1064"; # protein sequence = [MASISLSYADRAKNAQNIRSPIENTVLAISVSIPESTSTSSSFSSNASSRSSTSSNPGSSTVISSSSTDVDADITAPT # TSNSSVIVESDGECNGGQQEQKKRREREEEVSRITTRKPSVNVWEQRMNRGSVSSSFTLISSSSKTSTTNSAFIKKDNDPSIAKVRPTSNNWSARPTP # ASPSRPVSLDLRNSNAWPEVGVGLSSPSKDKGKGKLSNEEVSVVQENENTENASLSSSKSIRAKSKSRWVPIPAEELQAAADAASTTRRQAKTQTNIK # SAMNSVSRSRSRNQSQSRDLSQLMSLTRGTGISDRKSISRSGTTSNPTSSIHSSAGSAHGSPAFPREIGLPPQETEESRSTAHTMSSSPSNSKAERTP # SASTYTVPPFVSSTLPSVFPVQIQQQQQQAKFIASQNFQTGEASPHELPVGVQPVYFSNGHYPSDPIQSSSVSSLSMYSPSTEQNLPQSLAPLTSHLS # NLTSNLSTSYTSTYPFYGFPSIARSNAQMYWPGPTGSGHQTPNYGRQVHSPMIYPVEYRPTSPINGPTHNPTHFAESHLSNPSAYVPISAPVSIEVIQ # PIPTRVVFGNFDGCDTNMNIGSASFTPRSSFYVGAGSRETRSSSLKKRSAQRGKKRAIPQRSAGVTMLSADAEVVDLMERFTSAKNGRGTSGRWSFGR # FGNGEQDLNEDEKECAQTYNHSQQSNNSDLHLVTPPRPSLPPAYVPVGAVPVSAPAPVPPIPLSTLASLAPIHTNFPHPIPRIPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1064 ### # start gene g1065 Scaffold_7 AUGUSTUS gene 5048976 5049287 0.65 + . g1065 Scaffold_7 AUGUSTUS transcript 5048976 5049287 0.65 + . g1065.t1 Scaffold_7 AUGUSTUS start_codon 5048976 5048978 . + 0 transcript_id "g1065.t1"; gene_id "g1065"; Scaffold_7 AUGUSTUS CDS 5048976 5049287 0.65 + 0 transcript_id "g1065.t1"; gene_id "g1065"; Scaffold_7 AUGUSTUS stop_codon 5049285 5049287 . + 0 transcript_id "g1065.t1"; gene_id "g1065"; # protein sequence = [MSSVVEVQGDMVRMKEGEWERFVLPDAQTSRVDSIHEFPLTPSSGDSTSKVRSFVEEAVMRHVRSDNGDPESEADEIN # EEEEEEEEEEEEEEEVVFVMGYDPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1065 ### # start gene g1066 Scaffold_7 AUGUSTUS gene 5050948 5051283 0.7 + . g1066 Scaffold_7 AUGUSTUS transcript 5050948 5051283 0.7 + . g1066.t1 Scaffold_7 AUGUSTUS start_codon 5050948 5050950 . + 0 transcript_id "g1066.t1"; gene_id "g1066"; Scaffold_7 AUGUSTUS CDS 5050948 5051283 0.7 + 0 transcript_id "g1066.t1"; gene_id "g1066"; Scaffold_7 AUGUSTUS stop_codon 5051281 5051283 . + 0 transcript_id "g1066.t1"; gene_id "g1066"; # protein sequence = [MRAARIDPEAAWPPPISPDENDDDRNVRLEQEREAKRVSDAIDLALNVERENKKKTIHGAKILLLGPSQHISSFFVNL # RNRSSRIREVNDLEEHAGAFWSLPVSIMLRDLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1066 ### # start gene g1067 Scaffold_7 AUGUSTUS gene 5056001 5057104 0.47 + . g1067 Scaffold_7 AUGUSTUS transcript 5056001 5057104 0.47 + . g1067.t1 Scaffold_7 AUGUSTUS start_codon 5056001 5056003 . + 0 transcript_id "g1067.t1"; gene_id "g1067"; Scaffold_7 AUGUSTUS CDS 5056001 5057104 0.47 + 0 transcript_id "g1067.t1"; gene_id "g1067"; Scaffold_7 AUGUSTUS stop_codon 5057102 5057104 . + 0 transcript_id "g1067.t1"; gene_id "g1067"; # protein sequence = [MVFEVLGENLLGLIKRHQSKGVPMGLVKQIGKQILLGLDYMHRCCGVIHTDLKPENVLIAIDDVEGIIQAELAKSKLA # NASATDSSSNPSPARMSGVVGVPPSTGRGGNQTPRSESLIITSSQPLPSPSSSFGSTGFLSSLASAGGNLPKSIYSSTSGSTSSGPVFDKFSFGMSKI # DPEGPGQSTVEGRSNAEEIAEGVGNVSLDKSSTLDDAEDVLEFSTNKSKKVLPKVSLLTQQAPSHSSNASDLPAHSHSNLPPGAQPPPFNGRDMQITK # DGMGRVQDSVSAMAGEMEVEERITVKIADLGNGEIDPYPLIYFHFRGEASSLFEGESCTVMLTILALLCSAHISHMDRTSLHRRHSNASIPCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1067 ### # start gene g1068 Scaffold_7 AUGUSTUS gene 5058387 5059013 0.96 + . g1068 Scaffold_7 AUGUSTUS transcript 5058387 5059013 0.96 + . g1068.t1 Scaffold_7 AUGUSTUS start_codon 5058387 5058389 . + 0 transcript_id "g1068.t1"; gene_id "g1068"; Scaffold_7 AUGUSTUS CDS 5058387 5059013 0.96 + 0 transcript_id "g1068.t1"; gene_id "g1068"; Scaffold_7 AUGUSTUS stop_codon 5059011 5059013 . + 0 transcript_id "g1068.t1"; gene_id "g1068"; # protein sequence = [MVSGEKIRGRTKTPTPPSPPTSPSPSRLKAPKLEHRVSDATVTNDDDVVPAPSGPEAQLTPSTVSTASTKAKNSVTAQ # EQAEVDALKPVGEFEPESESNESGGTEPDTGGKGEDAAMDSPVKTTPTLGSAPSTGGKFPVSACLTIVPSSSLISIRAEDHSNILIYQYTQPRQCITY # PELSSQRKSGRKRGKGGGGSKSKRGGKGRGAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1068 ### # start gene g1069 Scaffold_7 AUGUSTUS gene 5059371 5060934 0.45 - . g1069 Scaffold_7 AUGUSTUS transcript 5059371 5060934 0.45 - . g1069.t1 Scaffold_7 AUGUSTUS stop_codon 5059371 5059373 . - 0 transcript_id "g1069.t1"; gene_id "g1069"; Scaffold_7 AUGUSTUS CDS 5059371 5059873 0.59 - 2 transcript_id "g1069.t1"; gene_id "g1069"; Scaffold_7 AUGUSTUS CDS 5059983 5060934 0.52 - 0 transcript_id "g1069.t1"; gene_id "g1069"; Scaffold_7 AUGUSTUS start_codon 5060932 5060934 . - 0 transcript_id "g1069.t1"; gene_id "g1069"; # protein sequence = [MACAYLLSCDELASPPRLERNYSRREWAKIRADETMNAIPDSEDSSPDRLSRAVLAEETSIDSPVPGSVSPGPDQRQK # KSYADALEHVLNLHTSRRMKPSTSDSDKVKQGVSIPSQRRFLYYWSLLLSREAPSHLWATELLVPSPNQDTILSMPVSQKSPRPKVRLTEIKIRMKEI # SNMRANLVRAANVVIDKTNMSKSPAQTDKNTHVWVSLARYDDDFVETLERWERYTRMDSASDQGYMGRREPGKDHFGKESLGELFVDGRWDSKKMVRS # FARMGADEQSFVKDCTEEVSTSAHHDSINLIKMFITGWQNQDIQANSMYDITQNVKEKGVVLDAGREVRVKLYMGQVSDLASALSLLRYPYKVFMGWL # WFIPTFHMSQPPPYSDLSQPQPSNISSKLVLQRKELDFALGIGSSIIDIEISLDWLKETEVETVQPPARVNTEDEETAPEKVKEPAGIGATIEAMAAG # DVAGIVEATQAAED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1069 ### # start gene g1070 Scaffold_7 AUGUSTUS gene 5061942 5062772 1 + . g1070 Scaffold_7 AUGUSTUS transcript 5061942 5062772 1 + . g1070.t1 Scaffold_7 AUGUSTUS start_codon 5061942 5061944 . + 0 transcript_id "g1070.t1"; gene_id "g1070"; Scaffold_7 AUGUSTUS CDS 5061942 5062772 1 + 0 transcript_id "g1070.t1"; gene_id "g1070"; Scaffold_7 AUGUSTUS stop_codon 5062770 5062772 . + 0 transcript_id "g1070.t1"; gene_id "g1070"; # protein sequence = [MTRARTQASSLLAENARATATTVASRAKTVETGGEKTSVKRKREILGEVTESNSGKPKASAKGKEKATSGDKAGPTAT # ASKSRLTSKTVRAPLREVGGTASIQKPLRSKPVAGDRQILGIIKEDDDRDEVMIDETRAPAPLHATQPAIFKLVPQTSAHKDLLPRAPASLRDDVDRE # PVFKKRITEDREDRQPVARVTPRLPTTLDDSQLDEDRIATELADVHEDEDGAGLWDDLDADDAEDPFMAPEYVHEIMEYMKELEVCLSPFIEIDLMYC # YS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1070 ### # start gene g1071 Scaffold_7 AUGUSTUS gene 5066403 5068436 0.4 + . g1071 Scaffold_7 AUGUSTUS transcript 5066403 5068436 0.4 + . g1071.t1 Scaffold_7 AUGUSTUS start_codon 5066403 5066405 . + 0 transcript_id "g1071.t1"; gene_id "g1071"; Scaffold_7 AUGUSTUS CDS 5066403 5068436 0.4 + 0 transcript_id "g1071.t1"; gene_id "g1071"; Scaffold_7 AUGUSTUS stop_codon 5068434 5068436 . + 0 transcript_id "g1071.t1"; gene_id "g1071"; # protein sequence = [MNRLGRRFASASSSAPTSVAQPLSSHCSRRSLLASFFNNSTRSSRWMMSLAGPTSRTFSSSPNTMMRRTPRIGSGGAG # PRWINSSGSGSGKDGKGVGKESDETEDNTSTEEVKASSIEGTNSEGGESDSDSTPPASSSGNNKSLTKPTVPTNYPTVLALPIARRPLFPGFYKAVVI # KNPAVVRAVRDMMARGQPYLGAFLLREEEGKDGQGEALDKDVISSLDEVHEVGVFAQITSVFSANPNPTASSEGNKDVDKSSGEDTEEYLTAVLYPHR # RILITELLKNGTASEPTEARVELVEDDQPPEIQTATPPQTPTDETPTSGRFSPITSFLNSHPVSVVNTVHYPTLPYTKSSQHIRALTAEIVTVFKDIA # QLNPLFRDQITNFSINQVASNVFDEPDRLADFAAAVSSGTSGELQEVLEEVDVANRLGKALVVLKKELINAQLQNKISKDVDTKIAKRQREYYLMEQL # KGIKKELGLESDGKDKLLQKFKDRAAQLAMPAPVRKVFDEELNKLASLEPSASEANVTRTYLEWITQLPWGVYTPTRYSVEAARQVLEEDHYGLKELK # ERILEFVAVGKLRGSVESASSVAQNPDPVVDSSSSLESNKSVPPPPPAQNDRLPTPEGKIILLHGPPGVGKTSVGKSLARAVGREFFRFSVGGLGDVA # EIKGHRRTYVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1071 ### # start gene g1072 Scaffold_7 AUGUSTUS gene 5068817 5069530 0.91 + . g1072 Scaffold_7 AUGUSTUS transcript 5068817 5069530 0.91 + . g1072.t1 Scaffold_7 AUGUSTUS start_codon 5068817 5068819 . + 0 transcript_id "g1072.t1"; gene_id "g1072"; Scaffold_7 AUGUSTUS CDS 5068817 5068839 0.95 + 0 transcript_id "g1072.t1"; gene_id "g1072"; Scaffold_7 AUGUSTUS CDS 5068932 5069070 0.98 + 1 transcript_id "g1072.t1"; gene_id "g1072"; Scaffold_7 AUGUSTUS CDS 5069126 5069530 0.95 + 0 transcript_id "g1072.t1"; gene_id "g1072"; Scaffold_7 AUGUSTUS stop_codon 5069528 5069530 . + 0 transcript_id "g1072.t1"; gene_id "g1072"; # protein sequence = [MEVLEVSGYLAPQAKASAGLQDADVVVERSAIDSLIKWYARESGVRNLKKMVEKIYRKTALKIVQDLGEEKLPEPPLP # ADAAAAVTPVTEHSSDAPLTPLTEPDPEHDQKIHPTTTEKRAPLVIPTSVHVRITADNLKDYVGPPVYQKDRMYEGPGRLVKGVSTGLGYLGNGSGAV # MPIETLVGVLLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1072 ### # start gene g1073 Scaffold_7 AUGUSTUS gene 5069726 5070202 0.52 + . g1073 Scaffold_7 AUGUSTUS transcript 5069726 5070202 0.52 + . g1073.t1 Scaffold_7 AUGUSTUS start_codon 5069726 5069728 . + 0 transcript_id "g1073.t1"; gene_id "g1073"; Scaffold_7 AUGUSTUS CDS 5069726 5070202 0.52 + 0 transcript_id "g1073.t1"; gene_id "g1073"; Scaffold_7 AUGUSTUS stop_codon 5070200 5070202 . + 0 transcript_id "g1073.t1"; gene_id "g1073"; # protein sequence = [MPEGSIGKEGPSAGTAILSALVSLGSGVGVRGDVGKFNIISPLVLPNFRRIIVAMTGEISLAGHVLPVGGLKEKILAA # HRAGIKTILAPAANRADIEENVPDSVKEGIKLIYVEDVREVLKEVFGGAVVEGSGEDVVSRWADSVQVKEKERFPESSGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1073 ### # start gene g1074 Scaffold_7 AUGUSTUS gene 5070488 5071637 0.23 - . g1074 Scaffold_7 AUGUSTUS transcript 5070488 5071637 0.23 - . g1074.t1 Scaffold_7 AUGUSTUS stop_codon 5070488 5070490 . - 0 transcript_id "g1074.t1"; gene_id "g1074"; Scaffold_7 AUGUSTUS CDS 5070488 5071310 0.55 - 1 transcript_id "g1074.t1"; gene_id "g1074"; Scaffold_7 AUGUSTUS CDS 5071426 5071637 0.23 - 0 transcript_id "g1074.t1"; gene_id "g1074"; Scaffold_7 AUGUSTUS start_codon 5071635 5071637 . - 0 transcript_id "g1074.t1"; gene_id "g1074"; # protein sequence = [MWSLSLIKNADNGYIDSCPCSGIKSHGLEGKLNTINIFQLQVLLTMIIFSSTELANGEPLVPFSAATVQATYGGSYQT # NNGAYAEFVRLYASVTFKLPDELSYEEGASLPIPHLTAVQVFYMRLNIPKPFSPPAAEKEIILIWGGSTAVGHNAIQLARTSGLRVFVTASPAVHEEL # KTLGAEQTFDYKAVDVVKQIQDAAGERGIIYAIDTVGELSTTNSPLTALSLSRSGHLVSILPPDPSSVNRRKDVKVEFSLVYTLLGLDFTFASAFKYD # AIPEDKALSLEYVSTYMPRVLEGWKAGQGSTSLKPQRLRKLEGGLEKIEEGLKIMRDGKYGREKLVYTIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1074 ### # start gene g1075 Scaffold_7 AUGUSTUS gene 5073367 5073681 1 + . g1075 Scaffold_7 AUGUSTUS transcript 5073367 5073681 1 + . g1075.t1 Scaffold_7 AUGUSTUS start_codon 5073367 5073369 . + 0 transcript_id "g1075.t1"; gene_id "g1075"; Scaffold_7 AUGUSTUS CDS 5073367 5073681 1 + 0 transcript_id "g1075.t1"; gene_id "g1075"; Scaffold_7 AUGUSTUS stop_codon 5073679 5073681 . + 0 transcript_id "g1075.t1"; gene_id "g1075"; # protein sequence = [MIVDPPPRKVLPALTIPKSLANLRDIPHTRTSARRSAHQAPDDDLEAERVFKKARTSSDAPEDAVEEQWADQHALDAL # EEEVEADPNGPDWDDLDQDDGDDPVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1075 ### # start gene g1076 Scaffold_7 AUGUSTUS gene 5078191 5079057 0.68 - . g1076 Scaffold_7 AUGUSTUS transcript 5078191 5079057 0.68 - . g1076.t1 Scaffold_7 AUGUSTUS stop_codon 5078191 5078193 . - 0 transcript_id "g1076.t1"; gene_id "g1076"; Scaffold_7 AUGUSTUS CDS 5078191 5079057 0.68 - 0 transcript_id "g1076.t1"; gene_id "g1076"; Scaffold_7 AUGUSTUS start_codon 5079055 5079057 . - 0 transcript_id "g1076.t1"; gene_id "g1076"; # protein sequence = [MVVERKKGLIDASRIAAEAHNFAVEWGSRCIHRWTQDWIKTRELPHSNRGRHAKVYSLLSDPTARDAIRAYLHTNKWS # LDPPKLKKLFANELAPDEAHEYSKQIISQEMPRGLKSFVEETLLPSMQCKPSHLGLSLSSMRCLMLREGFTYVEHKKAVYFDGHERPDVVQDHQTRFI # PQAKAFYCQIVHYDTKDVTKQLPPEDEYADKPRYVLCSHDEMVAQAHDGQKKGWVLEDNQPLKKKGPGRGIHQSDFICSTVGWLKDASVTLEYGKNHE # GFWNCELFIKQVED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1076 ### # start gene g1077 Scaffold_7 AUGUSTUS gene 5079624 5080121 0.91 - . g1077 Scaffold_7 AUGUSTUS transcript 5079624 5080121 0.91 - . g1077.t1 Scaffold_7 AUGUSTUS stop_codon 5079624 5079626 . - 0 transcript_id "g1077.t1"; gene_id "g1077"; Scaffold_7 AUGUSTUS CDS 5079624 5080121 0.91 - 0 transcript_id "g1077.t1"; gene_id "g1077"; Scaffold_7 AUGUSTUS start_codon 5080119 5080121 . - 0 transcript_id "g1077.t1"; gene_id "g1077"; # protein sequence = [MTSTNRNAKKAAAARARAGRARQQLGLNILPEPDLDPRDVSNETDFEESRLSGLEDDLEELADMLQDLDLWDPADSPM # DMGEDSDSEIEELQGEELVKSLEEKEARIESTFAQLMRDKSKQEWKQAEHSSRMGVYNGHSDRTRCYHAQKAIEKEKKDATMRNTYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1077 ### # start gene g1078 Scaffold_7 AUGUSTUS gene 5084426 5085589 0.16 + . g1078 Scaffold_7 AUGUSTUS transcript 5084426 5085589 0.16 + . g1078.t1 Scaffold_7 AUGUSTUS start_codon 5084426 5084428 . + 0 transcript_id "g1078.t1"; gene_id "g1078"; Scaffold_7 AUGUSTUS CDS 5084426 5085589 0.16 + 0 transcript_id "g1078.t1"; gene_id "g1078"; Scaffold_7 AUGUSTUS stop_codon 5085587 5085589 . + 0 transcript_id "g1078.t1"; gene_id "g1078"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRME # SVGMFLVQVDRSFYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1078 ### # start gene g1079 Scaffold_7 AUGUSTUS gene 5085962 5089015 0.3 + . g1079 Scaffold_7 AUGUSTUS transcript 5085962 5089015 0.3 + . g1079.t1 Scaffold_7 AUGUSTUS start_codon 5085962 5085964 . + 0 transcript_id "g1079.t1"; gene_id "g1079"; Scaffold_7 AUGUSTUS CDS 5085962 5086706 0.33 + 0 transcript_id "g1079.t1"; gene_id "g1079"; Scaffold_7 AUGUSTUS CDS 5086757 5087078 0.48 + 2 transcript_id "g1079.t1"; gene_id "g1079"; Scaffold_7 AUGUSTUS CDS 5087821 5089015 1 + 1 transcript_id "g1079.t1"; gene_id "g1079"; Scaffold_7 AUGUSTUS stop_codon 5089013 5089015 . + 0 transcript_id "g1079.t1"; gene_id "g1079"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRILQKDIVESFLRDLSIDDERRNIAIVA # NQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQNSFLGENCDKSESTETTQN # QCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDR # SPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEG # FLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKS # LRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGGRILYLYFTMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1079 ### # start gene g1080 Scaffold_7 AUGUSTUS gene 5089293 5091566 0.32 + . g1080 Scaffold_7 AUGUSTUS transcript 5089293 5091566 0.32 + . g1080.t1 Scaffold_7 AUGUSTUS start_codon 5089293 5089295 . + 0 transcript_id "g1080.t1"; gene_id "g1080"; Scaffold_7 AUGUSTUS CDS 5089293 5090223 0.56 + 0 transcript_id "g1080.t1"; gene_id "g1080"; Scaffold_7 AUGUSTUS CDS 5090349 5090542 0.63 + 2 transcript_id "g1080.t1"; gene_id "g1080"; Scaffold_7 AUGUSTUS CDS 5090643 5091566 0.92 + 0 transcript_id "g1080.t1"; gene_id "g1080"; Scaffold_7 AUGUSTUS stop_codon 5091564 5091566 . + 0 transcript_id "g1080.t1"; gene_id "g1080"; # protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDAHVKSSVGIYESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLG # HKGTDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWL # EEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTR # DELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTV # LKEKVGAFRVLPHFTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1080 ### # start gene g1081 Scaffold_7 AUGUSTUS gene 5092012 5093454 0.23 - . g1081 Scaffold_7 AUGUSTUS transcript 5092012 5093454 0.23 - . g1081.t1 Scaffold_7 AUGUSTUS stop_codon 5092012 5092014 . - 0 transcript_id "g1081.t1"; gene_id "g1081"; Scaffold_7 AUGUSTUS CDS 5092012 5092439 1 - 2 transcript_id "g1081.t1"; gene_id "g1081"; Scaffold_7 AUGUSTUS CDS 5093210 5093231 0.36 - 0 transcript_id "g1081.t1"; gene_id "g1081"; Scaffold_7 AUGUSTUS CDS 5093287 5093454 0.63 - 0 transcript_id "g1081.t1"; gene_id "g1081"; Scaffold_7 AUGUSTUS start_codon 5093452 5093454 . - 0 transcript_id "g1081.t1"; gene_id "g1081"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRMTHSKHINHALAQVV # SSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAV # PVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1081 ### # start gene g1082 Scaffold_7 AUGUSTUS gene 5095732 5096434 0.37 - . g1082 Scaffold_7 AUGUSTUS transcript 5095732 5096434 0.37 - . g1082.t1 Scaffold_7 AUGUSTUS stop_codon 5095732 5095734 . - 0 transcript_id "g1082.t1"; gene_id "g1082"; Scaffold_7 AUGUSTUS CDS 5095732 5096168 0.97 - 2 transcript_id "g1082.t1"; gene_id "g1082"; Scaffold_7 AUGUSTUS CDS 5096227 5096434 0.37 - 0 transcript_id "g1082.t1"; gene_id "g1082"; Scaffold_7 AUGUSTUS start_codon 5096432 5096434 . - 0 transcript_id "g1082.t1"; gene_id "g1082"; # protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS # KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE # AEDEDIAPPPKRLKTTSSISGRIFILHFSSHFINLIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1082 ### # start gene g1083 Scaffold_7 AUGUSTUS gene 5115430 5116158 0.33 + . g1083 Scaffold_7 AUGUSTUS transcript 5115430 5116158 0.33 + . g1083.t1 Scaffold_7 AUGUSTUS start_codon 5115430 5115432 . + 0 transcript_id "g1083.t1"; gene_id "g1083"; Scaffold_7 AUGUSTUS CDS 5115430 5116158 0.33 + 0 transcript_id "g1083.t1"; gene_id "g1083"; Scaffold_7 AUGUSTUS stop_codon 5116156 5116158 . + 0 transcript_id "g1083.t1"; gene_id "g1083"; # protein sequence = [MDDPQPGSSARMPKADLRADKLKKDVDKHRKKSTYWKGKTVVLRGSLSETKKELNKHIEEEEQIKKIANGERQKMSRQ # IENLEDALESEMKRRKLDAEEQETQNAQWREQVRDHRRQIVALKKKIGRIPSRLATAINRIARTYNMNVENDRKFFLKNDGVVTDETRDIFLDLVSIE # EVPANKVTRVFKRIASAFGIEVEGDVSRRSVGRIAKEGGVASKLQFGKAVLDPSTKGMYRKLYTCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1083 ### # start gene g1084 Scaffold_7 AUGUSTUS gene 5120194 5120899 0.3 + . g1084 Scaffold_7 AUGUSTUS transcript 5120194 5120899 0.3 + . g1084.t1 Scaffold_7 AUGUSTUS start_codon 5120194 5120196 . + 0 transcript_id "g1084.t1"; gene_id "g1084"; Scaffold_7 AUGUSTUS CDS 5120194 5120404 0.35 + 0 transcript_id "g1084.t1"; gene_id "g1084"; Scaffold_7 AUGUSTUS CDS 5120463 5120899 0.79 + 2 transcript_id "g1084.t1"; gene_id "g1084"; Scaffold_7 AUGUSTUS stop_codon 5120897 5120899 . + 0 transcript_id "g1084.t1"; gene_id "g1084"; # protein sequence = [MMRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSAR # SKDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESED # EDEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1084 ### # start gene g1085 Scaffold_7 AUGUSTUS gene 5121811 5122155 0.5 + . g1085 Scaffold_7 AUGUSTUS transcript 5121811 5122155 0.5 + . g1085.t1 Scaffold_7 AUGUSTUS start_codon 5121811 5121813 . + 0 transcript_id "g1085.t1"; gene_id "g1085"; Scaffold_7 AUGUSTUS CDS 5121811 5122155 0.5 + 0 transcript_id "g1085.t1"; gene_id "g1085"; Scaffold_7 AUGUSTUS stop_codon 5122153 5122155 . + 0 transcript_id "g1085.t1"; gene_id "g1085"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1085 ### # start gene g1086 Scaffold_7 AUGUSTUS gene 5123908 5124685 0.48 + . g1086 Scaffold_7 AUGUSTUS transcript 5123908 5124685 0.48 + . g1086.t1 Scaffold_7 AUGUSTUS start_codon 5123908 5123910 . + 0 transcript_id "g1086.t1"; gene_id "g1086"; Scaffold_7 AUGUSTUS CDS 5123908 5123934 0.48 + 0 transcript_id "g1086.t1"; gene_id "g1086"; Scaffold_7 AUGUSTUS CDS 5124041 5124176 0.61 + 0 transcript_id "g1086.t1"; gene_id "g1086"; Scaffold_7 AUGUSTUS CDS 5124258 5124685 1 + 2 transcript_id "g1086.t1"; gene_id "g1086"; Scaffold_7 AUGUSTUS stop_codon 5124683 5124685 . + 0 transcript_id "g1086.t1"; gene_id "g1086"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1086 ### # start gene g1087 Scaffold_7 AUGUSTUS gene 5124946 5126696 0.59 - . g1087 Scaffold_7 AUGUSTUS transcript 5124946 5126696 0.59 - . g1087.t1 Scaffold_7 AUGUSTUS stop_codon 5124946 5124948 . - 0 transcript_id "g1087.t1"; gene_id "g1087"; Scaffold_7 AUGUSTUS CDS 5124946 5126425 0.63 - 1 transcript_id "g1087.t1"; gene_id "g1087"; Scaffold_7 AUGUSTUS CDS 5126482 5126696 0.93 - 0 transcript_id "g1087.t1"; gene_id "g1087"; Scaffold_7 AUGUSTUS start_codon 5126694 5126696 . - 0 transcript_id "g1087.t1"; gene_id "g1087"; # protein sequence = [MGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLSSEGNR # LDELIPLIGKYLSNPSDESLSEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDI # YKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVV # TDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVE # STWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRT # KGGSYIIAEMDGTILKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPRLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1087 ### # start gene g1088 Scaffold_7 AUGUSTUS gene 5128805 5129638 0.82 - . g1088 Scaffold_7 AUGUSTUS transcript 5128805 5129638 0.82 - . g1088.t1 Scaffold_7 AUGUSTUS stop_codon 5128805 5128807 . - 0 transcript_id "g1088.t1"; gene_id "g1088"; Scaffold_7 AUGUSTUS CDS 5128805 5129638 0.82 - 0 transcript_id "g1088.t1"; gene_id "g1088"; Scaffold_7 AUGUSTUS start_codon 5129636 5129638 . - 0 transcript_id "g1088.t1"; gene_id "g1088"; # protein sequence = [MDPVKVAAVRDWPVPTNLRELRGFLGFANFLPALYPKFCKIARPLNDLTKKDTTFNWTGTQQEAFDTLREAFISAPIL # AYGRQIGPLEFEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDLSPTTPTSNSGAQHKTLPV # DKPDGPSIYHGFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKTWPLHQNRCFNPTEPPRGSYSESLRTGSTSTGRSGKQSRARVTTLGQ # WDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1088 ### # start gene g1089 Scaffold_7 AUGUSTUS gene 5131727 5132194 0.54 - . g1089 Scaffold_7 AUGUSTUS transcript 5131727 5132194 0.54 - . g1089.t1 Scaffold_7 AUGUSTUS stop_codon 5131727 5131729 . - 0 transcript_id "g1089.t1"; gene_id "g1089"; Scaffold_7 AUGUSTUS CDS 5131727 5132194 0.54 - 0 transcript_id "g1089.t1"; gene_id "g1089"; Scaffold_7 AUGUSTUS start_codon 5132192 5132194 . - 0 transcript_id "g1089.t1"; gene_id "g1089"; # protein sequence = [MAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSE # IKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPDFERGNQTSHIGGCLPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1089 ### # start gene g1090 Scaffold_7 AUGUSTUS gene 5133292 5133972 0.87 - . g1090 Scaffold_7 AUGUSTUS transcript 5133292 5133972 0.87 - . g1090.t1 Scaffold_7 AUGUSTUS stop_codon 5133292 5133294 . - 0 transcript_id "g1090.t1"; gene_id "g1090"; Scaffold_7 AUGUSTUS CDS 5133292 5133972 0.87 - 0 transcript_id "g1090.t1"; gene_id "g1090"; Scaffold_7 AUGUSTUS start_codon 5133970 5133972 . - 0 transcript_id "g1090.t1"; gene_id "g1090"; # protein sequence = [MGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY # AGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELK # DGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTKRRSFSITLDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1090 ### # start gene g1091 Scaffold_7 AUGUSTUS gene 5134286 5136405 0.99 - . g1091 Scaffold_7 AUGUSTUS transcript 5134286 5136405 0.99 - . g1091.t1 Scaffold_7 AUGUSTUS stop_codon 5134286 5134288 . - 0 transcript_id "g1091.t1"; gene_id "g1091"; Scaffold_7 AUGUSTUS CDS 5134286 5135457 1 - 2 transcript_id "g1091.t1"; gene_id "g1091"; Scaffold_7 AUGUSTUS CDS 5135532 5136405 0.99 - 0 transcript_id "g1091.t1"; gene_id "g1091"; Scaffold_7 AUGUSTUS start_codon 5136403 5136405 . - 0 transcript_id "g1091.t1"; gene_id "g1091"; # protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIV # ESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLN # QTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDN # EKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFKFKSYKV # VLPSKWRRQLNPYERKFRRGDLLNLYCKILVWGRIAINLNPQKPHRINVITKIPSETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEK # VRYESRQRKKGKAQDSKDKKENVQADVVTEPPINKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPD # EFRIERHIHGDPLFELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWLK # GIYLFRQVSSRMCAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1091 ### # start gene g1092 Scaffold_7 AUGUSTUS gene 5136497 5137259 0.6 - . g1092 Scaffold_7 AUGUSTUS transcript 5136497 5137259 0.6 - . g1092.t1 Scaffold_7 AUGUSTUS stop_codon 5136497 5136499 . - 0 transcript_id "g1092.t1"; gene_id "g1092"; Scaffold_7 AUGUSTUS CDS 5136497 5137051 0.86 - 0 transcript_id "g1092.t1"; gene_id "g1092"; Scaffold_7 AUGUSTUS CDS 5137101 5137259 0.6 - 0 transcript_id "g1092.t1"; gene_id "g1092"; Scaffold_7 AUGUSTUS start_codon 5137257 5137259 . - 0 transcript_id "g1092.t1"; gene_id "g1092"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAKHTEKMMSVCSTKIVQMEKKSTPMK # EQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIP # SSRPTNQINSEHRPYDHVQPRTYRPIQINTLRRYQETRRIKLIVMDILQPIKLGMKSRDQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1092 ### # start gene g1093 Scaffold_7 AUGUSTUS gene 5137354 5139974 0.22 - . g1093 Scaffold_7 AUGUSTUS transcript 5137354 5139974 0.22 - . g1093.t1 Scaffold_7 AUGUSTUS stop_codon 5137354 5137356 . - 0 transcript_id "g1093.t1"; gene_id "g1093"; Scaffold_7 AUGUSTUS CDS 5137354 5138957 0.52 - 2 transcript_id "g1093.t1"; gene_id "g1093"; Scaffold_7 AUGUSTUS CDS 5139959 5139974 0.28 - 0 transcript_id "g1093.t1"; gene_id "g1093"; Scaffold_7 AUGUSTUS start_codon 5139972 5139974 . - 0 transcript_id "g1093.t1"; gene_id "g1093"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRMELSGHVSCASRQIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1093 ### # start gene g1094 Scaffold_7 AUGUSTUS gene 5149431 5150316 0.46 - . g1094 Scaffold_7 AUGUSTUS transcript 5149431 5150316 0.46 - . g1094.t1 Scaffold_7 AUGUSTUS stop_codon 5149431 5149433 . - 0 transcript_id "g1094.t1"; gene_id "g1094"; Scaffold_7 AUGUSTUS CDS 5149431 5149919 0.91 - 0 transcript_id "g1094.t1"; gene_id "g1094"; Scaffold_7 AUGUSTUS CDS 5150015 5150123 0.78 - 1 transcript_id "g1094.t1"; gene_id "g1094"; Scaffold_7 AUGUSTUS CDS 5150174 5150316 0.46 - 0 transcript_id "g1094.t1"; gene_id "g1094"; Scaffold_7 AUGUSTUS start_codon 5150314 5150316 . - 0 transcript_id "g1094.t1"; gene_id "g1094"; # protein sequence = [MCVVYTVSEGNHAVNVMGPAAAEKALEISKSLIDLAKIESGLDKQVTICFDEWNVWDPVRAPGEKGAEEHYDLSDALA # ALVECFVGKRHLSHYHLPERSLQADDLLSTQTLRHVDARYLPQRARRVTISHRQTVPDWVEKLEKNAGGDEKLTKYIDVSAVLNDSKDEVRLAIVNRH # ATEGYTIPIRFGPACDVSDGKVQVYEVWSADLKDNNGWDGERVQIVEKQLPWSGEYSVKQHSFQRKSPII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1094 ### # start gene g1095 Scaffold_7 AUGUSTUS gene 5153198 5154322 1 + . g1095 Scaffold_7 AUGUSTUS transcript 5153198 5154322 1 + . g1095.t1 Scaffold_7 AUGUSTUS start_codon 5153198 5153200 . + 0 transcript_id "g1095.t1"; gene_id "g1095"; Scaffold_7 AUGUSTUS CDS 5153198 5154322 1 + 0 transcript_id "g1095.t1"; gene_id "g1095"; Scaffold_7 AUGUSTUS stop_codon 5154320 5154322 . + 0 transcript_id "g1095.t1"; gene_id "g1095"; # protein sequence = [MGIAESISAVGIAGTVTGLSYTQATAQQKEEEEEAKRAADEAAQATALPTRNNNRNKQRAGADENGPSRGAFPVSGTL # GGGGNGRGPGPGRQKGGGTTADTGGRQDGGNRNTTGRKDGRSGTGKQRAPTEQSNRPNSASQKKKKKDDNRRNQLPSAAEDNVPSSDAQNLPTTVTQS # TTPVKGQRRGGGKKQNASSVPCQTANETEKPAIDSGAVATVQEETAPATAVDNKSVAKTNRRKNGKSRSNTRAPQSSTTSPSLATNTTSPSALSPPPA # QNTSSLHPHPLSNPQVPQNESRARSRKPRGHPHTKADTVAPSQLQSPSSQIVQNPSETQVYTATTTPSASPKLPQARRGKGKGSRRANVERSKPPCRL # RS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1095 ### # start gene g1096 Scaffold_7 AUGUSTUS gene 5162371 5163081 0.34 - . g1096 Scaffold_7 AUGUSTUS transcript 5162371 5163081 0.34 - . g1096.t1 Scaffold_7 AUGUSTUS stop_codon 5162371 5162373 . - 0 transcript_id "g1096.t1"; gene_id "g1096"; Scaffold_7 AUGUSTUS CDS 5162371 5163081 0.34 - 0 transcript_id "g1096.t1"; gene_id "g1096"; Scaffold_7 AUGUSTUS start_codon 5163079 5163081 . - 0 transcript_id "g1096.t1"; gene_id "g1096"; # protein sequence = [MKCGDTVESLISAIYPGLNLLVPLANNDNWFLERTILCPRNDTVDNLNFQCLNTMSGETHTYHSSDRAIMDENADGDF # QYPVEYLNSINGSGLPISHLKLKIGAPLMILRNLDPTAGLCNGTRAILIHCTTRVLEVRLLGGDHAGDTAFIPRITLTPSNLDLPFTLERRQFPVRLA # FAMSINKSQGQSVKQVGLNLQSSVFTHGQLYVALSRSTTKQGVKAIFPEGKVIYYIALYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1096 ### # start gene g1097 Scaffold_7 AUGUSTUS gene 5163423 5166595 0.39 - . g1097 Scaffold_7 AUGUSTUS transcript 5163423 5166595 0.39 - . g1097.t1 Scaffold_7 AUGUSTUS stop_codon 5163423 5163425 . - 0 transcript_id "g1097.t1"; gene_id "g1097"; Scaffold_7 AUGUSTUS CDS 5163423 5164044 0.64 - 1 transcript_id "g1097.t1"; gene_id "g1097"; Scaffold_7 AUGUSTUS CDS 5164167 5166595 0.45 - 0 transcript_id "g1097.t1"; gene_id "g1097"; Scaffold_7 AUGUSTUS start_codon 5166593 5166595 . - 0 transcript_id "g1097.t1"; gene_id "g1097"; # protein sequence = [MDVQCPSCHALHWAAEKLSKSSISHPMFGTCCKSGKVELPMLQNPPQELQHLFDGTDYESKHFLDNIRSYNFAFAFVS # LGLKVQPHNDPNLPTTGPRQYKIKGALWHAMGSLLPETGKDPVYAQLYIVAPETALEQRLANNAHHGTGLRQSVMQTLSDCLSRNNHWITVYKSAYER # ISQLEQETPHAIQAAYVKLQFKDHTDPRRYNMPTADEVAVILPGPGEPTDYRDIILQSRAGPLKRIYETNPAYQPLHYVLLFPRGELGWHPKIKLADN # WPNVGDIASDTKFVSQMEYYAYRLHQRPPKDFADPQPWQESDHLFRAKNLLQQFIVDGWAQTDQERLSFLKHNQSKLRAEVYGGLVDAVHEGDTNFAN # IGMRTILPSSYIGGSRHMYQLYQDSIALARHFGKPDLFCTVTADPNAKEIKDALLPGQTANDRPDLIARVFREKIRKLLKFIDNGCFGKCRGRVHTIE # FQKRGLPHIHILIFLDPDARLQEPHQIDLAISAQLPDPITQPKLFKLVEKLMIHGPCGNLNPNASCMKDGKCTKNFPKTFQEHTVLSEDGYTLYARPN # NGRTCKKKVNGVEIDIDNCWVVPHSIWLLMELIAHVNLECCISIKAFKYIHKYIYKGHDRTTMGIGENNDEIQQHIDSRYVSTSEAVWRLFHYWMHEE # KPNVVRLPVHTEAGRFVVFNPELNAPNEILENATAKNSKLEAYFKLNKAEKEYAYQHPENASTLARSLLYQELPRYFVWVPKTTTWKIRERNDPSIGR # MNFAHPASGRDFISGCFLLLSVVQYHFLTSELIIILNIQHSRKHAFQPLLLWNEFKDHLCDDIQVLLHNSGILDYPSQDEIFDYGLYLIDKILFHAGL # TQGLKEFIGMPLPNYEFWINVEGNRLIVEQLAFNANDQRQLANENIAKLNTEQAHAFNTIQNAVYNNASKMFFLHGPAGTGKTFTYNTLCYYLRADKK # IVLCCASSGLAALLLKNGRTAHSTFKIPIELYDGKTCHVPKQGLLADLLRQTSLII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1097 ### # start gene g1098 Scaffold_7 AUGUSTUS gene 5166666 5167022 0.71 + . g1098 Scaffold_7 AUGUSTUS transcript 5166666 5167022 0.71 + . g1098.t1 Scaffold_7 AUGUSTUS start_codon 5166666 5166668 . + 0 transcript_id "g1098.t1"; gene_id "g1098"; Scaffold_7 AUGUSTUS CDS 5166666 5167022 0.71 + 0 transcript_id "g1098.t1"; gene_id "g1098"; Scaffold_7 AUGUSTUS stop_codon 5167020 5167022 . + 0 transcript_id "g1098.t1"; gene_id "g1098"; # protein sequence = [MGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGPMGAIGAIALLIF # LQDEGELPKVEPADYGVGEDTVSLILEHNESDTKILKNGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1098 ### # start gene g1099 Scaffold_7 AUGUSTUS gene 5171126 5171551 0.77 - . g1099 Scaffold_7 AUGUSTUS transcript 5171126 5171551 0.77 - . g1099.t1 Scaffold_7 AUGUSTUS stop_codon 5171126 5171128 . - 0 transcript_id "g1099.t1"; gene_id "g1099"; Scaffold_7 AUGUSTUS CDS 5171126 5171467 0.96 - 0 transcript_id "g1099.t1"; gene_id "g1099"; Scaffold_7 AUGUSTUS CDS 5171549 5171551 0.77 - 0 transcript_id "g1099.t1"; gene_id "g1099"; Scaffold_7 AUGUSTUS start_codon 5171549 5171551 . - 0 transcript_id "g1099.t1"; gene_id "g1099"; # protein sequence = [MATSLILQNDQAAINGIRSTGATQLILAPGNGFTGGHSWTQVTGANDDPSSEWLNQIVDPLNNTAIDIHEYLGTSRFV # VRDGIDGLIDNCVAIDEDFSGSHDTCTQPGEHLKLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1099 ### # start gene g1100 Scaffold_7 AUGUSTUS gene 5177436 5178260 0.98 - . g1100 Scaffold_7 AUGUSTUS transcript 5177436 5178260 0.98 - . g1100.t1 Scaffold_7 AUGUSTUS stop_codon 5177436 5177438 . - 0 transcript_id "g1100.t1"; gene_id "g1100"; Scaffold_7 AUGUSTUS CDS 5177436 5178260 0.98 - 0 transcript_id "g1100.t1"; gene_id "g1100"; Scaffold_7 AUGUSTUS start_codon 5178258 5178260 . - 0 transcript_id "g1100.t1"; gene_id "g1100"; # protein sequence = [MLADSYYWPHMRRDLYKYYVPGCEDCQRNKGRTAKNGKGPLHPLPVPEGRCDSVAMDFIGPLPLDQGFDCILTMTDRL # GSDLKIIPTNIDITAPALARLVFDHWYCDNGLPSEWVSDRDKLFVSEFWSVLNKLSGVKIKMSSSFHPETDGSSERSNKTVNQAIRFYVERNQVGWVN # ALPKIRFDIMNSVNTSTGLSMFQLRYGRAPRVLPPLVPVDVCSGPNPSDNAFDAHAFLAEIAETVQEAQDNLTLAKVVQAYQADKVRGPCELFEAGEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1100 ### # start gene g1101 Scaffold_7 AUGUSTUS gene 5194426 5196038 0.5 + . g1101 Scaffold_7 AUGUSTUS transcript 5194426 5196038 0.5 + . g1101.t1 Scaffold_7 AUGUSTUS start_codon 5194426 5194428 . + 0 transcript_id "g1101.t1"; gene_id "g1101"; Scaffold_7 AUGUSTUS CDS 5194426 5194577 0.5 + 0 transcript_id "g1101.t1"; gene_id "g1101"; Scaffold_7 AUGUSTUS CDS 5194649 5196038 0.99 + 1 transcript_id "g1101.t1"; gene_id "g1101"; Scaffold_7 AUGUSTUS stop_codon 5196036 5196038 . + 0 transcript_id "g1101.t1"; gene_id "g1101"; # protein sequence = [MEDVVGQILKRKEFQGKVGAVWMTKDWASEEVNEELRIERAVKKEGDGKIEAQLSHSNDFSTSDPAQVPDVFTSFRKS # FEPLRDNIRVPHCSTHSNLPPIPPKVPTQAAPFTIPTSLDDFISSLQKPVQDCGLGPPILKPQGASTAHPFIGGETSAHERILHLLVSGSLSTYKDTR # NGLLGEDFSTKLSAYLALGCVTARQANAYMVAFEDGKDLPDFGIRLNTEVNLANAKGFGKGENKGTAAVRFELLWRDYMRLCMRKFGSELFSIEGFGE # RSRRRGPEDVQYRKNKPNSDISYHWSNLSSPETRCAFDRFIRGETGTGLIDASMRELALTGYTSNRTRQNCASFLAKWLGIDWRLGAEWYECMLIDHD # VANNWGNWAYVAGVGNDPRGRDASGGGGTEGRKFNPVKQAWDYDRNGDYVKAWIAEFEGVPSGKDLGDGKKGWRDVLFQGWKVDEIFRHTKDQREREL # REKLKRLEWVNRPLVKIRYQPKDQAQGKRGSDAKRGGTQGTRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1101 ### # start gene g1102 Scaffold_7 AUGUSTUS gene 5196294 5196686 0.91 + . g1102 Scaffold_7 AUGUSTUS transcript 5196294 5196686 0.91 + . g1102.t1 Scaffold_7 AUGUSTUS start_codon 5196294 5196296 . + 0 transcript_id "g1102.t1"; gene_id "g1102"; Scaffold_7 AUGUSTUS CDS 5196294 5196686 0.91 + 0 transcript_id "g1102.t1"; gene_id "g1102"; Scaffold_7 AUGUSTUS stop_codon 5196684 5196686 . + 0 transcript_id "g1102.t1"; gene_id "g1102"; # protein sequence = [MFSRSRILTSGCYKSLSKRGVFPIPQFYSITTATEVNTSNAPVPTRAQKNEGAILDFFSTLDPNVSHDLPARFSDLKA # EIWNESLLESWKEVLAELETETERIASLGSQVRYMDQRCNFIVDSSLISFLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1102 ### # start gene g1103 Scaffold_7 AUGUSTUS gene 5204183 5204767 0.45 - . g1103 Scaffold_7 AUGUSTUS transcript 5204183 5204767 0.45 - . g1103.t1 Scaffold_7 AUGUSTUS stop_codon 5204183 5204185 . - 0 transcript_id "g1103.t1"; gene_id "g1103"; Scaffold_7 AUGUSTUS CDS 5204183 5204767 0.45 - 0 transcript_id "g1103.t1"; gene_id "g1103"; Scaffold_7 AUGUSTUS start_codon 5204765 5204767 . - 0 transcript_id "g1103.t1"; gene_id "g1103"; # protein sequence = [MDEQGGAPLSATRKLGILARAVSGGSSSRPLNRTISSMSTAAWRSPLSDEDGDFENSAAQVPSPVSTNITPGYGLGFG # ESSSSGHGQDVGRSSSHGHHSGSAESSGSTYNASSIQSSRSQGFNMPGFGQAAETMRMGPPMSAKDVSSHGHSTLLNQDHSHSTGTISSMKFNTSNNH # ATILQVKVQGRQIRIRIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1103 ### # start gene g1104 Scaffold_7 AUGUSTUS gene 5205274 5205702 0.77 + . g1104 Scaffold_7 AUGUSTUS transcript 5205274 5205702 0.77 + . g1104.t1 Scaffold_7 AUGUSTUS start_codon 5205274 5205276 . + 0 transcript_id "g1104.t1"; gene_id "g1104"; Scaffold_7 AUGUSTUS CDS 5205274 5205702 0.77 + 0 transcript_id "g1104.t1"; gene_id "g1104"; Scaffold_7 AUGUSTUS stop_codon 5205700 5205702 . + 0 transcript_id "g1104.t1"; gene_id "g1104"; # protein sequence = [MLNGRPYDGRVKVLDGDMKEVDEAEVVKVFDEEFGVKGGVDEGLINDVENGVEEDISEGDEELMDVVDGTVGEVKVEL # KVFDEELVKVVDKKVEEAGAVVDTVTDVLVGANPLVVDALVTAAPKELAGNQLNWIYNCITYST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1104 ### # start gene g1105 Scaffold_7 AUGUSTUS gene 5209874 5212168 0.6 - . g1105 Scaffold_7 AUGUSTUS transcript 5209874 5212168 0.6 - . g1105.t1 Scaffold_7 AUGUSTUS stop_codon 5209874 5209876 . - 0 transcript_id "g1105.t1"; gene_id "g1105"; Scaffold_7 AUGUSTUS CDS 5209874 5210455 0.93 - 0 transcript_id "g1105.t1"; gene_id "g1105"; Scaffold_7 AUGUSTUS CDS 5211897 5211916 0.77 - 2 transcript_id "g1105.t1"; gene_id "g1105"; Scaffold_7 AUGUSTUS CDS 5211979 5212168 0.82 - 0 transcript_id "g1105.t1"; gene_id "g1105"; Scaffold_7 AUGUSTUS start_codon 5212166 5212168 . - 0 transcript_id "g1105.t1"; gene_id "g1105"; # protein sequence = [MADSKFLSTEDTLKYSSRQASDKRSGLISKDSESSGIASLNTRKPKLPLGWRIAILTLTCLASFGNHWSNCVTPAPQV # EIIRSIIADPQWFATAFAIKSKSFSVWAILTFNRTINRIESVVQASIVIITTAAGKLQDDTANDSLDPAVTLWLVYAFVCTAVSGALWVVANWFPTLL # PAARLSQVKPSRMQEEVKMLLARRAHISSVESDMNIARVDEGEKEDDADDDGEFEEKKLLSDEKALKKANQAWTECGGSSLLLQQAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1105 ### # start gene g1106 Scaffold_7 AUGUSTUS gene 5220131 5221198 0.92 - . g1106 Scaffold_7 AUGUSTUS transcript 5220131 5221198 0.92 - . g1106.t1 Scaffold_7 AUGUSTUS stop_codon 5220131 5220133 . - 0 transcript_id "g1106.t1"; gene_id "g1106"; Scaffold_7 AUGUSTUS CDS 5220131 5221198 0.92 - 0 transcript_id "g1106.t1"; gene_id "g1106"; Scaffold_7 AUGUSTUS start_codon 5221196 5221198 . - 0 transcript_id "g1106.t1"; gene_id "g1106"; # protein sequence = [MNANLTDSSQAPQKAEFWDVDASSAETKLNPGRLKDQMFAYTVTNQIVNTFVEIGLPYVLRKITAFRTKKAVPSNGTG # SSLGKKKVVFEDEKEKGGQAEKEFLDQARAEAALPEYDVFGDYSEMVIQFGYVALWSTIWPLAPVMALLNNLLELRSDAFKITVHERRPTPVRTDTIG # PWLEALAFLSWLAALTNSALVYLFCPREHSQCTSSDFGGSESAIERVHRHLVATAGKEGIDGIWGEHGKGLGATKELLVMALLVALTASHGYLIVRSI # MRHVMERLLWKGSEEVKERERDERMVKEVFLKGLGGGVGVEVDVDGNGFKNFNVANSNVEGVGFWDHDEGMDEINRISKEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1106 ### # start gene g1107 Scaffold_7 AUGUSTUS gene 5228754 5229317 1 - . g1107 Scaffold_7 AUGUSTUS transcript 5228754 5229317 1 - . g1107.t1 Scaffold_7 AUGUSTUS stop_codon 5228754 5228756 . - 0 transcript_id "g1107.t1"; gene_id "g1107"; Scaffold_7 AUGUSTUS CDS 5228754 5229317 1 - 0 transcript_id "g1107.t1"; gene_id "g1107"; Scaffold_7 AUGUSTUS start_codon 5229315 5229317 . - 0 transcript_id "g1107.t1"; gene_id "g1107"; # protein sequence = [MKPFYGLKVSSKPLLEWHAFATIPDEDANGKPDGFSIVVSNAGDWTNDVIQNPPKKLWVRGYPLHGLLYTSKLFRKIV # VVATGSGIGPPLSLFYADFTPRRIFWSTPAPETTYGSKVIDMVKKADPDAWIWDTRKQGRPDMVAVTYKLVAESGAEAVFIISNPKLTRKVVYGMESR # GIPAYGAIFDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1107 ### # start gene g1108 Scaffold_7 AUGUSTUS gene 5232215 5234365 0.64 + . g1108 Scaffold_7 AUGUSTUS transcript 5232215 5234365 0.64 + . g1108.t1 Scaffold_7 AUGUSTUS start_codon 5232215 5232217 . + 0 transcript_id "g1108.t1"; gene_id "g1108"; Scaffold_7 AUGUSTUS CDS 5232215 5234365 0.64 + 0 transcript_id "g1108.t1"; gene_id "g1108"; Scaffold_7 AUGUSTUS stop_codon 5234363 5234365 . + 0 transcript_id "g1108.t1"; gene_id "g1108"; # protein sequence = [MSTNQVNVPIFPEESKLTGKDSWSRFKAAVELTAQLRGYTGYLDGTIVKPASSLYSSAAGSVYPSVTATPAYSPTPYP # EEWYMRDRFVAATINLNTVDATGLGIDLDKSAANIWKDLMEKFERKDEQLIYLADHALRTEKFDPDSCTMEDHEKKMKNLKKKLTDVGGTLTDAQFRI # IILASVPTDWKPETRNVPGKGSDEAFIHLYTVYLERKSESNEIEQSNKVRALIAKEILAAIPAQNQSTIAATTGTRHEHLICSNPPCPSKISHTLKKC # WAKGGGSEGKAPAWWYKKYNQEPPTSVNSTSPIDTFTLSARTSHSTSTQTHPDSQRNRNSRPILNQTISQGGSEDSSRDVPVSFRKPMPLDGCTVFSS # NRCSLSAKPVRTYIDSGASEHCWVDRHDFTVYQAVVNQGGLTAVAGSSFRIEGVGTVEFLTRVGGKDRIVQLTGVKHTPLFGHNLISLMTLDHKGLRG # VWGGRRITVANRDGNIVLSGTGTESTNSTAGGKMYEVEVLEKPTALANSARSHEKAVDIHTWHRRLGHVGIPRILRMSSKNLVDGLKITSKKVEGMCE # SCLYGKATRRPFDEKVIHESEVLERIHIDLWGQSRTKSRGGATWMILFTDGRSTLKVPDFLNNKQAATTLKSFHRYCLKAELETGKKVKCIRIDGGKE # LDNSLMENYCGEKGLKLKGFPRIHRRLMEWLKEPIGQSFRVYVLCWMNPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1108 ### # start gene g1109 Scaffold_7 AUGUSTUS gene 5234590 5236135 0.36 + . g1109 Scaffold_7 AUGUSTUS transcript 5234590 5236135 0.36 + . g1109.t1 Scaffold_7 AUGUSTUS start_codon 5234590 5234592 . + 0 transcript_id "g1109.t1"; gene_id "g1109"; Scaffold_7 AUGUSTUS CDS 5234590 5235413 0.36 + 0 transcript_id "g1109.t1"; gene_id "g1109"; Scaffold_7 AUGUSTUS CDS 5235523 5236135 0.6 + 1 transcript_id "g1109.t1"; gene_id "g1109"; Scaffold_7 AUGUSTUS stop_codon 5236133 5236135 . + 0 transcript_id "g1109.t1"; gene_id "g1109"; # protein sequence = [MDRRGYRLWIPEWRVVLENRDVRFEEGQPNRTFSRQLDTGNVLGDTGDGGTSGITEDLRGFDVEELDVDDMTPEPQDP # PAAVPPIPMHGEFAPEFLPPADDDEPRDLPPAAIPEFDNPALPELPLIPPPVHAQPLRRSARFKIPSTRYLESKEFEDREKEANDQGRDWATETAFTR # ICADPWSFAMSTEVDSIPSGYKQAMKHPELWREPMELEYKMLMAKNVWTLVELPPGANLMGGKWVFAIKRGPSGEIIRRKARYVAQGFTQVFGLDYEK # TPITHDVYMKQPEGFIQPGCENLVCKLQRSIYGTMQGSHDWQATLASGFKEDGYTSSRADPCIRSRRRGGEYVITSTYGDDICGGASSEPERQEAITD # LGKRWESDEVGSGMLLGMSISQDPSTRAITISQQGYFTRMLQHFGLQDIQPRKTPLPVGIQLEQSPGTLPNDERIFMANKPFRELLGSLMWGSTCTRA # DIAFATDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1109 ### # start gene g1110 Scaffold_7 AUGUSTUS gene 5239743 5240648 0.52 + . g1110 Scaffold_7 AUGUSTUS transcript 5239743 5240648 0.52 + . g1110.t1 Scaffold_7 AUGUSTUS start_codon 5239743 5239745 . + 0 transcript_id "g1110.t1"; gene_id "g1110"; Scaffold_7 AUGUSTUS CDS 5239743 5240648 0.52 + 0 transcript_id "g1110.t1"; gene_id "g1110"; Scaffold_7 AUGUSTUS stop_codon 5240646 5240648 . + 0 transcript_id "g1110.t1"; gene_id "g1110"; # protein sequence = [MNQLINDVFGDPYITLTCDGGECLHYSQVPGYVRPPKPDNTRWVALNALGACLFVVLVALLLWYVGRTGSGGDYGFLK # KGSGGGIRLPESEEDSENESAKLMAEHVPASMHFDDLSYVLNSKTILSGISGAVKPGQVMAIMGASGAGKSTLLDILARKSKRGTVGGEILINGRIVS # DAEFRAVTGYVDQEDTLMSTLTVYETVLYSALLRLPREMSEDAKKFRTLETLNELGILGIKDMRIGSSGHRSISGGEKRRVSIACELVTSPSILFLDE # PTSGLDAFNAFNVIDSLVSLARIIIGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1110 ### # start gene g1111 Scaffold_7 AUGUSTUS gene 5257559 5258470 0.22 + . g1111 Scaffold_7 AUGUSTUS transcript 5257559 5258470 0.22 + . g1111.t1 Scaffold_7 AUGUSTUS start_codon 5257559 5257561 . + 0 transcript_id "g1111.t1"; gene_id "g1111"; Scaffold_7 AUGUSTUS CDS 5257559 5257750 0.38 + 0 transcript_id "g1111.t1"; gene_id "g1111"; Scaffold_7 AUGUSTUS CDS 5257878 5257922 0.49 + 0 transcript_id "g1111.t1"; gene_id "g1111"; Scaffold_7 AUGUSTUS CDS 5257979 5258470 0.9 + 0 transcript_id "g1111.t1"; gene_id "g1111"; Scaffold_7 AUGUSTUS stop_codon 5258468 5258470 . + 0 transcript_id "g1111.t1"; gene_id "g1111"; # protein sequence = [MNHTAIVANLSQVKDDIAFLGSSPSTDNIVFNLGETNIDFTNLNMDQFGEYGSFDSLRKADVTSSINRIYLHQGTTFG # YAAWQPIATTSSPAKVRTPWYGLKFAAEAIGSHQGPIQIAPLDIVVVTSNLSFTNTNTTAFGNSTQTQIVPAQQLLTSEKISAYAVYESSSLARIALI # NFNEWNGTTPYPRPSTVFRIVLPPSNSDNTGNSNSSQPNSVSTRLLTAPNGASADSDLTFGGIMWN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1111 ### # start gene g1112 Scaffold_7 AUGUSTUS gene 5258889 5259860 0.69 - . g1112 Scaffold_7 AUGUSTUS transcript 5258889 5259860 0.69 - . g1112.t1 Scaffold_7 AUGUSTUS stop_codon 5258889 5258891 . - 0 transcript_id "g1112.t1"; gene_id "g1112"; Scaffold_7 AUGUSTUS CDS 5258889 5259860 0.69 - 0 transcript_id "g1112.t1"; gene_id "g1112"; Scaffold_7 AUGUSTUS start_codon 5259858 5259860 . - 0 transcript_id "g1112.t1"; gene_id "g1112"; # protein sequence = [MLQLQFFLHANLVSQFVASETSLLSPFTLFLTPVSLPPTPVYAACLQAGVAWPQWIRALGGNALYVCVMENSLKVRIG # ETGDVVTVWSTEPRDAPATSTKIQTSNECESPMALKLRAMLDSVRTRSSSADTPRKSIALPTSCLSHADVDANDSDSESDTESTTSSSLFSETSSTDY # MSSISSAVSSPVSKTSNLPVEKAPVYVPRHRRNIATAPPAPAQVDSSLPQRLSRSQRRLARTTVDKAKVDVCRYTYQGGQTLVMTGGVMLGGVKPAVI # TTATKATKSYGNTTQFAQTVLTTATRPSATKKSSAMLGSDSSRNWRARV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1112 ### # start gene g1113 Scaffold_7 AUGUSTUS gene 5269216 5269887 0.94 - . g1113 Scaffold_7 AUGUSTUS transcript 5269216 5269887 0.94 - . g1113.t1 Scaffold_7 AUGUSTUS stop_codon 5269216 5269218 . - 0 transcript_id "g1113.t1"; gene_id "g1113"; Scaffold_7 AUGUSTUS CDS 5269216 5269887 0.94 - 0 transcript_id "g1113.t1"; gene_id "g1113"; Scaffold_7 AUGUSTUS start_codon 5269885 5269887 . - 0 transcript_id "g1113.t1"; gene_id "g1113"; # protein sequence = [MFTPHSKFPTVSRSAMLPLRLFFALFLSLSSLLLIAVAAPVTDVPEQSNKSIGRESDISKTLCYSSNIHSPAQTYEIR # LIRMRRVDGKELEITDIQEPVRSDEIWSLKIGSDEFRAVRQPSGKWQGMVIVNLLGDKTGILLASATFPSIEKWKDVETKFRGMSSTSNLEYLNVILA # ALKGEKYLHNLNALWRYRDSYDNLSGFYWQMGARGGDAGGTLLYEHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1113 ### # start gene g1114 Scaffold_7 AUGUSTUS gene 5281567 5282946 0.99 + . g1114 Scaffold_7 AUGUSTUS transcript 5281567 5282946 0.99 + . g1114.t1 Scaffold_7 AUGUSTUS start_codon 5281567 5281569 . + 0 transcript_id "g1114.t1"; gene_id "g1114"; Scaffold_7 AUGUSTUS CDS 5281567 5282946 0.99 + 0 transcript_id "g1114.t1"; gene_id "g1114"; Scaffold_7 AUGUSTUS stop_codon 5282944 5282946 . + 0 transcript_id "g1114.t1"; gene_id "g1114"; # protein sequence = [MLAEVWPEEFGASKSSKRRRPAERKSVPKTIQETPVVSVDSSSIPALADLVVEPAVARSLELGNTDEIELLIPSKAPQ # IMNVLRAHNPFPDTGLPLLKVVLKQVFKNDTETLDLSGFSLSPNQLASVASEMNDARIIILSHSSVVTVEHVRALLAVKPEIDRLELLDTGVTNDAFS # SLLKTDPDIFKCVSDVVHHHLVSSRHTNPGSFHVIASQAGSYVRYGGRGSGGNIQSIPIWTPAKIIQNLIDILKMLVTDDLASMEPTQSILIPAALSA # GLRKPGTSWNDRTVPMVARDRGRVHHGGWMFLFNRANTPRGSAPGGKYAFVRLLTDQDCQAVDAFDLNGFLEEMKKEGRAPLPSTEAVKEFEDIVANR # GKNQENTKKTEGSGMEGAPQTMEHIMRFLMAGMNMGGGSTDAPKSGVSLFDTDSATKFVLNFIAPNAEGNSQGMEGMRGPRIVLAGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1114 ### # start gene g1115 Scaffold_7 AUGUSTUS gene 5284817 5286442 0.34 - . g1115 Scaffold_7 AUGUSTUS transcript 5284817 5286442 0.34 - . g1115.t1 Scaffold_7 AUGUSTUS stop_codon 5284817 5284819 . - 0 transcript_id "g1115.t1"; gene_id "g1115"; Scaffold_7 AUGUSTUS CDS 5284817 5286442 0.34 - 0 transcript_id "g1115.t1"; gene_id "g1115"; Scaffold_7 AUGUSTUS start_codon 5286440 5286442 . - 0 transcript_id "g1115.t1"; gene_id "g1115"; # protein sequence = [MPPSWDSNTHPLSSVPPTPGQLGRLPNAAANSSQSLSWDMMTDHEFDTLVATTMNNFQAPDWVDNTPVGVNIADMGDE # FMEPLPAPAVQHIGLGCISSPPIINESSNSTLGPQVSGSTDITMSDSTSGPTTSAPTAPTTLPPLIDTVNPTVPPPTTTCDTTVPDPVNAAPTATDAL # FTVHGISTVESSSSSPNIVSTVTNPLTPGHSIPPLELTSLSSNPAVGDKPNGPALLAALLTQEPALTGPETGSPDDVFADGTPTSDVRAEVNANGREP # SSSGPNHVSALGSNPAVGDKPNGPALLAALLTQEPALTGPETGSPDDVFADGTPTSDVRAEVNANGREPSSSSPNHVSALGSNPAVGGNPTGPALLAA # LLAKEPAILTSLESGTHENISADSTPTAASVATEINMKGKIGNSRSKGTRTAKSNKISNAPSKPLSHMGMQDTNKDNTNSGNIKIIVGHGKIKVTVNK # VDKPGDALASAKENTLPSLTESSSRPKRTYNEPPSREPITIHERNARMMQKRTAQDAGLNNAILSKKAKLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1115 ### # start gene g1116 Scaffold_7 AUGUSTUS gene 5289629 5290027 0.69 + . g1116 Scaffold_7 AUGUSTUS transcript 5289629 5290027 0.69 + . g1116.t1 Scaffold_7 AUGUSTUS start_codon 5289629 5289631 . + 0 transcript_id "g1116.t1"; gene_id "g1116"; Scaffold_7 AUGUSTUS CDS 5289629 5290027 0.69 + 0 transcript_id "g1116.t1"; gene_id "g1116"; Scaffold_7 AUGUSTUS stop_codon 5290025 5290027 . + 0 transcript_id "g1116.t1"; gene_id "g1116"; # protein sequence = [MNAPVFMTRLNFSLEKAREIYAEFKFLCGDSRAKFFGPLYDEFVATYNLDNAADAKETTIKLLCYEMGVRHEQIEAYA # KPHDEDIVDEVLAYVCELDAWKEDIEDFNHFAFLGMQTLTDELNSGTIRRLFLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1116 ### # start gene g1117 Scaffold_7 AUGUSTUS gene 5294769 5295263 0.43 + . g1117 Scaffold_7 AUGUSTUS transcript 5294769 5295263 0.43 + . g1117.t1 Scaffold_7 AUGUSTUS start_codon 5294769 5294771 . + 0 transcript_id "g1117.t1"; gene_id "g1117"; Scaffold_7 AUGUSTUS CDS 5294769 5295263 0.43 + 0 transcript_id "g1117.t1"; gene_id "g1117"; Scaffold_7 AUGUSTUS stop_codon 5295261 5295263 . + 0 transcript_id "g1117.t1"; gene_id "g1117"; # protein sequence = [MEKFDDTVLEVEECILESKAFLEYYRHEIPAYLVHDNEDISDNVDHHSSDSAPPPESIHFLNIHMPDTNSSGSDTFYF # SGSTELDFDSVSDDDSSDADVSSITAYLNNLSDSDESSVTASILPSSSPILSSDDATIAFDIDDFLTEVDEVADTSLFTEKFTMDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1117 ### # start gene g1118 Scaffold_7 AUGUSTUS gene 5297429 5298142 0.39 + . g1118 Scaffold_7 AUGUSTUS transcript 5297429 5298142 0.39 + . g1118.t1 Scaffold_7 AUGUSTUS start_codon 5297429 5297431 . + 0 transcript_id "g1118.t1"; gene_id "g1118"; Scaffold_7 AUGUSTUS CDS 5297429 5298142 0.39 + 0 transcript_id "g1118.t1"; gene_id "g1118"; Scaffold_7 AUGUSTUS stop_codon 5298140 5298142 . + 0 transcript_id "g1118.t1"; gene_id "g1118"; # protein sequence = [MLSSVMIKHSNAILVVCLEDGPSKLQTVTITTLSNWPINVVPRISLSPESQWQVVRDMNASSLRPWLIYVLERSKPIV # YTYIFIHFCSRYIIMDYVNIRSLHVNPPLRLTLSYDVMCQYSKKFEQRIKSYGDLLPLPDSLSVSDMQLLIPKFHLMGHQNSCRHQFAFNYANGTGKT # DGESVERVWAESNTLAGSTKKMGPGSRRDTLDDHWNDWNWRKSITLGEFAKHVDDKSPFLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1118 ### # start gene g1119 Scaffold_7 AUGUSTUS gene 5298706 5299297 0.73 + . g1119 Scaffold_7 AUGUSTUS transcript 5298706 5299297 0.73 + . g1119.t1 Scaffold_7 AUGUSTUS start_codon 5298706 5298708 . + 0 transcript_id "g1119.t1"; gene_id "g1119"; Scaffold_7 AUGUSTUS CDS 5298706 5298751 0.75 + 0 transcript_id "g1119.t1"; gene_id "g1119"; Scaffold_7 AUGUSTUS CDS 5298810 5299297 0.76 + 2 transcript_id "g1119.t1"; gene_id "g1119"; Scaffold_7 AUGUSTUS stop_codon 5299295 5299297 . + 0 transcript_id "g1119.t1"; gene_id "g1119"; # protein sequence = [MPVTTVLRAESESRLPAGDIQLFLPGAVFDAGRTCDVKLIDTEWRLRFAAAHDELEKIRKYMISRTCIINYKQKYGHG # QREGTRTATALDSLDLKIQACAARYRMHYNMIVRYSDTLGKSNIWHDTLRPLKDTDMRDLDGSVKDCLDGARVSWIWLSTPKDVASDEHINDCKSFGV # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1119 ### # start gene g1120 Scaffold_7 AUGUSTUS gene 5308706 5309149 0.44 + . g1120 Scaffold_7 AUGUSTUS transcript 5308706 5309149 0.44 + . g1120.t1 Scaffold_7 AUGUSTUS start_codon 5308706 5308708 . + 0 transcript_id "g1120.t1"; gene_id "g1120"; Scaffold_7 AUGUSTUS CDS 5308706 5309149 0.44 + 0 transcript_id "g1120.t1"; gene_id "g1120"; Scaffold_7 AUGUSTUS stop_codon 5309147 5309149 . + 0 transcript_id "g1120.t1"; gene_id "g1120"; # protein sequence = [MESIPVVRAADNAKAGIGTVYLSETDSCLVFGIDTKFTQEFAPRMQIQLGKVAKYAAAEVIEVVSDTELRIRQEFKVA # NDSGNDTSTTLLRDKVAALRSAGNEGGLEFKTVPYINQQEMYRYVYDRLRHGGSLGIFPEGTLPFFLSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1120 ### # start gene g1121 Scaffold_7 AUGUSTUS gene 5310542 5310892 0.96 + . g1121 Scaffold_7 AUGUSTUS transcript 5310542 5310892 0.96 + . g1121.t1 Scaffold_7 AUGUSTUS start_codon 5310542 5310544 . + 0 transcript_id "g1121.t1"; gene_id "g1121"; Scaffold_7 AUGUSTUS CDS 5310542 5310892 0.96 + 0 transcript_id "g1121.t1"; gene_id "g1121"; Scaffold_7 AUGUSTUS stop_codon 5310890 5310892 . + 0 transcript_id "g1121.t1"; gene_id "g1121"; # protein sequence = [MPSASTPPSAGTSSLWRRKTNVGAVDAQGLGLVHPMTWLDERLFGWSEYTTGGLQEDEVRADDEDGDAGDYEDVVSKY # DELVKGNDGGLRTNLYTELRQRRLDSDAAITHAGIMEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1121 ### # start gene g1122 Scaffold_7 AUGUSTUS gene 5312414 5313094 0.44 - . g1122 Scaffold_7 AUGUSTUS transcript 5312414 5313094 0.44 - . g1122.t1 Scaffold_7 AUGUSTUS stop_codon 5312414 5312416 . - 0 transcript_id "g1122.t1"; gene_id "g1122"; Scaffold_7 AUGUSTUS CDS 5312414 5313094 0.44 - 0 transcript_id "g1122.t1"; gene_id "g1122"; Scaffold_7 AUGUSTUS start_codon 5313092 5313094 . - 0 transcript_id "g1122.t1"; gene_id "g1122"; # protein sequence = [MLLTPHNNDAGRLSRSASHPHLGPVSAACDDELFDTASLLSESQIYQDNHGDDEGGDDDEEMEFDWDAIREIEDEDED # EDEGPEEEEEFQFVPARWDDKAMGGDDDEDNEEGVEEENTEQSEYVSEDKDQDQGDLVFPIPVKCEWMYQVAENAPLLACNFPARSLSEAKIHANRHA # RNNATKLSDEKEMLVVNCRWRGCDFDKYKLNEYITHFSVHLLLAAREYCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1122 ### # start gene g1123 Scaffold_7 AUGUSTUS gene 5318026 5320278 0.46 - . g1123 Scaffold_7 AUGUSTUS transcript 5318026 5320278 0.46 - . g1123.t1 Scaffold_7 AUGUSTUS stop_codon 5318026 5318028 . - 0 transcript_id "g1123.t1"; gene_id "g1123"; Scaffold_7 AUGUSTUS CDS 5318026 5320278 0.46 - 0 transcript_id "g1123.t1"; gene_id "g1123"; Scaffold_7 AUGUSTUS start_codon 5320276 5320278 . - 0 transcript_id "g1123.t1"; gene_id "g1123"; # protein sequence = [MRRVGLWVVSGQGCAGLCGPRYRWEEEDAEKTITSMYSADDLSEREQPLPWLWKENTRMRILDAYDFCCVTAHPLSGR # WGHHKKLSDMSDLLGTAYPLPMPESPGGFEGMDRLMAAVGLPSESHTQPRRGILSDDLFQQPEAGPSVIRGHYEVPADLAAVIPKVVQRTSRDKDVAS # PSAPLMKLPYPFTASGAAQVSSDDEKIPFPPSPSVASFKESSSGTKSRSKDHGTVEEEEVEGEEAMEGDDEEAEEAEEVDSGAQTTSEDPSSSSGSGR # ASNSMSSLGHPVSSRYPFQFRHPTRGASYSSGVPSHATPPSNGHSIASRFSQNTRSTGNRESTDSHSPRSHYTTSDAASPISMSGLPMPPRHPQQYQG # RGRARAGTVPVPSVPSSPSIDFPRRARVRTRTSDPYNTSSPEAALWSSDLEHEDELEDDSRVEDSILDSRIEDSIMEQPEPEGSQEAAEGEDVVGLLA # PSGIPSPKTSFSALRHRGSNISSHHRRSFGTGSGSGSRSGSNSRTNSHSGSSSGSRSRTGSISVAMSVRSRAQSLMQNVSSASRSSLELVQGAVRSRA # NSSMARLEEDSPYYSDRTHSRSASGSDGLMSSQENYTFGQPLPFRAHQDQVEEEGRVYEPSSPASQTAGPELHGVHSKQSLAPSSLFAPSERVPPSLH # PSEVTMHQELPNEPSGFAIPVAQRPAGPESMSEQSSPPDISTAAASFVTAPATLGSTDESGRTPPSWNNVTDMVDRSDGTWRPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1123 ### # start gene g1124 Scaffold_7 AUGUSTUS gene 5327042 5327656 0.87 - . g1124 Scaffold_7 AUGUSTUS transcript 5327042 5327656 0.87 - . g1124.t1 Scaffold_7 AUGUSTUS stop_codon 5327042 5327044 . - 0 transcript_id "g1124.t1"; gene_id "g1124"; Scaffold_7 AUGUSTUS CDS 5327042 5327656 0.87 - 0 transcript_id "g1124.t1"; gene_id "g1124"; Scaffold_7 AUGUSTUS start_codon 5327654 5327656 . - 0 transcript_id "g1124.t1"; gene_id "g1124"; # protein sequence = [MDSKSYAKLGAGDSYMVYDLFDSEFSEVAFQKVKEEVEFDIMHHRGNQDHHHRLSSTHFDVAGGEVPRLVAVQGEVAE # DLSFPVYRHPSDESPPLRNFTPTVELIRKEVQKIIRHPVNHALIQYYRSGKDYISEHSDKTIDVVPGSSIVNVSLGAQRTITLRTKKDQVRTDEGLDG # KRYPNAFLYLTAPCLSWASRLTGVGFMQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1124 ### # start gene g1125 Scaffold_7 AUGUSTUS gene 5340670 5341290 0.42 + . g1125 Scaffold_7 AUGUSTUS transcript 5340670 5341290 0.42 + . g1125.t1 Scaffold_7 AUGUSTUS start_codon 5340670 5340672 . + 0 transcript_id "g1125.t1"; gene_id "g1125"; Scaffold_7 AUGUSTUS CDS 5340670 5341290 0.42 + 0 transcript_id "g1125.t1"; gene_id "g1125"; Scaffold_7 AUGUSTUS stop_codon 5341288 5341290 . + 0 transcript_id "g1125.t1"; gene_id "g1125"; # protein sequence = [MTVDVPNYLQTATGSLTSDTIISNVVATLKGSQEPNRIYVVSGHYDSRNTNNSDGINDAPGADDDGSGTAISMELARI # MATHDSKTTIMFACVAGEEQGLFGSNFMAEQLKAAGADVQGMLDNDIVGASKGSTGPAGDTNSIVDPFSIRMFVQGVPTDVETLTQIQSRVSIGAEND # SPARQLGRFAAEVGTNSVTNMTGHSHFFTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1125 ### # start gene g1126 Scaffold_7 AUGUSTUS gene 5343110 5344106 0.72 + . g1126 Scaffold_7 AUGUSTUS transcript 5343110 5344106 0.72 + . g1126.t1 Scaffold_7 AUGUSTUS start_codon 5343110 5343112 . + 0 transcript_id "g1126.t1"; gene_id "g1126"; Scaffold_7 AUGUSTUS CDS 5343110 5343137 0.81 + 0 transcript_id "g1126.t1"; gene_id "g1126"; Scaffold_7 AUGUSTUS CDS 5343223 5344106 0.74 + 2 transcript_id "g1126.t1"; gene_id "g1126"; Scaffold_7 AUGUSTUS stop_codon 5344104 5344106 . + 0 transcript_id "g1126.t1"; gene_id "g1126"; # protein sequence = [MDIVRYTSKVGIPPSELHGSVSSSLILRILPIYAVDILLDEGISIAWKALYETATRSGTQPDILAILLADELDKVQSF # QRPTEVDFLVRAKRDSVPIPGWTYFGFVTGQVMHVSLLFADGTCWAESGDSAGHILTSLVDIIDPNNVDSSICAQFGSDFYARIRTIPTASTPHGCPG # NLVHLFLEETDGYWWGERNGVWEWISQTDVQQLESVFDVCYVVLAQCDFPSQCDFLTRCHCLAYNKGELIRITKECSDGWWWGEMGDNSGWVWWMNVK # GEENISWDIIDADGQSSDDEGYETPEEGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1126 ### # start gene g1127 Scaffold_7 AUGUSTUS gene 5344268 5344990 1 - . g1127 Scaffold_7 AUGUSTUS transcript 5344268 5344990 1 - . g1127.t1 Scaffold_7 AUGUSTUS stop_codon 5344268 5344270 . - 0 transcript_id "g1127.t1"; gene_id "g1127"; Scaffold_7 AUGUSTUS CDS 5344268 5344990 1 - 0 transcript_id "g1127.t1"; gene_id "g1127"; Scaffold_7 AUGUSTUS start_codon 5344988 5344990 . - 0 transcript_id "g1127.t1"; gene_id "g1127"; # protein sequence = [MTSQRPGTGLGFGQIPPSLSTTPSSSSNWQGSRTFIFYTGGKDGIFDYLTQQMQPYKVSSALKYPLPRTELMFGGGLA # FNPELFCAQLGNTDDTQSIPELSTYLSSVLPCYFGENWGDDAESSEEDDRLNWGKGRTKASWSGLIGLSADSNPWVGRVPASLAEGRKLEVDKSQAGL # ADAGEWVCGGYSGEGMVNAWKCGAALAHMILGRCECPEWLPEPYTVSLERHAKAKLDDVLQSYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1127 ### # start gene g1128 Scaffold_7 AUGUSTUS gene 5346770 5347360 0.97 - . g1128 Scaffold_7 AUGUSTUS transcript 5346770 5347360 0.97 - . g1128.t1 Scaffold_7 AUGUSTUS stop_codon 5346770 5346772 . - 0 transcript_id "g1128.t1"; gene_id "g1128"; Scaffold_7 AUGUSTUS CDS 5346770 5347360 0.97 - 0 transcript_id "g1128.t1"; gene_id "g1128"; Scaffold_7 AUGUSTUS start_codon 5347358 5347360 . - 0 transcript_id "g1128.t1"; gene_id "g1128"; # protein sequence = [MTQILTENGANIHAPVWYFGSALQAAAYNSSLEIVKFLVKNGANVNTQGGEYGNPLQAAAYREHLSILRYLLENGADV # NAQGGRYGNALYAAVYMRNLGLTQCLLENGANINAEGGKFGNALEVAAFQGSLDIVKLLVEKGADVNGQGGKYGNALQTAAYGGNLEIVEFLVEQDAD # VNAWEGNMGMPCKLQHIGED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1128 ### # start gene g1129 Scaffold_7 AUGUSTUS gene 5348832 5349143 0.78 - . g1129 Scaffold_7 AUGUSTUS transcript 5348832 5349143 0.78 - . g1129.t1 Scaffold_7 AUGUSTUS stop_codon 5348832 5348834 . - 0 transcript_id "g1129.t1"; gene_id "g1129"; Scaffold_7 AUGUSTUS CDS 5348832 5349143 0.78 - 0 transcript_id "g1129.t1"; gene_id "g1129"; Scaffold_7 AUGUSTUS start_codon 5349141 5349143 . - 0 transcript_id "g1129.t1"; gene_id "g1129"; # protein sequence = [MSRDGQKSTASTPPPTIDIAPVSNSNSRPGLGPTVRSPSNPLTTERNDQNAPSSISENNLNRRVKDGSAPLSSLLGIS # QAHPHTQYSGKRYLISLLKNLLFIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1129 ### # start gene g1130 Scaffold_7 AUGUSTUS gene 5352029 5352505 0.92 + . g1130 Scaffold_7 AUGUSTUS transcript 5352029 5352505 0.92 + . g1130.t1 Scaffold_7 AUGUSTUS start_codon 5352029 5352031 . + 0 transcript_id "g1130.t1"; gene_id "g1130"; Scaffold_7 AUGUSTUS CDS 5352029 5352505 0.92 + 0 transcript_id "g1130.t1"; gene_id "g1130"; Scaffold_7 AUGUSTUS stop_codon 5352503 5352505 . + 0 transcript_id "g1130.t1"; gene_id "g1130"; # protein sequence = [MDSPRSRNHSPSSLNLKREEEKEKRAAEEQKEAEGRARKLAQEKARTVAAKQAQREKEEKARKPAVEEAQREVKKSKR # CMLEERKRVEEQLLEEEETEKQQDDERKKNEAQDMERGRQASSIWGTLVSCYFVLQIFFLREHKSCMKNDESVITDQIFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1130 ### # start gene g1131 Scaffold_7 AUGUSTUS gene 5364823 5365299 0.74 - . g1131 Scaffold_7 AUGUSTUS transcript 5364823 5365299 0.74 - . g1131.t1 Scaffold_7 AUGUSTUS stop_codon 5364823 5364825 . - 0 transcript_id "g1131.t1"; gene_id "g1131"; Scaffold_7 AUGUSTUS CDS 5364823 5365299 0.74 - 0 transcript_id "g1131.t1"; gene_id "g1131"; Scaffold_7 AUGUSTUS start_codon 5365297 5365299 . - 0 transcript_id "g1131.t1"; gene_id "g1131"; # protein sequence = [MHQFLVLPAISKEISHNIEKWANEVKVSNYQLMMSTLSILISFLTIISNVHILRMKNLPYRPDTWMHYDEVIKSSKSS # STEEKVLCRTENFADYHEGFKELFRGAEMTSILEQLTGEPMVLFKEKINYEVDILLISNSKTMIMTISYQQPQAGGIKLM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1131 ### # start gene g1132 Scaffold_7 AUGUSTUS gene 5373157 5373741 1 + . g1132 Scaffold_7 AUGUSTUS transcript 5373157 5373741 1 + . g1132.t1 Scaffold_7 AUGUSTUS start_codon 5373157 5373159 . + 0 transcript_id "g1132.t1"; gene_id "g1132"; Scaffold_7 AUGUSTUS CDS 5373157 5373741 1 + 0 transcript_id "g1132.t1"; gene_id "g1132"; Scaffold_7 AUGUSTUS stop_codon 5373739 5373741 . + 0 transcript_id "g1132.t1"; gene_id "g1132"; # protein sequence = [MNNLKKKKERAEEKDKLRKEAEEKVKARKLAKEKARKRAEEKVRKQAEEKARKEAEEKAWKKAEDKARKLAEDKARKQ # AENKARKEKAQELAAEQAQREEEDKAQKCAAEQAQREAKLEESKRRIAEDWKRVKLEKRLQREGGKAKQQDVKSKGDELARDKQRGRQASSIWGTLVS # CLFCLLKPINIPERDSLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1132 ### # start gene g1133 Scaffold_7 AUGUSTUS gene 5383205 5384155 0.27 + . g1133 Scaffold_7 AUGUSTUS transcript 5383205 5384155 0.27 + . g1133.t1 Scaffold_7 AUGUSTUS start_codon 5383205 5383207 . + 0 transcript_id "g1133.t1"; gene_id "g1133"; Scaffold_7 AUGUSTUS CDS 5383205 5383213 0.27 + 0 transcript_id "g1133.t1"; gene_id "g1133"; Scaffold_7 AUGUSTUS CDS 5383268 5384155 0.91 + 0 transcript_id "g1133.t1"; gene_id "g1133"; Scaffold_7 AUGUSTUS stop_codon 5384153 5384155 . + 0 transcript_id "g1133.t1"; gene_id "g1133"; # protein sequence = [MFRDHEGQNLFANKTSRQFLPVPILNFTRKVAGVIEKVTSIACGDNHIVVLTTHGNVYTWGMSEDGRLGRRVLARHKV # DATVPQKVVLGRRNRKAVYVSAGQNTSFAIDTTGGVWSWGLNSMGHTGTGEPLKERDLSVDQPAKVIGLNFEELGQLDRVVSIAGGEHHTLFLTSQGK # VYACGRCDDGVLGLADDHEALRGEDGCHGRGFVTEPVLVDFPDGSVNDPIVHIAAGPRYNMATTQDGVLFSWGFGPQGELGLGNGMEPEFVPKMVTRR # EGSWSVKHVSCGGQHVIGLFQKRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1133 ### # start gene g1134 Scaffold_7 AUGUSTUS gene 5386197 5386973 0.88 + . g1134 Scaffold_7 AUGUSTUS transcript 5386197 5386973 0.88 + . g1134.t1 Scaffold_7 AUGUSTUS start_codon 5386197 5386199 . + 0 transcript_id "g1134.t1"; gene_id "g1134"; Scaffold_7 AUGUSTUS CDS 5386197 5386973 0.88 + 0 transcript_id "g1134.t1"; gene_id "g1134"; Scaffold_7 AUGUSTUS stop_codon 5386971 5386973 . + 0 transcript_id "g1134.t1"; gene_id "g1134"; # protein sequence = [MSNSVLDIGKSGGEPNLVILVIDSLEECVPDQYAYNSPGKNLVINLLQGLGSGVKQVPNLKVIVSSRPTTVISSQLDG # SNVSSSIVISYDMDKYLSSSDAEEDIQKFYEAELRTIQTQDASIDGKWPSPDVILRLVKQTGNSFLIAQTVCRMVGRADDPEETLNKFLDMPLKEFRS # SGIQDIYTPILEQVVQGLSPGELDPFRKAVMTIVLLRRTMSVEDLAAILGVKAFGLQRSLRGVLSIMVVPAPLSHQKSIAVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1134 ### # start gene g1135 Scaffold_7 AUGUSTUS gene 5387124 5389072 0.37 + . g1135 Scaffold_7 AUGUSTUS transcript 5387124 5389072 0.37 + . g1135.t1 Scaffold_7 AUGUSTUS start_codon 5387124 5387126 . + 0 transcript_id "g1135.t1"; gene_id "g1135"; Scaffold_7 AUGUSTUS CDS 5387124 5387267 0.38 + 0 transcript_id "g1135.t1"; gene_id "g1135"; Scaffold_7 AUGUSTUS CDS 5388647 5389072 0.6 + 0 transcript_id "g1135.t1"; gene_id "g1135"; Scaffold_7 AUGUSTUS stop_codon 5389070 5389072 . + 0 transcript_id "g1135.t1"; gene_id "g1135"; # protein sequence = [MAEQLLQFLNERLRCISNLSEFDEVHEKTFDVLEYRNDSKHKKLNRAVASFYLSLFKAVLDPKTSRRIFELARTQQDE # LDGLDEEIVEDALDEWITRIVNAEDEVEEVDGTEDDQREDAEEIFMSSEYPFVHSSKRNTSSRKSIQTIWRPWTLCYLITSMNEELWPTSYSQSSMKT # SVPFRKYSRKVNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1135 ### # start gene g1136 Scaffold_7 AUGUSTUS gene 5400464 5400832 0.76 - . g1136 Scaffold_7 AUGUSTUS transcript 5400464 5400832 0.76 - . g1136.t1 Scaffold_7 AUGUSTUS stop_codon 5400464 5400466 . - 0 transcript_id "g1136.t1"; gene_id "g1136"; Scaffold_7 AUGUSTUS CDS 5400464 5400832 0.76 - 0 transcript_id "g1136.t1"; gene_id "g1136"; Scaffold_7 AUGUSTUS start_codon 5400830 5400832 . - 0 transcript_id "g1136.t1"; gene_id "g1136"; # protein sequence = [MLDQQLCSQTDIAVQYDQDTERDTGSGYTLILLHATGMHKETWEVFIEHLFDYNLRRESRSSYSTPTPSSHDIDRSGI # WIEDVFSIESPNHGESAIVNEQVLKTTYEDRCMYYVPSMHPCSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1136 ### # start gene g1137 Scaffold_7 AUGUSTUS gene 5425061 5426419 0.9 + . g1137 Scaffold_7 AUGUSTUS transcript 5425061 5426419 0.9 + . g1137.t1 Scaffold_7 AUGUSTUS start_codon 5425061 5425063 . + 0 transcript_id "g1137.t1"; gene_id "g1137"; Scaffold_7 AUGUSTUS CDS 5425061 5426419 0.9 + 0 transcript_id "g1137.t1"; gene_id "g1137"; Scaffold_7 AUGUSTUS stop_codon 5426417 5426419 . + 0 transcript_id "g1137.t1"; gene_id "g1137"; # protein sequence = [MEDSRVLDQFPALDEALSGAPGQVSTSFSPRFPPLFDPSSQSISERFRKVQEDLHNATRERRVAVEKLITSTRKNSQL # RTTLLHQQGLVDESNALATRQRRRVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHRLYRCDPATVLHHH # HRYLGAIIEAVVAFLRRGLDSGDLDVTVHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYRMILEHSRFDSDSPFLTAAHHAGFVPP # PDDSVEPPLHRRMLALSTALPHSDGVGRWEDIVPALPSIDQLTADWEQMMLQYIHHITDTPLSGIATQGPMSSVEPANESLPEVLVRQSPETPAALES # TSSVGPHPQVPLFLPEQGSLTSPSPTLPPLFGSVANLVIDLTGDDDELYETEEVGAGRFSVTREVIDLAASQDVVKDESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1137 ### # start gene g1138 Scaffold_7 AUGUSTUS gene 5427919 5429154 0.31 - . g1138 Scaffold_7 AUGUSTUS transcript 5427919 5429154 0.31 - . g1138.t1 Scaffold_7 AUGUSTUS stop_codon 5427919 5427921 . - 0 transcript_id "g1138.t1"; gene_id "g1138"; Scaffold_7 AUGUSTUS CDS 5427919 5429154 0.31 - 0 transcript_id "g1138.t1"; gene_id "g1138"; Scaffold_7 AUGUSTUS start_codon 5429152 5429154 . - 0 transcript_id "g1138.t1"; gene_id "g1138"; # protein sequence = [MPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVKKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVLDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVI # LECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELL # SGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTSMIEALKRIARNEEESLVWEDGLI # KRGGRIYVPDVGTLRREVLQSYHDHKLRGHRGRNAPGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1138 ### # start gene g1139 Scaffold_7 AUGUSTUS gene 5431988 5432773 0.69 - . g1139 Scaffold_7 AUGUSTUS transcript 5431988 5432773 0.69 - . g1139.t1 Scaffold_7 AUGUSTUS stop_codon 5431988 5431990 . - 0 transcript_id "g1139.t1"; gene_id "g1139"; Scaffold_7 AUGUSTUS CDS 5431988 5432773 0.69 - 0 transcript_id "g1139.t1"; gene_id "g1139"; Scaffold_7 AUGUSTUS start_codon 5432771 5432773 . - 0 transcript_id "g1139.t1"; gene_id "g1139"; # protein sequence = [MGDQKEERTRWKTREEAKAVLTPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSN # SEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSA # WKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1139 ### # start gene g1140 Scaffold_7 AUGUSTUS gene 5438178 5438849 0.57 - . g1140 Scaffold_7 AUGUSTUS transcript 5438178 5438849 0.57 - . g1140.t1 Scaffold_7 AUGUSTUS stop_codon 5438178 5438180 . - 0 transcript_id "g1140.t1"; gene_id "g1140"; Scaffold_7 AUGUSTUS CDS 5438178 5438849 0.57 - 0 transcript_id "g1140.t1"; gene_id "g1140"; Scaffold_7 AUGUSTUS start_codon 5438847 5438849 . - 0 transcript_id "g1140.t1"; gene_id "g1140"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGRKIHAGTLQSPPEAPQRPPEAPQPPPEAQQPQAPLRAPRTRVKLEEVKDEEYEASQPGPH # KLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1140 ### # start gene g1141 Scaffold_7 AUGUSTUS gene 5442725 5443354 0.95 - . g1141 Scaffold_7 AUGUSTUS transcript 5442725 5443354 0.95 - . g1141.t1 Scaffold_7 AUGUSTUS stop_codon 5442725 5442727 . - 0 transcript_id "g1141.t1"; gene_id "g1141"; Scaffold_7 AUGUSTUS CDS 5442725 5443354 0.95 - 0 transcript_id "g1141.t1"; gene_id "g1141"; Scaffold_7 AUGUSTUS start_codon 5443352 5443354 . - 0 transcript_id "g1141.t1"; gene_id "g1141"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRYPLPY # PNNLGRHPGGYQHLQYSPLTFPPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1141 ### # start gene g1142 Scaffold_7 AUGUSTUS gene 5444624 5444905 1 - . g1142 Scaffold_7 AUGUSTUS transcript 5444624 5444905 1 - . g1142.t1 Scaffold_7 AUGUSTUS stop_codon 5444624 5444626 . - 0 transcript_id "g1142.t1"; gene_id "g1142"; Scaffold_7 AUGUSTUS CDS 5444624 5444905 1 - 0 transcript_id "g1142.t1"; gene_id "g1142"; Scaffold_7 AUGUSTUS start_codon 5444903 5444905 . - 0 transcript_id "g1142.t1"; gene_id "g1142"; # protein sequence = [MSASRTTTTTITSANTAGPSRSRTTNPPPADTVDNDEEELEEDDDEANPAGGGEGPQDEGEKSGAAAKKKAEEEAARK # AAEEAQRQRRRQRGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1142 ### # start gene g1143 Scaffold_7 AUGUSTUS gene 5448837 5449616 0.97 + . g1143 Scaffold_7 AUGUSTUS transcript 5448837 5449616 0.97 + . g1143.t1 Scaffold_7 AUGUSTUS start_codon 5448837 5448839 . + 0 transcript_id "g1143.t1"; gene_id "g1143"; Scaffold_7 AUGUSTUS CDS 5448837 5449616 0.97 + 0 transcript_id "g1143.t1"; gene_id "g1143"; Scaffold_7 AUGUSTUS stop_codon 5449614 5449616 . + 0 transcript_id "g1143.t1"; gene_id "g1143"; # protein sequence = [MEEHSSSKSSMNKPEVFKGKDGTEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPP # FGGNWDTFLKEYSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRWFGCGAQGYIKQNCPHRETTCRYCGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1143 ### # start gene g1144 Scaffold_7 AUGUSTUS gene 5455541 5456707 0.87 + . g1144 Scaffold_7 AUGUSTUS transcript 5455541 5456707 0.87 + . g1144.t1 Scaffold_7 AUGUSTUS start_codon 5455541 5455543 . + 0 transcript_id "g1144.t1"; gene_id "g1144"; Scaffold_7 AUGUSTUS CDS 5455541 5456707 0.87 + 0 transcript_id "g1144.t1"; gene_id "g1144"; Scaffold_7 AUGUSTUS stop_codon 5456705 5456707 . + 0 transcript_id "g1144.t1"; gene_id "g1144"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1144 ### # start gene g1145 Scaffold_7 AUGUSTUS gene 5458013 5460079 0.69 + . g1145 Scaffold_7 AUGUSTUS transcript 5458013 5460079 0.69 + . g1145.t1 Scaffold_7 AUGUSTUS start_codon 5458013 5458015 . + 0 transcript_id "g1145.t1"; gene_id "g1145"; Scaffold_7 AUGUSTUS CDS 5458013 5460079 0.69 + 0 transcript_id "g1145.t1"; gene_id "g1145"; Scaffold_7 AUGUSTUS stop_codon 5460077 5460079 . + 0 transcript_id "g1145.t1"; gene_id "g1145"; # protein sequence = [MFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEY # LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFATSTDALSGILPNSTTSERPDEERHQLYLDRHSQKAFDTLREAFISAPILALWTPDRPTR # IEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLS # RFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNG # LVYYRGRVYVPANDDLRTEVLRQCHDNPTAGHPGLHGTLDLVGTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQ # LPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEV # EKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKA # HQFKVGDLVWLSAEDINLPTFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1145 ### # start gene g1146 Scaffold_7 AUGUSTUS gene 5464189 5465411 0.92 - . g1146 Scaffold_7 AUGUSTUS transcript 5464189 5465411 0.92 - . g1146.t1 Scaffold_7 AUGUSTUS stop_codon 5464189 5464191 . - 0 transcript_id "g1146.t1"; gene_id "g1146"; Scaffold_7 AUGUSTUS CDS 5464189 5465084 0.93 - 2 transcript_id "g1146.t1"; gene_id "g1146"; Scaffold_7 AUGUSTUS CDS 5465156 5465411 0.99 - 0 transcript_id "g1146.t1"; gene_id "g1146"; Scaffold_7 AUGUSTUS start_codon 5465409 5465411 . - 0 transcript_id "g1146.t1"; gene_id "g1146"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPRSPI # SPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWF # VPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPA # TLADYRRSSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1146 ### # start gene g1147 Scaffold_7 AUGUSTUS gene 5471073 5471489 0.42 - . g1147 Scaffold_7 AUGUSTUS transcript 5471073 5471489 0.42 - . g1147.t1 Scaffold_7 AUGUSTUS stop_codon 5471073 5471075 . - 0 transcript_id "g1147.t1"; gene_id "g1147"; Scaffold_7 AUGUSTUS CDS 5471073 5471489 0.42 - 0 transcript_id "g1147.t1"; gene_id "g1147"; Scaffold_7 AUGUSTUS start_codon 5471487 5471489 . - 0 transcript_id "g1147.t1"; gene_id "g1147"; # protein sequence = [MAVNKLMEIAPMPQGNIRSKQQALSGHTFICLFDFASGFYACEVDRESHPYTAFYIEGKGYFWCGQLPFGLTGAPSTF # ANMMALHLNDLIADGTIELFVDDSSAADDDFNTTSSQCFHAQPPWRTQILELGSPEEPFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1147 ### # start gene g1148 Scaffold_7 AUGUSTUS gene 5490321 5491495 0.73 - . g1148 Scaffold_7 AUGUSTUS transcript 5490321 5491495 0.73 - . g1148.t1 Scaffold_7 AUGUSTUS stop_codon 5490321 5490323 . - 0 transcript_id "g1148.t1"; gene_id "g1148"; Scaffold_7 AUGUSTUS CDS 5490321 5490858 0.74 - 1 transcript_id "g1148.t1"; gene_id "g1148"; Scaffold_7 AUGUSTUS CDS 5490912 5491495 0.73 - 0 transcript_id "g1148.t1"; gene_id "g1148"; Scaffold_7 AUGUSTUS start_codon 5491493 5491495 . - 0 transcript_id "g1148.t1"; gene_id "g1148"; # protein sequence = [MDVLISKYSLGFDPNGLKLSGPFIHDSVVLITGTTGALGSYILVQLVKSAGVKKIYAFNRPSDALTIRERQHAVFSNH # NLDLTLLDAPKLVFIEGDASQIDLGLDPTTYEDLREEITVIIDNAWQLDLNAPLRNFISNIASTRNLIDLAYSSSRVSSIRYTFISSIASAQNWISET # GGHEEVPEEILENSKQAAIAWLPFSFELNLLISQLVSMSSLQASVYRVGQLCGASESGSWTIKEWIPKLTRTSLSLNAVPNMGGVILNFYEDINAGFD # LYYHKQIVSWIPIDKVASIVIEITLDPTSSPPPPVLNIVHPRPVTWTSIMEIVLKDLLPLKNTGETMKMKPYMEWVGLLEAVDGNGTEMSENYVRSVI # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1148 ### # start gene g1149 Scaffold_7 AUGUSTUS gene 5492758 5494287 0.97 - . g1149 Scaffold_7 AUGUSTUS transcript 5492758 5494287 0.97 - . g1149.t1 Scaffold_7 AUGUSTUS stop_codon 5492758 5492760 . - 0 transcript_id "g1149.t1"; gene_id "g1149"; Scaffold_7 AUGUSTUS CDS 5492758 5494287 0.97 - 0 transcript_id "g1149.t1"; gene_id "g1149"; Scaffold_7 AUGUSTUS start_codon 5494285 5494287 . - 0 transcript_id "g1149.t1"; gene_id "g1149"; # protein sequence = [MVLKAGGLQPLYTLATSATSGAHFAASSDILPTLSNVIAYQFSLTDMDRLPYSVDLITTNTLLEVPNINEGLLQALIL # HLVPGGSIVLKMLITPLYEKDFNSLLEQLMVLNFEPRFVPVVAENVGIWEARRPFIVPIIPPEISLPFFELPLIIEYGIGREMILQQHLKTIKEEDLS # PIWIVTSEGPDADAFLWPLPNTYPRFIRDFPNFNLRGASFSPCYYSSSIRQFIIHKYLPPVGPENEFYIGENLHISVPRIIPMTGLSARTSSQSYLPC # SADVMIEVSASSPFYDGLWGVVGTVTEGHRSSLEGARVVGIALCEPSGGRVSLIDGFFTRSGVDFDSFLLARIAPIAMIVGLAVGINALNDPTHFRAR # IIVTHSDTFTGTVAVELLKIFGLAQFIKCLPSLITPITLFNAQIQCEDIVISGLELHNELLESYLPEETQVTYWTTTKHLLTHLRRHSHFAGYMLELL # TRSLSEASLPLQFPDSNLDLKMAQPMILKIPSSKIPSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1149 ### # start gene g1150 Scaffold_7 AUGUSTUS gene 5526533 5527720 0.29 + . g1150 Scaffold_7 AUGUSTUS transcript 5526533 5527720 0.29 + . g1150.t1 Scaffold_7 AUGUSTUS start_codon 5526533 5526535 . + 0 transcript_id "g1150.t1"; gene_id "g1150"; Scaffold_7 AUGUSTUS CDS 5526533 5527720 0.29 + 0 transcript_id "g1150.t1"; gene_id "g1150"; Scaffold_7 AUGUSTUS stop_codon 5527718 5527720 . + 0 transcript_id "g1150.t1"; gene_id "g1150"; # protein sequence = [MKKRHHHNEEQSEKHHKRKRTEVRVDDEDMWVEKNIDTDAKVSSDAVMAPPDVPSTSSLKREEWMLGPSSSSAAESSD # FFSSLGIETHRKAKDKQKEKAQEVDRAMEIEKSLEIQDEQSIDPSTASDSAPKRPFTPGGPGSQWRMTRLKRVYETAEEEGRDVLEVALERFDSAEAW # ELAQEERRILDERDGRRGRPQDRFEIGDRGGGGEKGFMFSGSSTRSSSFRRPGGSGPSTPSAGGPPVNRRLDSLRLPSQASSPLQQSHTPIPSVLTPP # PSQSSSRRALSPSSLNKLQAKVLRAKLVGAPNAEKLEREYEDAQRVANGFGDASPRTSGKQNVKVEVLPTLDGRGRLYDIGSGSNGKDEEGDPARAGN # RRKKEKVCDNCLIFFLVLNANFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1150 ### # start gene g1151 Scaffold_7 AUGUSTUS gene 5530034 5530558 0.53 + . g1151 Scaffold_7 AUGUSTUS transcript 5530034 5530558 0.53 + . g1151.t1 Scaffold_7 AUGUSTUS start_codon 5530034 5530036 . + 0 transcript_id "g1151.t1"; gene_id "g1151"; Scaffold_7 AUGUSTUS CDS 5530034 5530558 0.53 + 0 transcript_id "g1151.t1"; gene_id "g1151"; Scaffold_7 AUGUSTUS stop_codon 5530556 5530558 . + 0 transcript_id "g1151.t1"; gene_id "g1151"; # protein sequence = [MSSDTLILPTPEIFSAFPYTPPYNIQAQLMRHLYEAIENRKVTVIESPTGTGKTSSLLCAGLTWLHDEKNRARKGKLN # NAATGDDWVSTQTRDRLRRQLEAEELEYEQRLADARQKEAQLKSRARVWKKPKPDDKPQQPFIDADASFLPEDDGTPGDDDMNLSPAVKALMARCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1151 ### # start gene g1152 Scaffold_7 AUGUSTUS gene 5536090 5536860 0.39 - . g1152 Scaffold_7 AUGUSTUS transcript 5536090 5536860 0.39 - . g1152.t1 Scaffold_7 AUGUSTUS stop_codon 5536090 5536092 . - 0 transcript_id "g1152.t1"; gene_id "g1152"; Scaffold_7 AUGUSTUS CDS 5536090 5536860 0.39 - 0 transcript_id "g1152.t1"; gene_id "g1152"; Scaffold_7 AUGUSTUS start_codon 5536858 5536860 . - 0 transcript_id "g1152.t1"; gene_id "g1152"; # protein sequence = [MPEDMSSVKIFFWTYLGLNLPLILVETLGAAAMTTFNQKTTWADAYAENSVGGLLGAGLAGPMGGFGSFLLVIMALSI # IANNIPNVLSGLDFPGSFRYVSTPIFLTTILQNIHPYAQAIPRIFIVIIGSVVYIVLAIAGASHFEEWLETMLNILAYWLAIFSTILIEEHLIFRHGK # WTNYNPEDFSDWRKLPLGVASFVALACGVAGAVLGMAQTWYIGVIGGMIGDPEFGGDIGQYGLFDSWLCPMLILADESRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1152 ### # start gene g1153 Scaffold_7 AUGUSTUS gene 5541526 5543161 0.73 - . g1153 Scaffold_7 AUGUSTUS transcript 5541526 5543161 0.73 - . g1153.t1 Scaffold_7 AUGUSTUS stop_codon 5541526 5541528 . - 0 transcript_id "g1153.t1"; gene_id "g1153"; Scaffold_7 AUGUSTUS CDS 5541526 5542032 0.73 - 0 transcript_id "g1153.t1"; gene_id "g1153"; Scaffold_7 AUGUSTUS CDS 5542235 5543161 1 - 0 transcript_id "g1153.t1"; gene_id "g1153"; Scaffold_7 AUGUSTUS start_codon 5543159 5543161 . - 0 transcript_id "g1153.t1"; gene_id "g1153"; # protein sequence = [MTNTDTHDDEELSRDYSAESSYTNDAEPAEFVGYDEGDHTSSIPGRNYDEAFDLFRQGFLDRDWAADDSLATSPTPAV # STTHSDMIFDSDANDSAYDGSKAIVDADDEMVCLSSDPGLPRPHRSLEALANEHCNHLECHTSIFSESEAGNVPSASRAFFASSFVPDVEMDFNMDRD # SDLILDMDDYLDLLPHAAPQAVPRPHHILEYEIDISKHPFSDVLDIDSDVDAGPLCPLHYSGDVLDIDSGSELRDSQKCVDHLLSDDDMKGMDICAAN # GSSSSVSFAPLAHFTASHSESGSDRFKEPPSLDFRTTQSSLASSALHTLLSSQSGPSSSSALPVSPISFYLSQNEHKNGNCNHNDNVNESRCSRTPHG # PDSAIKFFNYHKAHTSITFKDSDNVASNTFLDADMLMSAMDVKFDFDLGADADADALPLHPQLHNSSGLTTIMSQGNKYRAEDNGTIGKSDWELDFAE # DILDLEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1153 ### # start gene g1154 Scaffold_7 AUGUSTUS gene 5545005 5545917 0.39 + . g1154 Scaffold_7 AUGUSTUS transcript 5545005 5545917 0.39 + . g1154.t1 Scaffold_7 AUGUSTUS start_codon 5545005 5545007 . + 0 transcript_id "g1154.t1"; gene_id "g1154"; Scaffold_7 AUGUSTUS CDS 5545005 5545137 0.43 + 0 transcript_id "g1154.t1"; gene_id "g1154"; Scaffold_7 AUGUSTUS CDS 5545289 5545917 0.86 + 2 transcript_id "g1154.t1"; gene_id "g1154"; Scaffold_7 AUGUSTUS stop_codon 5545915 5545917 . + 0 transcript_id "g1154.t1"; gene_id "g1154"; # protein sequence = [MLHQLEFKLQVEMQYKRGIDKMAKLYQADGDKKSRQDAESKKVENGTGIEGERKENLRAKPLSGILSVTVRGARELDH # APIVTRFRSSKNQVVETSVSLKVEGTQLARSHPSRTDRWNEDFEITVDKANEVEIAVYDKQVGETHAVPIGLLWIRISDLVEALRRQKVFMESGQGGW # VTAGAMHGDAGHPNSADLNAPLSFGAAPPGGFGPQGGMGDGIPQQPSEGIEAWFAVEPAGAILLHLNFGESVANISC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1154 ### # start gene g1155 Scaffold_7 AUGUSTUS gene 5546967 5547293 0.95 + . g1155 Scaffold_7 AUGUSTUS transcript 5546967 5547293 0.95 + . g1155.t1 Scaffold_7 AUGUSTUS start_codon 5546967 5546969 . + 0 transcript_id "g1155.t1"; gene_id "g1155"; Scaffold_7 AUGUSTUS CDS 5546967 5547293 0.95 + 0 transcript_id "g1155.t1"; gene_id "g1155"; Scaffold_7 AUGUSTUS stop_codon 5547291 5547293 . + 0 transcript_id "g1155.t1"; gene_id "g1155"; # protein sequence = [MQQQRPPDRSSTVLPTAQTPPQQPQIQIQQQQQQRQPVRQQTQRRKVGLDDFNFLAVLGKGNFGKVMLAEEKKTNGLY # AIKVLKKEFIIDNDEVERLANVDALHGSLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1155 ### # start gene g1156 Scaffold_7 AUGUSTUS gene 5552181 5553231 0.72 + . g1156 Scaffold_7 AUGUSTUS transcript 5552181 5553231 0.72 + . g1156.t1 Scaffold_7 AUGUSTUS start_codon 5552181 5552183 . + 0 transcript_id "g1156.t1"; gene_id "g1156"; Scaffold_7 AUGUSTUS CDS 5552181 5552780 0.73 + 0 transcript_id "g1156.t1"; gene_id "g1156"; Scaffold_7 AUGUSTUS CDS 5552902 5553231 0.94 + 0 transcript_id "g1156.t1"; gene_id "g1156"; Scaffold_7 AUGUSTUS stop_codon 5553229 5553231 . + 0 transcript_id "g1156.t1"; gene_id "g1156"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK # DEMARLPEPATLADYRQEFFVLTIPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQI # ADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1156 ### # start gene g1157 Scaffold_7 AUGUSTUS gene 5555646 5556332 0.76 + . g1157 Scaffold_7 AUGUSTUS transcript 5555646 5556332 0.76 + . g1157.t1 Scaffold_7 AUGUSTUS start_codon 5555646 5555648 . + 0 transcript_id "g1157.t1"; gene_id "g1157"; Scaffold_7 AUGUSTUS CDS 5555646 5556332 0.76 + 0 transcript_id "g1157.t1"; gene_id "g1157"; Scaffold_7 AUGUSTUS stop_codon 5556330 5556332 . + 0 transcript_id "g1157.t1"; gene_id "g1157"; # protein sequence = [MDIEALHQHHLALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRT # LEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAE # LFVIHVSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYIRKPMGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1157 ### # start gene g1158 Scaffold_7 AUGUSTUS gene 5558209 5558526 1 - . g1158 Scaffold_7 AUGUSTUS transcript 5558209 5558526 1 - . g1158.t1 Scaffold_7 AUGUSTUS stop_codon 5558209 5558211 . - 0 transcript_id "g1158.t1"; gene_id "g1158"; Scaffold_7 AUGUSTUS CDS 5558209 5558526 1 - 0 transcript_id "g1158.t1"; gene_id "g1158"; Scaffold_7 AUGUSTUS start_codon 5558524 5558526 . - 0 transcript_id "g1158.t1"; gene_id "g1158"; # protein sequence = [MSASRTTTTTTSATAGPSRSRPVPPPPPPASDSAAQEEEDLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEAQERAKRARQQEEEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1158 ### # start gene g1159 Scaffold_7 AUGUSTUS gene 5560361 5561512 0.93 + . g1159 Scaffold_7 AUGUSTUS transcript 5560361 5561512 0.93 + . g1159.t1 Scaffold_7 AUGUSTUS start_codon 5560361 5560363 . + 0 transcript_id "g1159.t1"; gene_id "g1159"; Scaffold_7 AUGUSTUS CDS 5560361 5561512 0.93 + 0 transcript_id "g1159.t1"; gene_id "g1159"; Scaffold_7 AUGUSTUS stop_codon 5561510 5561512 . + 0 transcript_id "g1159.t1"; gene_id "g1159"; # protein sequence = [MTQYRKELASLGSKLSEDEFSITLLTSLPDSWDSFIQGVNTTSLSDSTKLVSRILEQSRRKFAKPSSDDIALPANRFK # GKAGKSSTALNSACHGCGRSGHFISNCRDTAAGKTYTAQQRKKIMNIPMRNRSRPNKSHRAHIVQEDQSAETDYAFMGQHTDNSLPADTWLIDSACTK # HIIQNKSHFSTYFETPGHSVKGFGESPAIGQGTATVATHVGKHAFNITLQNALHVPNAPFNLISVGCITQAGFTVKFTTNSISVISSGPSPREIIHGR # RVGNLYVVKITRGTACLSPSQHHPQSVPNNAETLAFPSLPTARSWKEWHCTLGHITAKSVKLLHDKGMVTGMVVDTTSELDFDCDACTRAKITCSAIS # KRSRTEIYRNW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1159 ### # start gene g1160 Scaffold_7 AUGUSTUS gene 5561862 5562680 0.87 + . g1160 Scaffold_7 AUGUSTUS transcript 5561862 5562680 0.87 + . g1160.t1 Scaffold_7 AUGUSTUS start_codon 5561862 5561864 . + 0 transcript_id "g1160.t1"; gene_id "g1160"; Scaffold_7 AUGUSTUS CDS 5561862 5562680 0.87 + 0 transcript_id "g1160.t1"; gene_id "g1160"; Scaffold_7 AUGUSTUS stop_codon 5562678 5562680 . + 0 transcript_id "g1160.t1"; gene_id "g1160"; # protein sequence = [MLAHYDLPLFLWPEAVAYAVYLKNRSPTQALTKYITPEEAFWKKKPDISTLQEFGSPCWVLRQDGQNQKLISKSRPFR # FTGLSDESRAWQYYNPESRRIQTSRNVVFNSKGAKTESTEIIPTPALEGEQKESTISENQSVESPPSELNQNTLTESLQPSTPSPITPPRPLSPLTPL # PSPSPSPSPSISTAYQKPKAPRDISSTISTENIISGKRTARSAPTLNYRLLNNPDSHSPKRPDAWKIRVPGPELDSDPILLPLLFHPSNKLLSVNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1160 ### # start gene g1161 Scaffold_7 AUGUSTUS gene 5562943 5564235 0.62 + . g1161 Scaffold_7 AUGUSTUS transcript 5562943 5564235 0.62 + . g1161.t1 Scaffold_7 AUGUSTUS start_codon 5562943 5562945 . + 0 transcript_id "g1161.t1"; gene_id "g1161"; Scaffold_7 AUGUSTUS CDS 5562943 5564235 0.62 + 0 transcript_id "g1161.t1"; gene_id "g1161"; Scaffold_7 AUGUSTUS stop_codon 5564233 5564235 . + 0 transcript_id "g1161.t1"; gene_id "g1161"; # protein sequence = [METVWLLISIATRFKLKTHVVDVIGAYLNGKLDEEIYMTQPECYEDGTTRVCKLECSLYGLKQAGRVWNLTLDSSFKE # LEFTRLLSDQCVYIRRSPKGIVIIAVHVDDMSIFASSDELMTEAESQLESKFSINRLGSLRQLLGMEIHQTKDSIILTQTQYLTRTLNKFGMTDCKPV # ATPMDTHVKLSRIPETESHPEIKAVYQNMIGSLMYAAITTRPDISFAVQALSQFNLNPGPIHFTAAKCILRYLKGTLNLGIKYSCLNDLEPVLFSDAD # WGNGIDDRKSITGYVSKHAGGAITWNSKKQPTVALSSMEAEYLALSATTCEALWLRTLFSKLGLPFKHPLDIFVDNQGTIAFAQNSGFHTRSKHINIR # HHFIRENITSDKVSVHYCATEDNIADILTKGLDRNNTNISSSSSGCVELEGGIVIYGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1161 ### # start gene g1162 Scaffold_7 AUGUSTUS gene 5583842 5584577 0.98 + . g1162 Scaffold_7 AUGUSTUS transcript 5583842 5584577 0.98 + . g1162.t1 Scaffold_7 AUGUSTUS start_codon 5583842 5583844 . + 0 transcript_id "g1162.t1"; gene_id "g1162"; Scaffold_7 AUGUSTUS CDS 5583842 5583946 0.98 + 0 transcript_id "g1162.t1"; gene_id "g1162"; Scaffold_7 AUGUSTUS CDS 5584014 5584577 0.99 + 0 transcript_id "g1162.t1"; gene_id "g1162"; Scaffold_7 AUGUSTUS stop_codon 5584575 5584577 . + 0 transcript_id "g1162.t1"; gene_id "g1162"; # protein sequence = [MGIDDDQGLGGPSRGRGRGGAESDFWMPQVASNGQIFYINTKTGEQSRDLPQEAEDDIDLSMTDDAPLALAQSSSSSR # AGPGVLGYATSSGPYTDLDPSSAPYASGSSNSQFQSQPGFGLPRRTDTPEPWIRRLADDGLSYYYLNQVDGRVQWTRPESLTSRGSGLPETPTTAVPL # PLHGRARSDSVNNLTGGGHGVYSDSSDVDVSLADEWMMRKGKGNRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1162 ### # start gene g1163 Scaffold_7 AUGUSTUS gene 5585882 5587298 0.67 + . g1163 Scaffold_7 AUGUSTUS transcript 5585882 5587298 0.67 + . g1163.t1 Scaffold_7 AUGUSTUS start_codon 5585882 5585884 . + 0 transcript_id "g1163.t1"; gene_id "g1163"; Scaffold_7 AUGUSTUS CDS 5585882 5586053 0.67 + 0 transcript_id "g1163.t1"; gene_id "g1163"; Scaffold_7 AUGUSTUS CDS 5586136 5587298 0.99 + 2 transcript_id "g1163.t1"; gene_id "g1163"; Scaffold_7 AUGUSTUS stop_codon 5587296 5587298 . + 0 transcript_id "g1163.t1"; gene_id "g1163"; # protein sequence = [MPGSGRAGSWTGFGFVAEDDLDEYEDQDIESEVAERKKVNGNSKKANGVGGSNATDTDLSDFSEFSERESEGEGSEVS # DFSEVDSGVDIEFGDSSNSDASSVVVRRSRPRRAPRGGRGKKRKRSPGHGSGVGVGSHSSNQAPEVNLQSNQNNPNSSHPTKSGNHSSSHLAKKKNMP # TRPPMKPLSPDLVSDIAASVTRLDAFLGVLDIAVVQQQQHSPAERNNTNATDQQYEYIQRAQRIHQVQRFAKDVIGQVQTVLELVDDVDVAESVVLDT # PIPHDTTLSQSVDGPLNSLAEEKKKVVISNSNGEGSKDEREGGRTALSSHHSSHSLSTVETTETVDTVDTRMSSVFTHGTGSSFNGFSSSSHTSHTSH # SQNSTPILDDNSHSSFISKHSPSFARTQDVSFTPRTDLSQTLPTAVRSCACSKRVCKLYTTTLRRFGDMCRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1163 ### # start gene g1164 Scaffold_7 AUGUSTUS gene 5587433 5588826 0.17 + . g1164 Scaffold_7 AUGUSTUS transcript 5587433 5588826 0.17 + . g1164.t1 Scaffold_7 AUGUSTUS start_codon 5587433 5587435 . + 0 transcript_id "g1164.t1"; gene_id "g1164"; Scaffold_7 AUGUSTUS CDS 5587433 5587901 0.52 + 0 transcript_id "g1164.t1"; gene_id "g1164"; Scaffold_7 AUGUSTUS CDS 5588378 5588826 0.17 + 2 transcript_id "g1164.t1"; gene_id "g1164"; Scaffold_7 AUGUSTUS stop_codon 5588824 5588826 . + 0 transcript_id "g1164.t1"; gene_id "g1164"; # protein sequence = [MILSVVNVLSTAIKANAAVVLQILDKLLALGVEQRTIVEGVLEEEDSATSSVGVAGGDMMNTRGTNGVRRWEESVRWS # KRVSRDVDRDVSKRMSHQRSSMVRVRPASILPASVGPDAQGGGGYGGGVPTALQPGYNMLRYGGYEGQTHEVYDEYGRVRLLVTTLTSLNQPQYQNQA # QYNQAQYQTQYQNQAQVQYNQIPKVRTTGSVGAQNVQGFSERNQYGQYPSDFEPGYGAIGSSANASEGEDTFVRWFDDFDEDDEDEDDVLVRGSDDRK # FSFAARINTNNRFLPPSTNTQNQGFQPSHPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1164 ### # start gene g1165 Scaffold_7 AUGUSTUS gene 5599598 5599879 0.49 + . g1165 Scaffold_7 AUGUSTUS transcript 5599598 5599879 0.49 + . g1165.t1 Scaffold_7 AUGUSTUS start_codon 5599598 5599600 . + 0 transcript_id "g1165.t1"; gene_id "g1165"; Scaffold_7 AUGUSTUS CDS 5599598 5599879 0.49 + 0 transcript_id "g1165.t1"; gene_id "g1165"; Scaffold_7 AUGUSTUS stop_codon 5599877 5599879 . + 0 transcript_id "g1165.t1"; gene_id "g1165"; # protein sequence = [MQDTMLIQMSSRFTKIYFITADTEESIQACLFDIAIDNGLMNPQDWRNGIHWLNTHEENWLIIMDNADNPKLPLRRYL # PSCEHGNIIITSRKC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1165 ### # start gene g1166 Scaffold_7 AUGUSTUS gene 5610851 5611888 0.97 + . g1166 Scaffold_7 AUGUSTUS transcript 5610851 5611888 0.97 + . g1166.t1 Scaffold_7 AUGUSTUS start_codon 5610851 5610853 . + 0 transcript_id "g1166.t1"; gene_id "g1166"; Scaffold_7 AUGUSTUS CDS 5610851 5611888 0.97 + 0 transcript_id "g1166.t1"; gene_id "g1166"; Scaffold_7 AUGUSTUS stop_codon 5611886 5611888 . + 0 transcript_id "g1166.t1"; gene_id "g1166"; # protein sequence = [MNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLK # EFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPT # MTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQP # RRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1166 ### # start gene g1167 Scaffold_7 AUGUSTUS gene 5611939 5615469 0.98 + . g1167 Scaffold_7 AUGUSTUS transcript 5611939 5615469 0.98 + . g1167.t1 Scaffold_7 AUGUSTUS start_codon 5611939 5611941 . + 0 transcript_id "g1167.t1"; gene_id "g1167"; Scaffold_7 AUGUSTUS CDS 5611939 5615469 0.98 + 0 transcript_id "g1167.t1"; gene_id "g1167"; Scaffold_7 AUGUSTUS stop_codon 5615467 5615469 . + 0 transcript_id "g1167.t1"; gene_id "g1167"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLLLRLCGEVLIHVVYIV # PTTYDNYPVIVAFWLSWILC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1167 ### # start gene g1168 Scaffold_7 AUGUSTUS gene 5615872 5616390 0.85 - . g1168 Scaffold_7 AUGUSTUS transcript 5615872 5616390 0.85 - . g1168.t1 Scaffold_7 AUGUSTUS stop_codon 5615872 5615874 . - 0 transcript_id "g1168.t1"; gene_id "g1168"; Scaffold_7 AUGUSTUS CDS 5615872 5616390 0.85 - 0 transcript_id "g1168.t1"; gene_id "g1168"; Scaffold_7 AUGUSTUS start_codon 5616388 5616390 . - 0 transcript_id "g1168.t1"; gene_id "g1168"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKCEETRKREA # GKPFVARNPKKGSSDFKTGSANQHNNSQPSGSTAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERSVKFMPNH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1168 ### # start gene g1169 Scaffold_7 AUGUSTUS gene 5617330 5618733 0.93 - . g1169 Scaffold_7 AUGUSTUS transcript 5617330 5618733 0.93 - . g1169.t1 Scaffold_7 AUGUSTUS stop_codon 5617330 5617332 . - 0 transcript_id "g1169.t1"; gene_id "g1169"; Scaffold_7 AUGUSTUS CDS 5617330 5618733 0.93 - 0 transcript_id "g1169.t1"; gene_id "g1169"; Scaffold_7 AUGUSTUS start_codon 5618731 5618733 . - 0 transcript_id "g1169.t1"; gene_id "g1169"; # protein sequence = [MESFKLDGKWTLDHTKAFLALKKALVTEPVLKAPRWDGSSFIITTDGCKEGFAAVVAQRFEVVHPNGTTTYKMHPVGF # ASKRTSASEQNYKPFLLEFAALKFGLDKFSDMIWGFPVEIETDCQALRDVIANDKLKAAHCRWRDGVLAHHIVDVRHIPGKLNVVADGMSRMWEGQDR # VVGDGSEWTVSEDWEAVTGLVNDVFGVDVSGETLRNEELTDWKAMSERFQNEPVFTEVVEALRVLESSASDKVKQKASHKAARYMVDGNRLWKVGGNE # GIRDRARVECVTRREAVALAKTQHGEAGHWGRDSVKLALMDRIWSPKLDESIMEAITGCPECKNFGSTHLHALLNPITRRHPFELLVGDYLSMSKGKG # GYKTIGLYLDTYSQRVWAFKFKVAGSGATTTTSLDSLFGGYLPPEMFMTDNGTHFANKEVAALCAKWGTKQHFTPAYSPWVNGLVKVLIKSYFTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1169 ### # start gene g1170 Scaffold_7 AUGUSTUS gene 5620455 5621192 0.57 - . g1170 Scaffold_7 AUGUSTUS transcript 5620455 5621192 0.57 - . g1170.t1 Scaffold_7 AUGUSTUS stop_codon 5620455 5620457 . - 0 transcript_id "g1170.t1"; gene_id "g1170"; Scaffold_7 AUGUSTUS CDS 5620455 5621192 0.57 - 0 transcript_id "g1170.t1"; gene_id "g1170"; Scaffold_7 AUGUSTUS start_codon 5621190 5621192 . - 0 transcript_id "g1170.t1"; gene_id "g1170"; # protein sequence = [MANGSVVPGMARWKGRISVKGVETDGGFEVFDSGGSWRFLFGKPLLERFSAVHDYQKDAIVFREGREKWQEVFNKGLG # VALTPNSTTVLEERGQQEAPSSSAQADDVLKDREGPSGGVIVQALTPLSREVADLSHVQKEYATNETSQCLPQASPRRRCQKPQIEEVQDEDQGDRNP # QRERYQDSLESDFNAIEEEWMVTESELEEWFRAERQRRRNETVKLQEQTGTSTEGAASGFGKGGGTEGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1170 ### # start gene g1171 Scaffold_7 AUGUSTUS gene 5621474 5622400 0.55 - . g1171 Scaffold_7 AUGUSTUS transcript 5621474 5622400 0.55 - . g1171.t1 Scaffold_7 AUGUSTUS stop_codon 5621474 5621476 . - 0 transcript_id "g1171.t1"; gene_id "g1171"; Scaffold_7 AUGUSTUS CDS 5621474 5622400 0.55 - 0 transcript_id "g1171.t1"; gene_id "g1171"; Scaffold_7 AUGUSTUS start_codon 5622398 5622400 . - 0 transcript_id "g1171.t1"; gene_id "g1171"; # protein sequence = [MGGFRSEIPCTVSVTKERKEVGEIIPHQSGRGTNYARAHHENERRHEPAIPPMVGRPLAPPGKGCGGGKDEAVHRYCV # EAPPYALKKVIDEEHDNWAEFTSAIKAVKWSVLKVEAEHEASKAVPMVVPETPRTKLASSFATARISAPPSPSPIRMKPAYTTSTGNRKPRRTFTALD # EGRKGVLRRGIAAKAQHPNTPEGLAAWKTELLEWASRYGVDGALSEVTIVPLKPGTEAVCSGECFRCGGPRHGFEIPCPRPGTIPAVESDWRAYCQRE # LGGRTPRVNAVQVLGPEAIFEGMVESGNGEGSAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1171 ### # start gene g1172 Scaffold_7 AUGUSTUS gene 5623114 5623878 0.97 - . g1172 Scaffold_7 AUGUSTUS transcript 5623114 5623878 0.97 - . g1172.t1 Scaffold_7 AUGUSTUS stop_codon 5623114 5623116 . - 0 transcript_id "g1172.t1"; gene_id "g1172"; Scaffold_7 AUGUSTUS CDS 5623114 5623878 0.97 - 0 transcript_id "g1172.t1"; gene_id "g1172"; Scaffold_7 AUGUSTUS start_codon 5623876 5623878 . - 0 transcript_id "g1172.t1"; gene_id "g1172"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTARIDSPILQAIARRMGKQPQRRAASESPRDPPPHFDL # DAGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRP # SDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1172 ### # start gene g1173 Scaffold_7 AUGUSTUS gene 5633207 5635428 0.74 - . g1173 Scaffold_7 AUGUSTUS transcript 5633207 5635428 0.74 - . g1173.t1 Scaffold_7 AUGUSTUS stop_codon 5633207 5633209 . - 0 transcript_id "g1173.t1"; gene_id "g1173"; Scaffold_7 AUGUSTUS CDS 5633207 5635280 0.84 - 1 transcript_id "g1173.t1"; gene_id "g1173"; Scaffold_7 AUGUSTUS CDS 5635352 5635428 0.75 - 0 transcript_id "g1173.t1"; gene_id "g1173"; Scaffold_7 AUGUSTUS start_codon 5635426 5635428 . - 0 transcript_id "g1173.t1"; gene_id "g1173"; # protein sequence = [MSFGNSPNIPRLPEEKQLAGEENWRPPNVYPGPIYPSTQPPTPLFSPTPCLEEWESRDRLVAGAIVSNITDPVGLGVD # ETKRASEIWLTLIKRFEKRDEQRIHLADTNLRQEKYDPSEDTMEDHEKRMRNLLKKVHDLGGAATDAQFRRIIISSMPPEWRQDVRSVPGTSSADAFS # YLHTLWYEKEEERKEAERDTKRVKALMATHTQAQRPQPRGSSKPPITCHNCSKPGHIAKKCWAKGGGMEGQWPKQGQADKRTGTSANQADTDKTDTSS # PMATYVMSAEATNKPSRSPHVQKPKLTADPAIRQDYPILKGAGQRDAGMEDVDRDLDSSTTVAKDKCLACRGNTSLYSLPVPTTRTFIDSGASEHCWV # RKADFVEYTEVYGQGGSSAISGEAGRFRILGVGTVQITTRIGESERVIQLQGVKHTPAFSHNLISLSTLDARGMQGEWGQGILTVKAANGETILEGYG # RDKMYEVEVLELGKITVNYSRARDRPIDILTWHRRLGHVAIRRILRMANRKLVDGLHITNREIRGMCEDCLYGKATKHPFDEVLTHESEVLERVHIDL # FGPSRTQTRGGASYLMLCTDGRSSFRVPNYLTNKRKETGLKALHEYRVMAENQTGKTLRTIRIDGGGELNNSLVDAYCAEHGITIEKVPHDSSAANGV # AERSFRTVMEGTRTLLEDAGLPYSFWGEASSTFIYTNNLCLLRGSLTPYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1173 ### # start gene g1174 Scaffold_7 AUGUSTUS gene 5646473 5647639 0.92 + . g1174 Scaffold_7 AUGUSTUS transcript 5646473 5647639 0.92 + . g1174.t1 Scaffold_7 AUGUSTUS start_codon 5646473 5646475 . + 0 transcript_id "g1174.t1"; gene_id "g1174"; Scaffold_7 AUGUSTUS CDS 5646473 5647639 0.92 + 0 transcript_id "g1174.t1"; gene_id "g1174"; Scaffold_7 AUGUSTUS stop_codon 5647637 5647639 . + 0 transcript_id "g1174.t1"; gene_id "g1174"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1174 ### # start gene g1175 Scaffold_7 AUGUSTUS gene 5659248 5659736 0.8 + . g1175 Scaffold_7 AUGUSTUS transcript 5659248 5659736 0.8 + . g1175.t1 Scaffold_7 AUGUSTUS start_codon 5659248 5659250 . + 0 transcript_id "g1175.t1"; gene_id "g1175"; Scaffold_7 AUGUSTUS CDS 5659248 5659736 0.8 + 0 transcript_id "g1175.t1"; gene_id "g1175"; Scaffold_7 AUGUSTUS stop_codon 5659734 5659736 . + 0 transcript_id "g1175.t1"; gene_id "g1175"; # protein sequence = [MWRKPTTTTGKIELEYSVGLDTTSRSPPPEPEPKPVSQVKKGEEVLAESEDTSVAPMHSRSQPKMPAGSGVAFYRNAH # LSTELGLKSSVSLFATNELEVPSNTSLEHSQSILIAQDLHPNAVSTANTQPSPSSSSTVNSSPVTSSPSTSQYGIAVWSAFIDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1175 ### # start gene g1176 Scaffold_7 AUGUSTUS gene 5661726 5662256 0.84 - . g1176 Scaffold_7 AUGUSTUS transcript 5661726 5662256 0.84 - . g1176.t1 Scaffold_7 AUGUSTUS stop_codon 5661726 5661728 . - 0 transcript_id "g1176.t1"; gene_id "g1176"; Scaffold_7 AUGUSTUS CDS 5661726 5662256 0.84 - 0 transcript_id "g1176.t1"; gene_id "g1176"; Scaffold_7 AUGUSTUS start_codon 5662254 5662256 . - 0 transcript_id "g1176.t1"; gene_id "g1176"; # protein sequence = [MSGEQFSLKDAVWNLTNEQTKERTAQAFLRVSDDGLLIYSFLTLLLTLIQGVQQFNNRIRQVLMSSGSTTFSKIVNKW # NTALIGLMTYYREAVIHTNELLDSLVKAENKIQTRVKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVAGKTHPNFLNVNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1176 ### # start gene g1177 Scaffold_7 AUGUSTUS gene 5671998 5673203 1 + . g1177 Scaffold_7 AUGUSTUS transcript 5671998 5673203 1 + . g1177.t1 Scaffold_7 AUGUSTUS start_codon 5671998 5672000 . + 0 transcript_id "g1177.t1"; gene_id "g1177"; Scaffold_7 AUGUSTUS CDS 5671998 5673203 1 + 0 transcript_id "g1177.t1"; gene_id "g1177"; Scaffold_7 AUGUSTUS stop_codon 5673201 5673203 . + 0 transcript_id "g1177.t1"; gene_id "g1177"; # protein sequence = [MSSHAGSARSLRKKTSSSSIGTEASISKKGQAQGDTASLSSRTSRKRAGLGFGQHPERSPSDGNYSPQTPSRSATSSL # RRLAVPPSSFIPKGIHNSNLEPPREKGRTQDIFDDANLVTSTDIKREIAAVEAEGRRLVDAFNGLEVTTLAKRQRRHMGHHRVESRPATIVGLPGDGP # LSIEIGTEEDSGGKGSSGVGVGSTWTLIPDNKLHFRATPTQTPTSAYLDTDVTSIRSGTSAHTSHTGRSIPRSIHRDASRTLPSKPSSGSASGSGAGS # LHRKNSSSSLGSSIAAGKKRGGGLSPVPPLPISVPPLPSGLSGLSNLALASGSSLNLTRSTGHLPMSSVPEDEDIDLLGLNGREEMDEEIREIQKKKD # DVSKRYAERLEYLRAKLKGAQLHEKLMKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1177 ### # start gene g1178 Scaffold_7 AUGUSTUS gene 5677845 5678783 1 + . g1178 Scaffold_7 AUGUSTUS transcript 5677845 5678783 1 + . g1178.t1 Scaffold_7 AUGUSTUS start_codon 5677845 5677847 . + 0 transcript_id "g1178.t1"; gene_id "g1178"; Scaffold_7 AUGUSTUS CDS 5677845 5678783 1 + 0 transcript_id "g1178.t1"; gene_id "g1178"; Scaffold_7 AUGUSTUS stop_codon 5678781 5678783 . + 0 transcript_id "g1178.t1"; gene_id "g1178"; # protein sequence = [MGAVAQHLHGSSGSNASDLESEDFAFVDRTTGLTISPISLPESSQKKDPSTRRIRGEGGPSGGEPVEGIVEGNMPQFE # FESSGGAGLTNKMEILAESMEQDGSHIAALRCQIGSGFVTFWAPNLENLSEEGSSAPTNLSSSSSSSQLILLRYVLSRIGLKPPHPTAGHVSRPLPQL # LLSTPDKPGLVEAVVRGLLGSVPGAGSVKFQDTNDTFEFHGYDEGLAILRQMRKQGHIESADDGHPHKPSNISHIAICPNGIVPSVEDTPLFDLRTYF # NLLKEARTREECRRDVSGFGETLIYGQVIGSTQTLFDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1178 ### # start gene g1179 Scaffold_7 AUGUSTUS gene 5680379 5681365 0.76 - . g1179 Scaffold_7 AUGUSTUS transcript 5680379 5681365 0.76 - . g1179.t1 Scaffold_7 AUGUSTUS stop_codon 5680379 5680381 . - 0 transcript_id "g1179.t1"; gene_id "g1179"; Scaffold_7 AUGUSTUS CDS 5680379 5681365 0.76 - 0 transcript_id "g1179.t1"; gene_id "g1179"; Scaffold_7 AUGUSTUS start_codon 5681363 5681365 . - 0 transcript_id "g1179.t1"; gene_id "g1179"; # protein sequence = [MKFPFIALVWTSALFLALHVEARPHPRHVGLTSTLLLNGIGYQPHGDGEVSISIESFAHLGEPKSMSPLTHLLNETLH # KLHVDVDHIGDHMATAVERLRLFAAVGIPLDKLELTIIGCEKKTVSLPRTGFTNLGIVQASVAVGKCPSALLTAKTHNSETATIYSSPPTGLGVISDI # DDTIKITDVLDPDKMIENTMYKDPVPVAGMPVLYASLAKSLTTQSIPPQFIYLSGSPFELFPFLSSFLKSQFSASLGPLLLQSLSITNPAEIKSLGDG # KSGQGKIDYKVGQIKRINGYYPQKSFLTIGDSGEKDPEVYGKASVYLLPPSTDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1179 ### # start gene g1180 Scaffold_7 AUGUSTUS gene 5682341 5683191 0.56 + . g1180 Scaffold_7 AUGUSTUS transcript 5682341 5683191 0.56 + . g1180.t1 Scaffold_7 AUGUSTUS start_codon 5682341 5682343 . + 0 transcript_id "g1180.t1"; gene_id "g1180"; Scaffold_7 AUGUSTUS CDS 5682341 5682476 0.61 + 0 transcript_id "g1180.t1"; gene_id "g1180"; Scaffold_7 AUGUSTUS CDS 5682533 5683191 0.84 + 2 transcript_id "g1180.t1"; gene_id "g1180"; Scaffold_7 AUGUSTUS stop_codon 5683189 5683191 . + 0 transcript_id "g1180.t1"; gene_id "g1180"; # protein sequence = [MLHKVTSSIYQTLFIFILLSDGIATIMALPLLPVSWSALQLERRVDREKNSALHFKIGRIVPDSDGKTCTWILSSSPS # RLFGEESLAFCIGGKDCFAVWPTTKAALLPLSAFKVNVPIYPSGWINYDKLSSLGGKVYFKSSYPKYNHLPEKSTTLELLEDINEIAKQTKFSITDDI # SYVSASLALLKNKGVLDDPDQMQKDWDEYKGQVEQDRKKQHEKGQHEKEQHEKEQHEKEQHEKEQHEKEQEAKAARQGNMGLNFILHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1180 ### # start gene g1181 Scaffold_7 AUGUSTUS gene 5683955 5685613 0.37 + . g1181 Scaffold_7 AUGUSTUS transcript 5683955 5685613 0.37 + . g1181.t1 Scaffold_7 AUGUSTUS start_codon 5683955 5683957 . + 0 transcript_id "g1181.t1"; gene_id "g1181"; Scaffold_7 AUGUSTUS CDS 5683955 5685613 0.37 + 0 transcript_id "g1181.t1"; gene_id "g1181"; Scaffold_7 AUGUSTUS stop_codon 5685611 5685613 . + 0 transcript_id "g1181.t1"; gene_id "g1181"; # protein sequence = [MSANLNIPSPASEPDEPGFGEQPSSLSSTPTPSSHVHRSISQSGSQAFSNQFWSAADTPSHHYQGTSYFSAPRSPSSS # RQAPPPPILMRSSSAHSTHSMRRGVRSTSVSSTARGGFRDDEAFSEADEYEGDDGEGTRKQRRGGGGSKAVSVDDEPHEDSDEQPLSEQDSTGKSDDE # PDPITLKERQSLINVEHPFGLPIWKPALYKKSRSVTRYADEALHSVPSAQAERHLLPGNLLWVIIFGWWLALVCWIVSVFLYIVPKGGKRYANLVFGL # GWYIAWPFGKYVEGVADDLDQEDNEENEHDDEPDADATPVTNEDSDAHERRSSGSSNTVRGVSAEIRHHPNPSWIPTEHTSLISTTSAPLPAKSYGAL # SATPSSSTSSIGLSKQAAAPDDHFLAKAAFWTSFVCIIAPLMLVVCLICWFFVFTIPMAKLTWALIKHIFEQPQTIRFCAAPLTVVVDTIPASSPELD # QLHEQAHASSESAPAPDSRLSVKHTIKPTRLTKGQRAPSGSPCTAVLLLHLPCTWTQVLQVHRRRSEYHVRQPPRCCLLRYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1181 ### # start gene g1182 Scaffold_7 AUGUSTUS gene 5685779 5686222 0.27 - . g1182 Scaffold_7 AUGUSTUS transcript 5685779 5686222 0.27 - . g1182.t1 Scaffold_7 AUGUSTUS stop_codon 5685779 5685781 . - 0 transcript_id "g1182.t1"; gene_id "g1182"; Scaffold_7 AUGUSTUS CDS 5685779 5686054 0.27 - 0 transcript_id "g1182.t1"; gene_id "g1182"; Scaffold_7 AUGUSTUS CDS 5686121 5686222 0.27 - 0 transcript_id "g1182.t1"; gene_id "g1182"; Scaffold_7 AUGUSTUS start_codon 5686220 5686222 . - 0 transcript_id "g1182.t1"; gene_id "g1182"; # protein sequence = [MLEITLITTPGFVWVSRRRIRRTSSADELKLQRINNVGVNAPTIAMINIILVTPALFALNLTSFLLNALDIIDIPGIN # NTPASNDPTIEPSTNRPLPEDKAIEYKRISIIEPNVALITAPIPIEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1182 ### # start gene g1183 Scaffold_7 AUGUSTUS gene 5692484 5693080 0.99 + . g1183 Scaffold_7 AUGUSTUS transcript 5692484 5693080 0.99 + . g1183.t1 Scaffold_7 AUGUSTUS start_codon 5692484 5692486 . + 0 transcript_id "g1183.t1"; gene_id "g1183"; Scaffold_7 AUGUSTUS CDS 5692484 5693080 0.99 + 0 transcript_id "g1183.t1"; gene_id "g1183"; Scaffold_7 AUGUSTUS stop_codon 5693078 5693080 . + 0 transcript_id "g1183.t1"; gene_id "g1183"; # protein sequence = [MSFARFALWLASTSLVLAQSASNSTIATSSTAATDIGSLSTSLLSTLSISFPLSTIPSSTASILSSIASTETATVLSS # SVSGSAASTSTANVSISSISGSATSSLSASATSVSITTAATTSSATSEPLTESRVTVPISSYTFSSFPVPSETAIPNVFPVTDPMDPPPVGAAVVPDF # EAAWAAAYQKAEALVSIAILRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1183 ### # start gene g1184 Scaffold_7 AUGUSTUS gene 5699177 5700385 0.24 + . g1184 Scaffold_7 AUGUSTUS transcript 5699177 5700385 0.24 + . g1184.t1 Scaffold_7 AUGUSTUS start_codon 5699177 5699179 . + 0 transcript_id "g1184.t1"; gene_id "g1184"; Scaffold_7 AUGUSTUS CDS 5699177 5699356 0.41 + 0 transcript_id "g1184.t1"; gene_id "g1184"; Scaffold_7 AUGUSTUS CDS 5699529 5699653 0.43 + 0 transcript_id "g1184.t1"; gene_id "g1184"; Scaffold_7 AUGUSTUS CDS 5699836 5700385 0.47 + 1 transcript_id "g1184.t1"; gene_id "g1184"; Scaffold_7 AUGUSTUS stop_codon 5700383 5700385 . + 0 transcript_id "g1184.t1"; gene_id "g1184"; # protein sequence = [MLVPHWVLPENVVACESDFQKLSLRLFPHHLQSLKKDVAVAELIQSLIEFSHRLFEVTDYLSTEDLKSLKSSLRITER # HHKGGQIFCCLPKHGQPQLKSVHFIVKLTAAMDVEYSPQKKYNEQRKDARRKSRIERGNEEYDLLHKSSEFWPQLVPFAVSMSCIAKYRQSIQYIVPS # ICACCGSEDRKFTGCYLPQSQWPVMSFLTVEDPFILSHTPQARFTYICQDLDGLLLDPRGIRALDFDCTVFEMYLCRECLAYMHRSIMPRLALKNHLY # RGELPKIYKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1184 ### # start gene g1185 Scaffold_7 AUGUSTUS gene 5700729 5706367 0.43 + . g1185 Scaffold_7 AUGUSTUS transcript 5700729 5706367 0.43 + . g1185.t1 Scaffold_7 AUGUSTUS start_codon 5700729 5700731 . + 0 transcript_id "g1185.t1"; gene_id "g1185"; Scaffold_7 AUGUSTUS CDS 5700729 5705554 0.44 + 0 transcript_id "g1185.t1"; gene_id "g1185"; Scaffold_7 AUGUSTUS CDS 5705644 5706367 0.82 + 1 transcript_id "g1185.t1"; gene_id "g1185"; Scaffold_7 AUGUSTUS stop_codon 5706365 5706367 . + 0 transcript_id "g1185.t1"; gene_id "g1185"; # protein sequence = [MYPDNNLLPGLQDRFIYDHDTSVADVFGIESDGFDDHPADLLSHQSEVLLERSGVYDSESQDVPARFMTASSIHNIAQ # ALPSTGFGTSDFIIRYGKDPIDEYNNPDLFPGMFPTLYPLGIGGFEDHRQCPAISFEAHVQHLLDQSLRNFRYHHFFSFVALNVIQRRKAHLHTSLSI # SSNKYHYIASELLAVTPNILSNLANKLKNESDNSSFTEDEQHAFRLLKEVNIIAAKIPGSQASKTKIRQQIRSYFAYFGLPHLFVTLNPSAVHSPVFQ # VMYGDQNVNLSQRFPAVVQPRSERAYRVAHDPVAAADFFDFMYHVIFEDLFGWDFKNGKSTQQGGLFGHLRAFYGCAELTERGCFHGHYLLFLRGGLN # PSEVHKKMHHVEEYQKQFFSFFEDIIHHHLPGTDYNCAPQYESRSEMPPDVPELDSEGDVSSELLSAWQKLFTDEHKKIGEQLQRHRCRPVCHKGKSA # NSDCRFGYPHDVVEHSSFDSNHNSIILSRKESDVNGHNRFLLVYTRHNHDVKCILSGKAAKAAMFYISDYITKVPLNTEALLSTLSKAVASITSEDID # ETPVMNAKRLLHRCLTHFGRKQQIHSQQCARYLRGLTDSMSSHSTIPLPSASLMMFVQNEYRHLLDKYLDQDCSENLDIQVHFSFREGKLVHSNQVID # YWYRDLSLSDMCFYDFIKYISLQTQSKTKTVHNSDTRTGVLRRHKLLSGHPLQSTHELIQHTNFKQGDVGREFVPMMIGAVPPRRTDKLYALFVLAHF # KEFSILNPLISSNDVDGEFHSFQLHTDHQQILNNWEEIHECADQRDAERLRKKASELAKSSQLVTGMESVLDDDEYADYNFVVPKGVKNIESKVFSDM # QQMQLLKTDLCSAAWLSSPPSALRLSIQKSAVVSPMLPLLTIQKVDKWIKEGKSEAERLANIRYKHSNISNQSSSDIHNSDAEVPQSSVSYSFQDIGN # SSNPTSKVLTASQLKDKIANEFSLNKKQQFAFDIIASFMIFREIFKLPEWSAKEPMVMLLTGPGGTGKTHIVQAVQKVMEYYRMDHGYRALAPTGNAA # SLINGRTIHSGLKIRVREHKNGKSHRPLGELNENIVVSASVKKNNNLRIEWKDVCLLLIDEISMVDSILLAEVDASLRYAKEKPNDFFGGINVIFCGD # PFQYPPVGTPLYAPIRSVSIQTDEEMMRRLGRIAWKSINTVIELDEQKRMQGDPEYAAAVGRLRTRECIQSDVELFNTRAIRTLSNPQGVMFTTEQQY # MASIIVSKNSVRQALNDFKTTAICRGQEGPELIDVVAHDQLQYKKHTNANLNGKKVYPSVAQQQQLLAMDTSSGKLKDGLPGILKLYIGMPIIMKHEN # LNTELGVNGSRGFLRKLDLSVDNNGFTYCKYALVEFPDSKVHLPGLPLHFFPVKARSWKCSTFIINENEEKILVSVTRTQLPFEPLFALTGQGAQVNT # LGAILCMLHLGGFGAYVAASRPRSRDGLFITRKVTLDDLNKPGIPYDLWFETQRFHVMAHNTMVIWGFCKGELKEVPDAECEKRGNFSKIQYQFGDDR # HDMQHNMSLNTESDHINEDQLIDGPRKNECSFQSQLPYSAQFGPLWDHVNWSCAFDSAFVVSLSQIHADFTNQSLWNDMRNQWRDILFKEHGSTCERY # GPVLLSVSTLLEWHVPLYHAVLTTFCSSHQTLHQHKSYIRCSNLIFPHSKPLVSQNNINMSVQCYVDSFNDFTDDSITSCVTHCNPSCHSIASITNDI # SQVIIFELNGVTTIVPSLELIVPFHNTDIQLKYKLSGIIYFGSSHFTVRIFNESGIWKYDGQVNNGHYQHDYVISDIDLMELSGRHAHVLLYTFLSSH # TNVNANM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1185 ### # start gene g1186 Scaffold_7 AUGUSTUS gene 5710742 5712184 0.11 + . g1186 Scaffold_7 AUGUSTUS transcript 5710742 5712184 0.11 + . g1186.t1 Scaffold_7 AUGUSTUS start_codon 5710742 5710744 . + 0 transcript_id "g1186.t1"; gene_id "g1186"; Scaffold_7 AUGUSTUS CDS 5710742 5710927 0.55 + 0 transcript_id "g1186.t1"; gene_id "g1186"; Scaffold_7 AUGUSTUS CDS 5711051 5711263 0.23 + 0 transcript_id "g1186.t1"; gene_id "g1186"; Scaffold_7 AUGUSTUS CDS 5711424 5711466 0.29 + 0 transcript_id "g1186.t1"; gene_id "g1186"; Scaffold_7 AUGUSTUS CDS 5711537 5711584 0.62 + 2 transcript_id "g1186.t1"; gene_id "g1186"; Scaffold_7 AUGUSTUS CDS 5711640 5712184 0.63 + 2 transcript_id "g1186.t1"; gene_id "g1186"; Scaffold_7 AUGUSTUS stop_codon 5712182 5712184 . + 0 transcript_id "g1186.t1"; gene_id "g1186"; # protein sequence = [MIAENAKVLDPLSSFMQYYDVFAASPIPTPSNVSLQRVSALSEYGGLWMVNESREVVRIGLVITIDSFRRACARLFFH # EVYTPAECTAEVAEIYNAHKTRFNDVLNLLQHCATQYIDQASATDGKIYVALDCFHSSMSTIRGNLPDPQKERNLNALKTSASIDAVDIWHRQLGHWP # DSEGYIHDLAEKHDLSNVKFHIPSIYDAQGSLVHPMDYENVLVPGCFVMVELEFHLLVYHIPSNALFDEINNIPRWDITRSTDGKAINRPSRIFSNMI # NRLHVLSDDVDDLGLLLHTEALNRANKIKQDIEHKRQAEEAREIAKREEVMRIQQTMTRAKALSDMKKKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1186 ### # start gene g1187 Scaffold_7 AUGUSTUS gene 5719945 5720649 0.78 - . g1187 Scaffold_7 AUGUSTUS transcript 5719945 5720649 0.78 - . g1187.t1 Scaffold_7 AUGUSTUS stop_codon 5719945 5719947 . - 0 transcript_id "g1187.t1"; gene_id "g1187"; Scaffold_7 AUGUSTUS CDS 5719945 5720649 0.78 - 0 transcript_id "g1187.t1"; gene_id "g1187"; Scaffold_7 AUGUSTUS start_codon 5720647 5720649 . - 0 transcript_id "g1187.t1"; gene_id "g1187"; # protein sequence = [MFYLRENISHVPDLELSWYKEFNIQQSNSVQIKGSSNANAQEEASQSFWEQDELSRTAGLLLETVKTKKNPKFQNSIF # LNLMTQLCNQKVAVRGNEMMENNGTGTAGQDSRVDVKGKGKEKASDLLFIPYAGWVTMLGQTIGNNATMAGISPYNEQNDIQEDVNNAYFRQENKDHT # RYCNGMDAQKSQRQTVEVSYTNDGCQLEAYEATREWVWRNNDHRDILHSIRMRYAIPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1187 ### # start gene g1188 Scaffold_7 AUGUSTUS gene 5738370 5738858 0.24 + . g1188 Scaffold_7 AUGUSTUS transcript 5738370 5738858 0.24 + . g1188.t1 Scaffold_7 AUGUSTUS start_codon 5738370 5738372 . + 0 transcript_id "g1188.t1"; gene_id "g1188"; Scaffold_7 AUGUSTUS CDS 5738370 5738858 0.24 + 0 transcript_id "g1188.t1"; gene_id "g1188"; Scaffold_7 AUGUSTUS stop_codon 5738856 5738858 . + 0 transcript_id "g1188.t1"; gene_id "g1188"; # protein sequence = [MREARTAYHEGRTKYHGAGTGLILNSLVMTHFLRTLTVLVHASENTPEWLGFLAPDSLELALTLGTKLISIADSSTED # TGIAEKGTKEASVLASALELALIVLDGCIQLDGGRSLGLDQATLLMSVSEWASVVFSRLEDGIKLKDGGESKVPILDVRLPELS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1188 ### # start gene g1189 Scaffold_7 AUGUSTUS gene 5740753 5741220 0.93 + . g1189 Scaffold_7 AUGUSTUS transcript 5740753 5741220 0.93 + . g1189.t1 Scaffold_7 AUGUSTUS start_codon 5740753 5740755 . + 0 transcript_id "g1189.t1"; gene_id "g1189"; Scaffold_7 AUGUSTUS CDS 5740753 5741220 0.93 + 0 transcript_id "g1189.t1"; gene_id "g1189"; Scaffold_7 AUGUSTUS stop_codon 5741218 5741220 . + 0 transcript_id "g1189.t1"; gene_id "g1189"; # protein sequence = [MSTAVPPALHKPPSVPQPPRQPSPQLAYNPFAPAIVPPPPPRPPGSFVLDERARMAAAIAAKLGAIQPPQPTESAPPP # VEEQLKRFATYNDFTLLFTDTIYLIADPTLMDLPLVSWPSGGAKKDKGCALMDLALSMPSQLNRSKEARVLEPLATG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1189 ### # start gene g1190 Scaffold_7 AUGUSTUS gene 5742877 5744094 0.95 - . g1190 Scaffold_7 AUGUSTUS transcript 5742877 5744094 0.95 - . g1190.t1 Scaffold_7 AUGUSTUS stop_codon 5742877 5742879 . - 0 transcript_id "g1190.t1"; gene_id "g1190"; Scaffold_7 AUGUSTUS CDS 5742877 5744094 0.95 - 0 transcript_id "g1190.t1"; gene_id "g1190"; Scaffold_7 AUGUSTUS start_codon 5744092 5744094 . - 0 transcript_id "g1190.t1"; gene_id "g1190"; # protein sequence = [MIGVGGNNGTTLCATILANRHNIVWHTKQGIRQPNYIGSLLRASTVRIGTEASTGKDVHVPVSDVLPMVHPNDLVLGG # WDISRVPLEKAMQRAQVLDYDLQRQVAPHMALLGKPLPSIYYPDFIAANQEMRADNLISGQDKQVHLEHICADIRKFKKNNGLDRTVVFWTANTERYS # DIIPGVNDTAENLLSSIKSSHPEVSPSTLFAVAAILEDEPFINGAPQNTFVPGVIALAELHKCFIGGDDLKSGETKLKSVLAEFLVNAGIKPLSISSY # NHLGNNDGRNLSAEKQFRSKEISKSSVVDDMVDANRVLYKAPEVGEKGVPVGKGEHPDHIVVIKYVPAVGDSKRAIDEYYSEIFCGGRNTISIFNECE # VYFTSCSTFTELTPVDIGLPPRYPIHSRPYHSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1190 ### # start gene g1191 Scaffold_7 AUGUSTUS gene 5750332 5750814 0.92 + . g1191 Scaffold_7 AUGUSTUS transcript 5750332 5750814 0.92 + . g1191.t1 Scaffold_7 AUGUSTUS start_codon 5750332 5750334 . + 0 transcript_id "g1191.t1"; gene_id "g1191"; Scaffold_7 AUGUSTUS CDS 5750332 5750814 0.92 + 0 transcript_id "g1191.t1"; gene_id "g1191"; Scaffold_7 AUGUSTUS stop_codon 5750812 5750814 . + 0 transcript_id "g1191.t1"; gene_id "g1191"; # protein sequence = [MTVGNNFPSSVQRLHVIFELTEGASRIAGRIDFAHLRNLTHIWLTFDDSDAQSPGDEFRVTEVLPLPDIGDWINHYCP # DDLQVLILEKDGGVESPLEDEEYRQYVDLPLVCLVNDGSIDLKYLADEEKPYAEQLTFDAEGFTTEQIWEHSLAVVAQKNSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1191 ### # start gene g1192 Scaffold_7 AUGUSTUS gene 5758372 5759175 0.8 - . g1192 Scaffold_7 AUGUSTUS transcript 5758372 5759175 0.8 - . g1192.t1 Scaffold_7 AUGUSTUS stop_codon 5758372 5758374 . - 0 transcript_id "g1192.t1"; gene_id "g1192"; Scaffold_7 AUGUSTUS CDS 5758372 5759175 0.8 - 0 transcript_id "g1192.t1"; gene_id "g1192"; Scaffold_7 AUGUSTUS start_codon 5759173 5759175 . - 0 transcript_id "g1192.t1"; gene_id "g1192"; # protein sequence = [MRLIPSSRLLVCLYRLYTVPIQLGPTLTSVHLDTGSSDLWVTTDACTTASCGKLTTPSYPMTSFNASGSSVTMNYGDS # TTGTKASGPIGFDSATLAGIAIQGQTFAAVNFTTNTVVQDGAAGIFGLGFPAGSDIQAAVVEAQSGPLKPTDDFVQDTYKYGPLLARIAATNALEDDV # FSISLQRSEIDVGIDNGTLTIGKLPDGVDNSSLTWVPVRLYSPSEGGLSPPTFASAEVSLVPDFLLAAFSFRLLGVSFVCSNSRIFFVVNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1192 ### # start gene g1193 Scaffold_7 AUGUSTUS gene 5762687 5763322 0.71 + . g1193 Scaffold_7 AUGUSTUS transcript 5762687 5763322 0.71 + . g1193.t1 Scaffold_7 AUGUSTUS start_codon 5762687 5762689 . + 0 transcript_id "g1193.t1"; gene_id "g1193"; Scaffold_7 AUGUSTUS CDS 5762687 5763322 0.71 + 0 transcript_id "g1193.t1"; gene_id "g1193"; Scaffold_7 AUGUSTUS stop_codon 5763320 5763322 . + 0 transcript_id "g1193.t1"; gene_id "g1193"; # protein sequence = [MVHSHTVLTAVIAVGVATSALAAPINPVPSRPTTVTTVTGAHPQNVPTRPHTISRQVTSDPQLPPVVPGKSLNAREFD # VIVEEDSHPHHPHPHHHHEGFEVEVEEHHGEEFKLDFEEEHRYPHHPHHYHHHGGEDFEVDVEFDEHHPITPILTTTTVRTSRSTSSSKSIVLIVTTA # RKPSKSRSKKSPPPPPSPSPRWGTLRAQASRRKSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1193 ### # start gene g1194 Scaffold_7 AUGUSTUS gene 5771732 5772355 0.72 + . g1194 Scaffold_7 AUGUSTUS transcript 5771732 5772355 0.72 + . g1194.t1 Scaffold_7 AUGUSTUS start_codon 5771732 5771734 . + 0 transcript_id "g1194.t1"; gene_id "g1194"; Scaffold_7 AUGUSTUS CDS 5771732 5772355 0.72 + 0 transcript_id "g1194.t1"; gene_id "g1194"; Scaffold_7 AUGUSTUS stop_codon 5772353 5772355 . + 0 transcript_id "g1194.t1"; gene_id "g1194"; # protein sequence = [MTFLFRYIVFPQDLTYGYYSLHKKHGDPKKPLDWAIVEATSINSDGHIVPGASVGASPEILQSAEKIIIEVNTRIPNL # EGLHDINSSFLPPHRQPYLITHPSDRIGSTAIPIDPDRVVAIIESDKPDNTGLNAPENDESRAIAKHLIEFLEKEVKEGRLPKSLLPLQSGIGNVANS # IIGGLAEGPFDNVQVWTEVLQGKLLLHCAFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1194 ### # start gene g1195 Scaffold_7 AUGUSTUS gene 5785266 5786750 0.32 + . g1195 Scaffold_7 AUGUSTUS transcript 5785266 5786750 0.32 + . g1195.t1 Scaffold_7 AUGUSTUS start_codon 5785266 5785268 . + 0 transcript_id "g1195.t1"; gene_id "g1195"; Scaffold_7 AUGUSTUS CDS 5785266 5785396 0.92 + 0 transcript_id "g1195.t1"; gene_id "g1195"; Scaffold_7 AUGUSTUS CDS 5785618 5785791 0.92 + 1 transcript_id "g1195.t1"; gene_id "g1195"; Scaffold_7 AUGUSTUS CDS 5786459 5786750 0.32 + 1 transcript_id "g1195.t1"; gene_id "g1195"; Scaffold_7 AUGUSTUS stop_codon 5786748 5786750 . + 0 transcript_id "g1195.t1"; gene_id "g1195"; # protein sequence = [MVAHDFPDRWPGLLDEIKRLLGSGNIREVHAGCVAALEAVRAFSTHQQSAESLVPWGQLLFNVVNLAIPKEAVPEDEE # EREQSEWWIAKKWAYATLGRLFHSHPSSNSSPQQRFGALNMTAALGPWIMKHPEVATNMEQFIQQFVTPEFASPEPYLRGIVSAQPLIHFRVNKPPLS # CLFVCDRLAKLLVPLPNMGWNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1195 ### # start gene g1196 Scaffold_7 AUGUSTUS gene 5787185 5787724 0.37 + . g1196 Scaffold_7 AUGUSTUS transcript 5787185 5787724 0.37 + . g1196.t1 Scaffold_7 AUGUSTUS start_codon 5787185 5787187 . + 0 transcript_id "g1196.t1"; gene_id "g1196"; Scaffold_7 AUGUSTUS CDS 5787185 5787724 0.37 + 0 transcript_id "g1196.t1"; gene_id "g1196"; Scaffold_7 AUGUSTUS stop_codon 5787722 5787724 . + 0 transcript_id "g1196.t1"; gene_id "g1196"; # protein sequence = [MLIEPQCESYLRLARESNNQETLDSNPNDLESIMADADDDKTYAAMGVAKTIWTVRERLTSCMKLVANTQPDLPLRFL # KIDIQIVTSVDSSPEILAQIQEIIIPIIVYTLEAKLLGQWFPFAVITLFQYTFYHPDLFDNVYDLIDSLTFKTRSVSPNMWPVFELTYKLFKNDAVDF # LEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1196 ### # start gene g1197 Scaffold_7 AUGUSTUS gene 5788186 5789054 0.13 + . g1197 Scaffold_7 AUGUSTUS transcript 5788186 5789054 0.13 + . g1197.t1 Scaffold_7 AUGUSTUS start_codon 5788186 5788188 . + 0 transcript_id "g1197.t1"; gene_id "g1197"; Scaffold_7 AUGUSTUS CDS 5788186 5788479 0.23 + 0 transcript_id "g1197.t1"; gene_id "g1197"; Scaffold_7 AUGUSTUS CDS 5788713 5789054 0.38 + 0 transcript_id "g1197.t1"; gene_id "g1197"; Scaffold_7 AUGUSTUS stop_codon 5789052 5789054 . + 0 transcript_id "g1197.t1"; gene_id "g1197"; # protein sequence = [MENTQPGCSRVFFDKWFAAINNEKQLPRVHDKKLSIITLTALMEMEPGMVPEPLREGWPGIVAGALRLFKALPKAVAG # EELLSQNSTMLIVKFHRPESGARLRAKSEKLASGEDADDDSDEEEIEEELGYISPLDDVNPYTAFKQSLTGKLIVCPRLGRFSSYSNIFSLPVFQMRN # PAGYQAATTALNVDEQTLLMEIMRIADQPTPLAAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1197 ### # start gene g1198 Scaffold_7 AUGUSTUS gene 5796104 5796298 0.82 + . g1198 Scaffold_7 AUGUSTUS transcript 5796104 5796298 0.82 + . g1198.t1 Scaffold_7 AUGUSTUS start_codon 5796104 5796106 . + 0 transcript_id "g1198.t1"; gene_id "g1198"; Scaffold_7 AUGUSTUS CDS 5796104 5796298 0.82 + 0 transcript_id "g1198.t1"; gene_id "g1198"; Scaffold_7 AUGUSTUS stop_codon 5796296 5796298 . + 0 transcript_id "g1198.t1"; gene_id "g1198"; # protein sequence = [MTSAVKDPINEENPNLSPTSPAEDSDTTPLYPTSEPEPIPGLHGVPVRCKFCSLTSAIQSKSDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1198 ### # start gene g1199 Scaffold_7 AUGUSTUS gene 5826392 5826904 0.5 + . g1199 Scaffold_7 AUGUSTUS transcript 5826392 5826904 0.5 + . g1199.t1 Scaffold_7 AUGUSTUS start_codon 5826392 5826394 . + 0 transcript_id "g1199.t1"; gene_id "g1199"; Scaffold_7 AUGUSTUS CDS 5826392 5826630 0.67 + 0 transcript_id "g1199.t1"; gene_id "g1199"; Scaffold_7 AUGUSTUS CDS 5826685 5826904 0.5 + 1 transcript_id "g1199.t1"; gene_id "g1199"; Scaffold_7 AUGUSTUS stop_codon 5826902 5826904 . + 0 transcript_id "g1199.t1"; gene_id "g1199"; # protein sequence = [MTPDDSKRTAVAEPDSVQPSMAPTLRESKSIDNCSPSLIAKLASGIVLDIRARAPYYVRDWTDAWNYRVVPATSLIFF # ANVLPGIAFSLDLIETTEQYGVAEVLLSSFMAAFVFSVFGAQPLTIAGVTGQHLVLQILQYYNLEVKRTYHGIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1199 ### # start gene g1200 Scaffold_7 AUGUSTUS gene 5834998 5835809 0.98 - . g1200 Scaffold_7 AUGUSTUS transcript 5834998 5835809 0.98 - . g1200.t1 Scaffold_7 AUGUSTUS stop_codon 5834998 5835000 . - 0 transcript_id "g1200.t1"; gene_id "g1200"; Scaffold_7 AUGUSTUS CDS 5834998 5835172 0.99 - 1 transcript_id "g1200.t1"; gene_id "g1200"; Scaffold_7 AUGUSTUS CDS 5835223 5835809 0.98 - 0 transcript_id "g1200.t1"; gene_id "g1200"; Scaffold_7 AUGUSTUS start_codon 5835807 5835809 . - 0 transcript_id "g1200.t1"; gene_id "g1200"; # protein sequence = [MLGTFAKFAPNPEAEAAIKELNTNKEVYHEIVANGCLKAGEVLQLAAGNDIQAIPTPENTTAWPIPFDMIVSSIPRLQ # PRYYSISSSPKLHPNSIHVTCVVLKYQSTPNERVPERSVYGVGSNFLLNLKYAANGEEAPLLGSTGVAGAVVPSYAIEGPRGAYKQENIYKAPIHVRR # STFRLPTNPKSPLIMVGPGLVSPPFEVLSKNALPLPAALSKNGPDALADWGRITLFYGCRKSTEDFLYQDEWPSLHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1200 ### # start gene g1201 Scaffold_7 AUGUSTUS gene 5836225 5836867 0.76 - . g1201 Scaffold_7 AUGUSTUS transcript 5836225 5836867 0.76 - . g1201.t1 Scaffold_7 AUGUSTUS stop_codon 5836225 5836227 . - 0 transcript_id "g1201.t1"; gene_id "g1201"; Scaffold_7 AUGUSTUS CDS 5836225 5836800 0.93 - 0 transcript_id "g1201.t1"; gene_id "g1201"; Scaffold_7 AUGUSTUS CDS 5836856 5836867 0.76 - 0 transcript_id "g1201.t1"; gene_id "g1201"; Scaffold_7 AUGUSTUS start_codon 5836865 5836867 . - 0 transcript_id "g1201.t1"; gene_id "g1201"; # protein sequence = [MKAGNKRLAIFYGSQTGTAEEYAIRLAKEAKAKFGLTSLVCDPEEYDFETLDTVPEDCAVFFVMATYGEGEPTDNAVQ # LMQNLQDESFEFSKGAHDLSGLKYVVFGLGNKTYEHYNVISQYVDTALEKMGAIRMGIRGEGDDDKSMEEDYLEWKDGMWEAFATAMGVEEGQGGDTA # DFAVRELESHPEEKVYLGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1201 ### # command line: # augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000007