# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_1/input_1.fa_chunk_0000006 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 3662990, name = Scaffold_4) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 Scaffold_4 AUGUSTUS gene 1 962 0.42 - . g1 Scaffold_4 AUGUSTUS transcript 1 962 0.42 - . g1.t1 Scaffold_4 AUGUSTUS CDS 650 962 0.66 - 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_4 AUGUSTUS start_codon 960 962 . - 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MTSESRGTGSKRTGRKERGRAPPPPPPPPPPSGGPGDSNSEGSDEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYD # PDQPWYYDPRQGWHRKAAPRPPNEGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 Scaffold_4 AUGUSTUS gene 9833 11514 0.52 - . g2 Scaffold_4 AUGUSTUS transcript 9833 11514 0.52 - . g2.t1 Scaffold_4 AUGUSTUS stop_codon 9833 9835 . - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_4 AUGUSTUS CDS 9833 10162 0.99 - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_4 AUGUSTUS CDS 10245 10641 0.86 - 1 transcript_id "g2.t1"; gene_id "g2"; Scaffold_4 AUGUSTUS CDS 11222 11514 0.74 - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_4 AUGUSTUS start_codon 11512 11514 . - 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWD # SAALKWAYGRGLAERIKDEMARLPEPATLADYVKKFFVLTIVIGNARKLESVRLPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNH # LGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 Scaffold_4 AUGUSTUS gene 15757 16122 0.37 - . g3 Scaffold_4 AUGUSTUS transcript 15757 16122 0.37 - . g3.t1 Scaffold_4 AUGUSTUS stop_codon 15757 15759 . - 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_4 AUGUSTUS CDS 15757 16122 0.37 - 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_4 AUGUSTUS start_codon 16120 16122 . - 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MNTYPLLCINECYVNLYDATVFTTFDLKLGYWQVRLAEEDKAKTAFTCRYSHFQFHVMPFGLTNALATFQNMMNNILA # PYIDDFIMVYLDDIVIYSRSIDDHDTHIELVLAALARGSHPQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 Scaffold_4 AUGUSTUS gene 20864 21157 0.74 - . g4 Scaffold_4 AUGUSTUS transcript 20864 21157 0.74 - . g4.t1 Scaffold_4 AUGUSTUS stop_codon 20864 20866 . - 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_4 AUGUSTUS CDS 20864 21157 0.74 - 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_4 AUGUSTUS start_codon 21155 21157 . - 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAGRRTRLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 Scaffold_4 AUGUSTUS gene 22158 22493 0.98 - . g5 Scaffold_4 AUGUSTUS transcript 22158 22493 0.98 - . g5.t1 Scaffold_4 AUGUSTUS stop_codon 22158 22160 . - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_4 AUGUSTUS CDS 22158 22493 0.98 - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_4 AUGUSTUS start_codon 22491 22493 . - 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVNEPPTNKLEERIKLNQQDRSPINLIDE # TNKQVVNEAIGVEKPINLNTEEVFTKYKPVEKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 Scaffold_4 AUGUSTUS gene 23033 24463 1 - . g6 Scaffold_4 AUGUSTUS transcript 23033 24463 1 - . g6.t1 Scaffold_4 AUGUSTUS stop_codon 23033 23035 . - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_4 AUGUSTUS CDS 23033 24463 1 - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_4 AUGUSTUS start_codon 24461 24463 . - 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMLEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVHLIMKNRQVKMIQR # EIFIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 Scaffold_4 AUGUSTUS gene 24493 27480 0.31 - . g7 Scaffold_4 AUGUSTUS transcript 24493 27480 0.31 - . g7.t1 Scaffold_4 AUGUSTUS stop_codon 24493 24495 . - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_4 AUGUSTUS CDS 24493 26462 0.52 - 2 transcript_id "g7.t1"; gene_id "g7"; Scaffold_4 AUGUSTUS CDS 27465 27480 0.37 - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_4 AUGUSTUS start_codon 27478 27480 . - 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 Scaffold_4 AUGUSTUS gene 28270 29419 0.38 + . g8 Scaffold_4 AUGUSTUS transcript 28270 29419 0.38 + . g8.t1 Scaffold_4 AUGUSTUS start_codon 28270 28272 . + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_4 AUGUSTUS CDS 28270 28433 0.72 + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_4 AUGUSTUS CDS 28530 28841 0.55 + 1 transcript_id "g8.t1"; gene_id "g8"; Scaffold_4 AUGUSTUS CDS 28930 29419 0.73 + 1 transcript_id "g8.t1"; gene_id "g8"; Scaffold_4 AUGUSTUS stop_codon 29417 29419 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRPGQPPVVAPARGRSTTRIDFSNSPSHSPPLDPDDPGADNNNDDLDDNSGGLP # RGEPGDPSGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFNGLDPQKLKTGSAKEWFVPDILDSLPA # WTSSFKALVKELQDNFGVYDAQGKAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYERGLAERIKDEMARLPEPATLADYRQEVLRIDN # RYWKREAGKPFIARNPKKGSSDFKTSSTNQQNNCQPSGSSAPFTPKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 Scaffold_4 AUGUSTUS gene 31911 32288 0.81 + . g9 Scaffold_4 AUGUSTUS transcript 31911 32288 0.81 + . g9.t1 Scaffold_4 AUGUSTUS start_codon 31911 31913 . + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_4 AUGUSTUS CDS 31911 32288 0.81 + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_4 AUGUSTUS stop_codon 32286 32288 . + 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQISPSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 Scaffold_4 AUGUSTUS gene 32943 33323 0.99 + . g10 Scaffold_4 AUGUSTUS transcript 32943 33323 0.99 + . g10.t1 Scaffold_4 AUGUSTUS start_codon 32943 32945 . + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_4 AUGUSTUS CDS 32943 33323 0.99 + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_4 AUGUSTUS stop_codon 33321 33323 . + 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MINSIPPSGPSNQSNRFERDTTLRSLNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPR # DDPNISRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMDPAHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 Scaffold_4 AUGUSTUS gene 33666 34436 0.14 + . g11 Scaffold_4 AUGUSTUS transcript 33666 34436 0.14 + . g11.t1 Scaffold_4 AUGUSTUS start_codon 33666 33668 . + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_4 AUGUSTUS CDS 33666 33683 0.14 + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_4 AUGUSTUS CDS 33777 34436 0.58 + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_4 AUGUSTUS stop_codon 34434 34436 . + 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MSMDVDHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDKDGGEPINFIMGDGGKEPYQFDDFKDQM # DPRSGYLYETAQEADDMELDVQEALDEERSYEIRRNHMLEAKNATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESL # GEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDRSTTISGGKRKVYAHVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 Scaffold_4 AUGUSTUS gene 34664 35041 0.96 + . g12 Scaffold_4 AUGUSTUS transcript 34664 35041 0.96 + . g12.t1 Scaffold_4 AUGUSTUS start_codon 34664 34666 . + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_4 AUGUSTUS CDS 34664 35041 0.96 + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_4 AUGUSTUS stop_codon 35039 35041 . + 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MDVNIIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTNNAGQMKNMLAWLEEKYGIKGIRISAYN # SQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 Scaffold_4 AUGUSTUS gene 42286 43417 0.3 + . g13 Scaffold_4 AUGUSTUS transcript 42286 43417 0.3 + . g13.t1 Scaffold_4 AUGUSTUS start_codon 42286 42288 . + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_4 AUGUSTUS CDS 42286 42354 0.36 + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_4 AUGUSTUS CDS 42752 43417 0.51 + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_4 AUGUSTUS stop_codon 43415 43417 . + 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MAVRTLQVLTDDSPSTESSGDYDTHLSHFEAKCSFWSSENCFLSQGSDLISPSPANKAQAVPPRALRRIGKSKASRLT # LPRFVSIFLISSFLFDYSFCLSSVASPQSIHSKDSDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRS # RKIAPATAKGKSRQVVVSEDDSASNEVESEDEEEDEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 Scaffold_4 AUGUSTUS gene 46499 47175 0.78 + . g14 Scaffold_4 AUGUSTUS transcript 46499 47175 0.78 + . g14.t1 Scaffold_4 AUGUSTUS start_codon 46499 46501 . + 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_4 AUGUSTUS CDS 46499 46667 0.93 + 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_4 AUGUSTUS CDS 46749 46899 1 + 2 transcript_id "g14.t1"; gene_id "g14"; Scaffold_4 AUGUSTUS CDS 46959 47175 0.84 + 1 transcript_id "g14.t1"; gene_id "g14"; Scaffold_4 AUGUSTUS stop_codon 47173 47175 . + 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MFCIHDSFYVVESSQHSYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTP # PAPLESQSTKFIAATLNFQAAEFEFNANCILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHV # SA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 Scaffold_4 AUGUSTUS gene 47433 48545 0.51 - . g15 Scaffold_4 AUGUSTUS transcript 47433 48545 0.51 - . g15.t1 Scaffold_4 AUGUSTUS stop_codon 47433 47435 . - 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_4 AUGUSTUS CDS 47433 48545 0.51 - 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_4 AUGUSTUS start_codon 48543 48545 . - 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR # RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 Scaffold_4 AUGUSTUS gene 48828 49799 0.97 - . g16 Scaffold_4 AUGUSTUS transcript 48828 49799 0.97 - . g16.t1 Scaffold_4 AUGUSTUS stop_codon 48828 48830 . - 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_4 AUGUSTUS CDS 48828 49799 0.97 - 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_4 AUGUSTUS start_codon 49797 49799 . - 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKK # KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSR # ITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVF # SRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 Scaffold_4 AUGUSTUS gene 50042 50695 0.73 - . g17 Scaffold_4 AUGUSTUS transcript 50042 50695 0.73 - . g17.t1 Scaffold_4 AUGUSTUS stop_codon 50042 50044 . - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_4 AUGUSTUS CDS 50042 50695 0.73 - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_4 AUGUSTUS start_codon 50693 50695 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGHQLDMNYQKEVTKLFQKSWN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 Scaffold_4 AUGUSTUS gene 50752 51445 0.79 - . g18 Scaffold_4 AUGUSTUS transcript 50752 51445 0.79 - . g18.t1 Scaffold_4 AUGUSTUS stop_codon 50752 50754 . - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_4 AUGUSTUS CDS 50752 51005 0.98 - 2 transcript_id "g18.t1"; gene_id "g18"; Scaffold_4 AUGUSTUS CDS 51051 51367 0.95 - 1 transcript_id "g18.t1"; gene_id "g18"; Scaffold_4 AUGUSTUS CDS 51423 51445 0.8 - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_4 AUGUSTUS start_codon 51443 51445 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEEHETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPE # LSKHPKPFVPTGRYTEEGKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 Scaffold_4 AUGUSTUS gene 51770 52884 0.28 - . g19 Scaffold_4 AUGUSTUS transcript 51770 52884 0.28 - . g19.t1 Scaffold_4 AUGUSTUS stop_codon 51770 51772 . - 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_4 AUGUSTUS CDS 51770 52813 0.5 - 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_4 AUGUSTUS CDS 52858 52884 0.28 - 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_4 AUGUSTUS start_codon 52882 52884 . - 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MIMFNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTK # TNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPV # VVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLL # GRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEHDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 Scaffold_4 AUGUSTUS gene 53235 54760 0.68 - . g20 Scaffold_4 AUGUSTUS transcript 53235 54760 0.68 - . g20.t1 Scaffold_4 AUGUSTUS stop_codon 53235 53237 . - 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_4 AUGUSTUS CDS 53235 54039 0.94 - 1 transcript_id "g20.t1"; gene_id "g20"; Scaffold_4 AUGUSTUS CDS 54150 54760 0.69 - 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_4 AUGUSTUS start_codon 54758 54760 . - 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPLRLTNRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIR # AVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDS # KRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGK # K] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 Scaffold_4 AUGUSTUS gene 62792 64369 0.82 - . g21 Scaffold_4 AUGUSTUS transcript 62792 64369 0.82 - . g21.t1 Scaffold_4 AUGUSTUS stop_codon 62792 62794 . - 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_4 AUGUSTUS CDS 62792 64369 0.82 - 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_4 AUGUSTUS start_codon 64367 64369 . - 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRLASPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 Scaffold_4 AUGUSTUS gene 64420 65586 0.93 - . g22 Scaffold_4 AUGUSTUS transcript 64420 65586 0.93 - . g22.t1 Scaffold_4 AUGUSTUS stop_codon 64420 64422 . - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_4 AUGUSTUS CDS 64420 65586 0.93 - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_4 AUGUSTUS start_codon 65584 65586 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 Scaffold_4 AUGUSTUS gene 72419 72931 0.5 - . g23 Scaffold_4 AUGUSTUS transcript 72419 72931 0.5 - . g23.t1 Scaffold_4 AUGUSTUS stop_codon 72419 72421 . - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_4 AUGUSTUS CDS 72419 72931 0.5 - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_4 AUGUSTUS start_codon 72929 72931 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MFAISHSSSIVQQITTSSSVRDSSFNPSQTSSKASDLKHVLIPPTPTSNIHLAQTSKHPDITQTPLTPYLRSTVTVSL # PNSGACCDQCSSSVPSLQLKLLINDTRFQEQGLRRSQVITVPYVDEPKCGSKEYNVKFSDIYDSLQQTHTALDGTLYICPFITVRQLILYAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 Scaffold_4 AUGUSTUS gene 77139 77859 0.29 - . g24 Scaffold_4 AUGUSTUS transcript 77139 77859 0.29 - . g24.t1 Scaffold_4 AUGUSTUS stop_codon 77139 77141 . - 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_4 AUGUSTUS CDS 77139 77402 0.67 - 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_4 AUGUSTUS CDS 77507 77754 0.65 - 2 transcript_id "g24.t1"; gene_id "g24"; Scaffold_4 AUGUSTUS CDS 77841 77859 0.36 - 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_4 AUGUSTUS start_codon 77857 77859 . - 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MSVTGTITPTASSFVHAVSKEEEHYSTAKVLFDFTATSEFELSVSGEPFVAQFHNSEFKCSSEGSTVTVIEHDDGSGW # VKVKDGSGDGLGSTQGILSVIYVPVKAIYAYEARGSDELGLKDGELIELSSGPSGGQYYGEGWWEGEFPATAWFPRALARSLSTGSRYQFVGAKGYIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 Scaffold_4 AUGUSTUS gene 82889 83542 0.59 - . g25 Scaffold_4 AUGUSTUS transcript 82889 83542 0.59 - . g25.t1 Scaffold_4 AUGUSTUS stop_codon 82889 82891 . - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_4 AUGUSTUS CDS 82889 83289 0.99 - 2 transcript_id "g25.t1"; gene_id "g25"; Scaffold_4 AUGUSTUS CDS 83536 83542 0.61 - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_4 AUGUSTUS start_codon 83540 83542 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MIDSSSSAPTTSTSVSTPLSTSSSISVPTSSSSSTLQTTAVTEAEASSSASNLASESSATNTVTSVITVSSGPASSTT # AEIGSASSLSISSTSGSSASPSATEAAASSNSAWQPGVSQSQVYAFVVAGLLAACLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 Scaffold_4 AUGUSTUS gene 92205 93626 0.97 + . g26 Scaffold_4 AUGUSTUS transcript 92205 93626 0.97 + . g26.t1 Scaffold_4 AUGUSTUS start_codon 92205 92207 . + 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_4 AUGUSTUS CDS 92205 93626 0.97 + 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_4 AUGUSTUS stop_codon 93624 93626 . + 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MRLAEVIPPTQEYMQQFAPILDAIFIGPQKPVAAFDAFDTFWHTTQFSVNVPPQAWPKKVYEYIYGAPAISAAPSPKS # PYPVEETHVGEDTPDEGVGSVVSSKESRTEEASSLHDSEPCLFNSAPLCSPALEFPASPHPSHSGKFEAENAESDIRLLLPAPPILSTPPRASRAKLG # IAEALNSPPPLPHTPGESSLVFARRFDPLFSPKTPSSKSKHVSQLALSPIIKPLPPASPVASPNKKRRVSDSDKENLSPCPTRYSPQYRGSDVQSSPS # RLLSGNDRKRMFDSVEDGTPCPEQVKVERPTKRVRISTPIPPLALPLPAGPISSSLETADFDLALCSPSSSSSKAMSSTSSSPSSSSLDSTVDANNAA # TLCRTTSISKKRKALLMDCVEIVRITPSKLGQAMKTPTHRMTRKVSISKRKTVTMASPVQSPDGEGDLDPEFLNLSMSSESDSDYGSDPTTCVVKTTL # FRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 Scaffold_4 AUGUSTUS gene 100993 101736 1 - . g27 Scaffold_4 AUGUSTUS transcript 100993 101736 1 - . g27.t1 Scaffold_4 AUGUSTUS stop_codon 100993 100995 . - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_4 AUGUSTUS CDS 100993 101736 1 - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_4 AUGUSTUS start_codon 101734 101736 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MFAGFLSKDMTYSCAIFEDLDGDLKGGEQGELKGRWNGGHGLKKLTNGMTNGVPLLSMPSPASKKNDPGLPSPPLTSL # TKTESSTSPEPNVAAELPSSSDPLEDAQYRKLHHIIRKARILPGHRVLEIGSGWGSLSMLIAKTIPNTTVDTLTLSVEQQSLALSRIKAEGLAERVQV # HLIDYRHMPEEWKGKFDRVVSVEMIEAVGKEFLEGFWAKVEWAMKEQESVGVVQVITIPEASTSYVIGILR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 Scaffold_4 AUGUSTUS gene 103567 104274 0.77 - . g28 Scaffold_4 AUGUSTUS transcript 103567 104274 0.77 - . g28.t1 Scaffold_4 AUGUSTUS stop_codon 103567 103569 . - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_4 AUGUSTUS CDS 103567 104274 0.77 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_4 AUGUSTUS start_codon 104272 104274 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MSSLPPPEDPEDSNVPRKFERPSLPLCTLHLTHPSAETHTIKNNLPPKDISFSNHHSHSRVPLYNGVTLFPDPTQRAA # LLDLLCGILAIERKARVRNQGRAIAPGEILSSEANQASNSPSSLSSIPSSSLSSSVDDSTRIDNRASHAFLLYSDAHTALTADMAGVGLALWRIPMFE # GMGWESKPQGDVEGVAREASEKGSSDFNVEDSFGSSGSPWVKRYKYRSMFGDERYRVRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 Scaffold_4 AUGUSTUS gene 105645 106187 1 - . g29 Scaffold_4 AUGUSTUS transcript 105645 106187 1 - . g29.t1 Scaffold_4 AUGUSTUS stop_codon 105645 105647 . - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_4 AUGUSTUS CDS 105645 106187 1 - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_4 AUGUSTUS start_codon 106185 106187 . - 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MLRFLSQPTAIDLSPQIRALNEPVGSGEFWALEIDKFYGQNAFAYAIRYDPAVRSHVGGKVEINRGLLKPQQFHDATF # EESTLKFQSIKHRNEFLKQFETLDPNNNARNLEFLENFLTKMTTQFEGNPPVLATIPLRLTELITEMKRWEQHADGVVKTSKGWETVTKVDALFAKYD # QEHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 Scaffold_4 AUGUSTUS gene 107281 108054 0.62 - . g30 Scaffold_4 AUGUSTUS transcript 107281 108054 0.62 - . g30.t1 Scaffold_4 AUGUSTUS stop_codon 107281 107283 . - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_4 AUGUSTUS CDS 107281 108054 0.62 - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_4 AUGUSTUS start_codon 108052 108054 . - 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MLDKTTRGYMDWCHRRNSLFSASDSGNTESSSFPPSSQSQLRQYPVLGAPVPHSGSSVSLQISPHLSSTFHDSHPYLK # QYLQDLNSHPPVLPTFLALSVLGPSTPSRNNNIVGSIVMNDFGPGPGGFRGPSLGTLSAHPQSSSSGPMRLQSSSSFGTGQTQEPVYNIGSFERPAHS # YPDSHRRLQPPYYDGTGPWLPDIYSFSTVDGIGVENRYKPALAPPTPFMPSSPRVDENEKVNFEYGALTTDLEETSYMAWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 Scaffold_4 AUGUSTUS gene 115943 117311 0.25 - . g31 Scaffold_4 AUGUSTUS transcript 115943 117311 0.25 - . g31.t1 Scaffold_4 AUGUSTUS stop_codon 115943 115945 . - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_4 AUGUSTUS CDS 115943 116158 0.38 - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_4 AUGUSTUS CDS 116582 116844 0.36 - 2 transcript_id "g31.t1"; gene_id "g31"; Scaffold_4 AUGUSTUS CDS 116939 117162 0.55 - 1 transcript_id "g31.t1"; gene_id "g31"; Scaffold_4 AUGUSTUS CDS 117307 117311 0.73 - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_4 AUGUSTUS start_codon 117309 117311 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MFQVGRIIQQAGSESATTVPIGALTSDNRDYWADARKTVIDGSPENENALREIESAMIVVCLDDTKPVTREEISWSFI # VFDNGRSGFLGEHSCMDGTPTLRMNEFILAAIAQNKINLGPPRTSETEVSLPQPVEIKFVLNDKIRKDVASAEERFDKLVADHDLHYAAWAADGQGVD # RHLFGLKKIMNEGEELPAIFKDSSYAKTSHWELSTSQLSSDYFDGWGYGEGEIGNFISV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 Scaffold_4 AUGUSTUS gene 120383 120616 0.35 + . g32 Scaffold_4 AUGUSTUS transcript 120383 120616 0.35 + . g32.t1 Scaffold_4 AUGUSTUS start_codon 120383 120385 . + 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_4 AUGUSTUS CDS 120383 120616 0.35 + 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_4 AUGUSTUS stop_codon 120614 120616 . + 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MTALLVSTLLHEDAGVRTAAASLVFNAAAFLQKGRVDAVKNGGGSGKSDIEDEDWEVELVSAVVEAIDREKVNEDVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 Scaffold_4 AUGUSTUS gene 129204 130355 0.46 - . g33 Scaffold_4 AUGUSTUS transcript 129204 130355 0.46 - . g33.t1 Scaffold_4 AUGUSTUS stop_codon 129204 129206 . - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_4 AUGUSTUS CDS 129204 129701 0.61 - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_4 AUGUSTUS CDS 129786 130355 0.47 - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_4 AUGUSTUS start_codon 130353 130355 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MGGGEEASFKEMRKAAYLALDILASGPEDVSERFIDELMAHRVSVYPGSQELGHPQTIVEKGLKPPVEQIIELAKISF # ALSCIEQLVPVLSIKYLKGPVWNLVEPNLDLRHSPPGTSEASSSSPNYTTQQLMDQLMRETFESAHSVVLAILAANATNADLKGPGVSGSNDGKGKAR # EEEDLSLSDFCTRLNSAEGKLSTSQLRIAYAALVRSACSSVSPTRYESDELSQYTLAWYCISKLLSAIQNLGNDIPDLEQKHRLHITLIACVSALPLS # LLGRFFEEIDGVLRVDRESKDSEDMAALTMQDQNRTELIQALYRELSQMVGDREKEYVLRWWSAFAAENSVVPNRRTISKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 Scaffold_4 AUGUSTUS gene 131478 132065 0.92 - . g34 Scaffold_4 AUGUSTUS transcript 131478 132065 0.92 - . g34.t1 Scaffold_4 AUGUSTUS stop_codon 131478 131480 . - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_4 AUGUSTUS CDS 131478 132065 0.92 - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_4 AUGUSTUS start_codon 132063 132065 . - 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MSSHAYTNLLQHLHRAQPALPLETIQSALAFHIANHSLVPTPLAATAITSPLFLSYPFTLSRLQTLSNSFRHAIHLKF # TLLSGPRFTFFESIAHLAQWTKELIKGLQGGNPLLRLAAASGILLGLEDLRTQAKANSLDVDSNSSDLASQDPVPNATRAKVEDEVVIAFAEVMDQEG # VGREWESEFQQIALLSNSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 Scaffold_4 AUGUSTUS gene 133222 133965 0.49 + . g35 Scaffold_4 AUGUSTUS transcript 133222 133965 0.49 + . g35.t1 Scaffold_4 AUGUSTUS start_codon 133222 133224 . + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_4 AUGUSTUS CDS 133222 133965 0.49 + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_4 AUGUSTUS stop_codon 133963 133965 . + 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MSASSASASSASVSSASAASASSASASRASASAAASTSSTTASGASSSNGSGNIQSGSNSGGFPHWAIAVIVVLGFLA # IASSCLLAFFIMRRLRRRRELDSNRNSMGSSSPMMAHVQSPGSPLLAGGAEGPSSTGHGATGFQRAPSVVSPDGASSISHGGSAGEGGPFSGADAAII # ANAFRTMLRKPDFADAPVEEGESPDSQERGRVELSRELAEEGRDIRSVSSSRGVRVETLSDDGDTIQEADH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 Scaffold_4 AUGUSTUS gene 144322 146108 0.36 + . g36 Scaffold_4 AUGUSTUS transcript 144322 146108 0.36 + . g36.t1 Scaffold_4 AUGUSTUS start_codon 144322 144324 . + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_4 AUGUSTUS CDS 144322 144664 0.36 + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_4 AUGUSTUS CDS 144781 146108 0.56 + 2 transcript_id "g36.t1"; gene_id "g36"; Scaffold_4 AUGUSTUS stop_codon 146106 146108 . + 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MNTIQDKLEQLEDENGISRRRVRELELELEMCKKDVARERTRVIQKEEAILQNQRELERAVADAKRSMKGKTRARDTS # MHADIDASVRYKEAVEEKKGTLLYFCLLDLSFNYFWHARALKEKTSDITRLRVEVERLAGEVEVLRGVVEEGLKERRLARENSRASVSQVNSESMAQQ # EILEDTEEAVDSTGVREDEHQQELEEEEDGEEEEDEELEEEDLDDHEEPEPFDPMSIPGSSRELDALDKTVRTDRATLGTPGASQRNISRPTRFIDDD # ELERIAADVEERRSERSAAGTSRSQFDSRVLNPSRSASPVPAPTAATQRRATVEDVADKNDCVHNLHFQEENRSPSPALSSASVRLRRVKAREAQEIH # QPNRPSPPTPGHATTHNHRPSYRHADPDDSIAETPFPQIRGERLEKLFFSAPEHNQKTCNVCCRHRGPRGVDTRPMSPSWLPSRFAQDVNQHNYEADG # DVDEGFAEGSEEANQENFRDHFARGMKRNGKQRDMGPPRDTYEQRKNLPQQTVLARVIRELEDDFTHYKRFVPSSRYVVSVLMIDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 Scaffold_4 AUGUSTUS gene 147168 147910 0.53 - . g37 Scaffold_4 AUGUSTUS transcript 147168 147910 0.53 - . g37.t1 Scaffold_4 AUGUSTUS stop_codon 147168 147170 . - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_4 AUGUSTUS CDS 147168 147426 0.99 - 1 transcript_id "g37.t1"; gene_id "g37"; Scaffold_4 AUGUSTUS CDS 147483 147637 0.53 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_4 AUGUSTUS CDS 147698 147910 0.99 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_4 AUGUSTUS start_codon 147908 147910 . - 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MPVNEPSAPQHTIKATTESPSSSVKALKAKVDINDRDSHEDKPPISQPAANRPSSPNTDSSKNQNCETEAETSSSDED # EIIDMEIFNQILELDEDDTHDFSREMVEAYYTQAAQTFDDMDAALIKKDLMTLSDLGHFLKGSSATLGVAHVQNSCEKIQRYGQLRDEEKGIDLDSKQ # ALDLITLLISQVKGEYSIAEKWLRKWYTEHSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 Scaffold_4 AUGUSTUS gene 150542 151926 0.35 - . g38 Scaffold_4 AUGUSTUS transcript 150542 151926 0.35 - . g38.t1 Scaffold_4 AUGUSTUS stop_codon 150542 150544 . - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_4 AUGUSTUS CDS 150542 151610 0.36 - 1 transcript_id "g38.t1"; gene_id "g38"; Scaffold_4 AUGUSTUS CDS 151679 151926 0.42 - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_4 AUGUSTUS start_codon 151924 151926 . - 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MGVLLHGDAAFAGQGIVYETMGMHNLPNYGTGGTIHLIVNNQVGFTTDPRFARSTPYPSDIAKSIDAPIFHVNGDNVE # AVTFVRYGHNETDQPMFTQPRMYKAIEKQPTTLTQYSKFLVGRGTFTEKDIEEHKKWVWGMLEKAAAGAKDYVPTSKEWLSASWQGFPSPKQLADQTL # PTRATGSDEATLQRIGRAISSYPNGFTVHRNLGRILQTRGKTIEEGKNIDWSTAEALAFGALALENIHVRVSGRTSNVAPSPSVTPSFMTRPTKTIRP # SKRPRLLQARFIICNSSLSEYGTLGFELGYSLVSPDCLTMWEAQFGDFANNAQCIIDQFIASGERKWLQRSGLVMSLPHGYDGQGPEHSSARLERFLQ # LCDDHPNVFPSQEKIERQHQDCNMQVVYPTTPANYVSLSVLFHLLLLTSNDVLDVLVPRPSSSNSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 Scaffold_4 AUGUSTUS gene 158900 161443 0.11 - . g39 Scaffold_4 AUGUSTUS transcript 158900 161443 0.11 - . g39.t1 Scaffold_4 AUGUSTUS stop_codon 158900 158902 . - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_4 AUGUSTUS CDS 158900 159750 0.73 - 2 transcript_id "g39.t1"; gene_id "g39"; Scaffold_4 AUGUSTUS CDS 160180 161443 0.16 - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_4 AUGUSTUS start_codon 161441 161443 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MGVTGSRCSSPVSMSGLKGISGRKCTRLLTKDGRLLMQETAVPCGSFGISQAKVSDRSLFSIVQTNDFCVARLMDEST # EQRESLIDLILPFLAVPFRYPSSFAPANHFRLPLRSSVPSSSSTPFSIPTPHGPFPIYLHPNRHTWLTPHFDRWTPLCTPLAADAAKLVYFSRRETML # FSVLDLLPRNREEHRARIRARLAAQGNGEIDEFQVETVLQSELPRPTQEDFEELNAGLLGGDMVPSSPFSKGGGTPLPRTYDPWDDARKRLPNLLDPR # LNHTDISESNLDTAEQIFGGEIDESACSSRRWDADWWRLRLCRSAWVGQGEPESEDNLIASDVGIITNNADTSIVADVNDEEGEDCDDDGENDEVMSD # YDGDGQQNVDMPVNGGAEESAQVEQVDNDMQRNHTMLTGYPQKGAVFTPVPCAHDTEDDNDYGTDFDFDGDDGIHSSTRSHNSGDSSNTTRAGSSHDT # VPRSTSINPDDAFDQGIKDSWFPPNTTLSTKGDRVIASVPSSGPTNGGEYEYVAVRNRDISADDDFRFSPSVASTSTLTSARSEAEAQSQRKPGTFHD # RETCTGCIARERALLVARTEAQALIDIDPEHPADASSDGSSDEDLSEEEPAEDLPPYVPSAKTIPPCNGIRDVLITGSTDPRHAAAWGKWVWRGRVRK # WDGLVGLVRSVDSGVSFQVMFFVLSCLILFHHLCFHAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 Scaffold_4 AUGUSTUS gene 165401 167251 0.99 + . g40 Scaffold_4 AUGUSTUS transcript 165401 167251 0.99 + . g40.t1 Scaffold_4 AUGUSTUS start_codon 165401 165403 . + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_4 AUGUSTUS CDS 165401 167251 0.99 + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_4 AUGUSTUS stop_codon 167249 167251 . + 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MSRNASNSSKEPPPGQQKLGFHPTQPVRNQTTPASPAVSTNGDDDQRTLIAKAITMKLMASDEDCTVVLPVKLVKLAA # AAKDGKTKITQGDMWEKVALIGKILQECSFRDRMKHFRDELIEKMEERFDDETCRLEGRFKILRKEAEDTSKAAEKLKEKMEELVKDLETRGNAVREE # LVESEDGEVTQTNNNRISYATAAQAKSVAQHIQQPRHSPAIRDAEMRDRRIIIKSDVESDWKLTEKEIVTKANLAMDKMMDDEGVGTKMKVMAATKIR # GNGAFLLMGSVAEAESMKVGDRLVRFCEAWGSSAILRPNYHEVVVESLPVETMIENAYERSYIEKANELPANSIAQIRWIKPIGKRRNDQRYAHAIFS # MNSRETANKLIIHQAIVGSKALRARKNKSDPRRCAKCNVFGHIAEQCKAEHDSCARCAGRHRTSSCTAPDDRLQCANCKTPGHGAASRDCPYFIRKLK # ERVQWEPERAYELFVTKDPETWVRDDAPLKEDFDQGWRQEVANSYNTWTTVKRGNGQGRLAGGQPGQGGGVQRSQPIRGRSIRPRTSQPPTGPPQATL # DRYNFSQSRLPTSQLHLRPAQSQTRQGPSQRWGDTAIPGSQASNSTDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 Scaffold_4 AUGUSTUS gene 178575 178914 0.48 - . g41 Scaffold_4 AUGUSTUS transcript 178575 178914 0.48 - . g41.t1 Scaffold_4 AUGUSTUS stop_codon 178575 178577 . - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_4 AUGUSTUS CDS 178575 178813 0.5 - 2 transcript_id "g41.t1"; gene_id "g41"; Scaffold_4 AUGUSTUS CDS 178851 178914 0.48 - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_4 AUGUSTUS start_codon 178912 178914 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MRVECARRDRLLVRYRQASQGSLDEVEANRVESQDKDRDLTESWWETNVWEIFVVEPHSRTWTLSPAPKITGDFPLTT # KDVIYSEVEKISTIEWCSASYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 Scaffold_4 AUGUSTUS gene 180092 181066 0.89 + . g42 Scaffold_4 AUGUSTUS transcript 180092 181066 0.89 + . g42.t1 Scaffold_4 AUGUSTUS start_codon 180092 180094 . + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_4 AUGUSTUS CDS 180092 181066 0.89 + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_4 AUGUSTUS stop_codon 181064 181066 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MPRVFLAGRGLYLPALLVHRGLPKASDVTVTTTESISAAATGTRTEVDHLSVPKDVKKSRVIFPSSHASSSKVETKTG # STSGAGPQSNARTPSPDLSDIEAMTSSGPGPVTPLPASRRRGMASPVLGAPVGIEVNADDDVDLPVPGNKSRKRDSGKGKARTVLFQDSGKEFDNGCA # VREASSDDDIESEKENQREESVSWQISPRRPGSIGPSGGPSASSMPWNGSPIRHSQSYLHKQYANIPGSPGGTSPQGLLRNIVRDVMYDFHQESRAEM # MSLHLDLVSMGRGWKKELRELMGEYGGELKELREENRRLREENERLRRGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 Scaffold_4 AUGUSTUS gene 187269 187580 0.51 - . g43 Scaffold_4 AUGUSTUS transcript 187269 187580 0.51 - . g43.t1 Scaffold_4 AUGUSTUS stop_codon 187269 187271 . - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_4 AUGUSTUS CDS 187269 187580 0.51 - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_4 AUGUSTUS start_codon 187578 187580 . - 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MVVQSNGTRPPQWGPEIAREVFIITRGLGGSVLSWGRAVVLPQLEFSAVPDVTKHWALLIGDTYHQLEKASGVILYQH # KPKEWYDGFTKYSVGWTNLDDDTIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 Scaffold_4 AUGUSTUS gene 189928 190728 0.81 + . g44 Scaffold_4 AUGUSTUS transcript 189928 190728 0.81 + . g44.t1 Scaffold_4 AUGUSTUS start_codon 189928 189930 . + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_4 AUGUSTUS CDS 189928 190728 0.81 + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_4 AUGUSTUS stop_codon 190726 190728 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MFWHNEEYIDAQSIGSENGIVLDGVVCVVDAVFGLKQMEEDHSNNGKDEPGESLKQIAGSDVIILNKVDLVQPSTLSA # IEAAIKHVNPVAPLHRTIRAELDLAHILGIQAYSTGRHLPPPDDQNRPHNHDHDHEHEREHTHSSFSAAAPHYVTRGISCLQLSLPPLSASQFTAFDV # WIRTILWENCLPELEGTDTQSKESASKGNINVLRCKGLLTLTSGEKHVLQGVRSMYEIIPVKGDDESTKSEFPFAGKGSHRQRSRGGCTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 Scaffold_4 AUGUSTUS gene 194010 194438 0.69 - . g45 Scaffold_4 AUGUSTUS transcript 194010 194438 0.69 - . g45.t1 Scaffold_4 AUGUSTUS stop_codon 194010 194012 . - 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_4 AUGUSTUS CDS 194010 194438 0.69 - 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_4 AUGUSTUS start_codon 194436 194438 . - 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MWDSNCAWTGSALMAVLARRTQKSTTAQAVLTPVMELKTALKDSRTRICTPLDAKAWHLALSELGLLPKYPTLSNSIR # FGFKIGIPPINHTFSPPNKLDDPESIKAFKSIVNNEISLKRWIGPFSRHILEEIMSLFKQSPYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 Scaffold_4 AUGUSTUS gene 195785 196255 0.91 - . g46 Scaffold_4 AUGUSTUS transcript 195785 196255 0.91 - . g46.t1 Scaffold_4 AUGUSTUS stop_codon 195785 195787 . - 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_4 AUGUSTUS CDS 195785 196255 0.91 - 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_4 AUGUSTUS start_codon 196253 196255 . - 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MANRIDFDPAKIPCPDFSNNLYDVIRNALIADANSPDITNNEQAILKLRSQWETENANLRAQYQVQLQEEHAAGEQRR # ADEEESTRQREVEEREKEVELAKEREKKRTPLPNFKQGVGHCSVPHHFHPYAEKLMTARKYVPLWYFLPDAEREARNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 Scaffold_4 AUGUSTUS gene 197729 198460 0.69 + . g47 Scaffold_4 AUGUSTUS transcript 197729 198460 0.69 + . g47.t1 Scaffold_4 AUGUSTUS start_codon 197729 197731 . + 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_4 AUGUSTUS CDS 197729 198460 0.69 + 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_4 AUGUSTUS stop_codon 198458 198460 . + 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MMVEILFDRYKFPPEYVLRVWKQAGDLEETEAILKQLRDLENGLLRESSSRRSSHTSSNSSSGNGRKDGDQITAEPIL # GGPQRASCAGGDSSIVRNPSRLRESFLGDFLKPEEQATATETRATFGFPRALDACRDFALPNNSSSKINVTTPATYQSRIPEDTSPSPGSPKSSTTHG # CSDNHLEAHTSKPSNVEATLPPKLQEIYSAISSPDRKMVLQKFWKAYGTDYIQVESTLNDNLPTFML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 Scaffold_4 AUGUSTUS gene 205087 205997 0.53 - . g48 Scaffold_4 AUGUSTUS transcript 205087 205997 0.53 - . g48.t1 Scaffold_4 AUGUSTUS stop_codon 205087 205089 . - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_4 AUGUSTUS CDS 205087 205328 0.91 - 2 transcript_id "g48.t1"; gene_id "g48"; Scaffold_4 AUGUSTUS CDS 205397 205539 0.61 - 1 transcript_id "g48.t1"; gene_id "g48"; Scaffold_4 AUGUSTUS CDS 205669 205936 0.74 - 2 transcript_id "g48.t1"; gene_id "g48"; Scaffold_4 AUGUSTUS CDS 205976 205997 0.84 - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_4 AUGUSTUS start_codon 205995 205997 . - 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MEGVDWKECLDPISVPKMPNPDRKLVPDGYDLYDVFIPLWADDISGNKSKQYNKHINMYTANSNLPGRLLHQEYFVQF # VSTSPNATSPEQFSAIKDILPADNPQQAEEACHAGGNSNLLCRKCDVGGTYNETESNEGYHALYRVAAQTREWLASQLKAATLGVKSDVIEMQQKTGT # KDKVAQYWIDILLEKSNKMKKESPDLSADEITTILEAWLDEQPGDKIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 Scaffold_4 AUGUSTUS gene 208867 210033 0.95 + . g49 Scaffold_4 AUGUSTUS transcript 208867 210033 0.95 + . g49.t1 Scaffold_4 AUGUSTUS start_codon 208867 208869 . + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_4 AUGUSTUS CDS 208867 210033 0.95 + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_4 AUGUSTUS stop_codon 210031 210033 . + 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 Scaffold_4 AUGUSTUS gene 210084 211559 0.72 + . g50 Scaffold_4 AUGUSTUS transcript 210084 211559 0.72 + . g50.t1 Scaffold_4 AUGUSTUS start_codon 210084 210086 . + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_4 AUGUSTUS CDS 210084 211559 0.72 + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_4 AUGUSTUS stop_codon 211557 211559 . + 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHDEC # TGSINPVRKARPLPTTRKMRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 Scaffold_4 AUGUSTUS gene 212530 213795 0.64 + . g51 Scaffold_4 AUGUSTUS transcript 212530 213795 0.64 + . g51.t1 Scaffold_4 AUGUSTUS start_codon 212530 212532 . + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_4 AUGUSTUS CDS 212530 213795 0.64 + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_4 AUGUSTUS stop_codon 213793 213795 . + 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MPDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPN # SQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKY # IRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQF # KVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDS # RVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 Scaffold_4 AUGUSTUS gene 215012 217378 0.32 + . g52 Scaffold_4 AUGUSTUS transcript 215012 217378 0.32 + . g52.t1 Scaffold_4 AUGUSTUS start_codon 215012 215014 . + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_4 AUGUSTUS CDS 215012 217378 0.32 + 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_4 AUGUSTUS stop_codon 217376 217378 . + 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKR # AISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFM # GLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGFLKRVPASAAPRV # PRNQFVMFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVFNIDGTPNRAGRITH # FARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENPHIEVPL # EATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWD # HAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYF # TKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLY # LRPKNANLNNNRLNTSDSSSQKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 Scaffold_4 AUGUSTUS gene 218216 219232 0.54 + . g53 Scaffold_4 AUGUSTUS transcript 218216 219232 0.54 + . g53.t1 Scaffold_4 AUGUSTUS start_codon 218216 218218 . + 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_4 AUGUSTUS CDS 218216 219232 0.54 + 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_4 AUGUSTUS stop_codon 219230 219232 . + 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MGWSTTEVEYTYQQMTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVRRFQRHPRA # VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIK # SDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDA # GAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLXLSSEKFRRSTAWPLSHSGENLAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 Scaffold_4 AUGUSTUS gene 220595 220876 0.57 + . g54 Scaffold_4 AUGUSTUS transcript 220595 220876 0.57 + . g54.t1 Scaffold_4 AUGUSTUS start_codon 220595 220597 . + 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_4 AUGUSTUS CDS 220595 220876 0.57 + 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_4 AUGUSTUS stop_codon 220874 220876 . + 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MEEHSSARSSMNKPKIFKGKDSAETHRFMAQFLNWALEQPDLTKSQAKLIKSALGFFTESASDWAFPHLLHFNVEHPP # LEKLGRVPERVRSIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 Scaffold_4 AUGUSTUS gene 223168 223629 0.98 + . g55 Scaffold_4 AUGUSTUS transcript 223168 223629 0.98 + . g55.t1 Scaffold_4 AUGUSTUS start_codon 223168 223170 . + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_4 AUGUSTUS CDS 223168 223629 0.98 + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_4 AUGUSTUS stop_codon 223627 223629 . + 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MVSQSAAQLQTSKVGLALISAAVFNRACKDAGMEPILLHAIHSEVAARTANCSFTASTVPPLPHSISAEYAEFADIFD # EIAADALPEHRPYHLQIDLEEGTLPPLSQVYPLSEKELVALEDFIDKQLATGAITPSSSPHGTLVLFIPKKDRKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 Scaffold_4 AUGUSTUS gene 228540 229973 0.89 + . g56 Scaffold_4 AUGUSTUS transcript 228540 229973 0.89 + . g56.t1 Scaffold_4 AUGUSTUS start_codon 228540 228542 . + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_4 AUGUSTUS CDS 228540 229973 0.89 + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_4 AUGUSTUS stop_codon 229971 229973 . + 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 Scaffold_4 AUGUSTUS gene 236676 237287 0.96 + . g57 Scaffold_4 AUGUSTUS transcript 236676 237287 0.96 + . g57.t1 Scaffold_4 AUGUSTUS start_codon 236676 236678 . + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_4 AUGUSTUS CDS 236676 237287 0.96 + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_4 AUGUSTUS stop_codon 237285 237287 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MGPYANFASGGGVGSIGNAVHHSDQALCEQLYLRSVGDADEHVVHGGGSNVPSIDTGVAPYINNANIMNGPTNIRNGV # HSNGVNNAPFPFLNTINQPTDFNPGASSNGITSDTQNFTSGYMAQYMTSSHVDGQTPSSTMVANTAEPLNPQVLTGRVQLRSPFHGSANVNNTALQQQ # LFTHEAEFITDVNPPSPSKHDSFMLCQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 Scaffold_4 AUGUSTUS gene 242463 242987 0.56 + . g58 Scaffold_4 AUGUSTUS transcript 242463 242987 0.56 + . g58.t1 Scaffold_4 AUGUSTUS start_codon 242463 242465 . + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_4 AUGUSTUS CDS 242463 242987 0.56 + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_4 AUGUSTUS stop_codon 242985 242987 . + 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MQSTNSDLGTNSSKFKDRCFPRIDATWDYRCPEGRLLPLQGVIPNRLMQHPDMWDSDREPCLLVVKNGHATCTTMGRA # NGPLSVVRTYTLDISTHHTSMEWGILNYDSKSEVFSRGGDSGSVIADIRGRIGGMLTGGAGSTESSDLTYATPFWWLLGRIKATNRFSQVHLGIDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 Scaffold_4 AUGUSTUS gene 251414 253113 0.22 - . g59 Scaffold_4 AUGUSTUS transcript 251414 253113 0.22 - . g59.t1 Scaffold_4 AUGUSTUS stop_codon 251414 251416 . - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_4 AUGUSTUS CDS 251414 251852 0.44 - 1 transcript_id "g59.t1"; gene_id "g59"; Scaffold_4 AUGUSTUS CDS 252938 253113 0.28 - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_4 AUGUSTUS start_codon 253111 253113 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYMISFYPSRVDRSSKQAIFIPTHD # TITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNN # APNASTGITPFFANKGYTQISPFGPRST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 Scaffold_4 AUGUSTUS gene 254860 256379 0.41 - . g60 Scaffold_4 AUGUSTUS transcript 254860 256379 0.41 - . g60.t1 Scaffold_4 AUGUSTUS stop_codon 254860 254862 . - 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_4 AUGUSTUS CDS 254860 255517 0.97 - 1 transcript_id "g60.t1"; gene_id "g60"; Scaffold_4 AUGUSTUS CDS 256141 256379 0.41 - 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_4 AUGUSTUS start_codon 256377 256379 . - 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTCTLVTDNL # SNGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKD # EMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQ # SGGQRPAFNHLVQMESPSLRRKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 Scaffold_4 AUGUSTUS gene 273234 274547 0.25 - . g61 Scaffold_4 AUGUSTUS transcript 273234 274547 0.25 - . g61.t1 Scaffold_4 AUGUSTUS stop_codon 273234 273236 . - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_4 AUGUSTUS CDS 273234 274547 0.25 - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_4 AUGUSTUS start_codon 274545 274547 . - 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MGLSTMQCNFLVAVAEILIKTAMAMNCSSEESSAFSPFQNGIISDMPTSLSDALRKFDVDGIFIPYATCPSCNATTKG # IPIEDGVYHWPETCANSILGQEGARTCGEPLLFHRKDGTPQPIKPYLVGSLPDYIARCLLDPTYLEQSVKRIDAALHDIQSGIGPKQTVVHDVFEAEF # IKDFRGPDGKLFVNRGNKVRLAFSIHLDFFNPNGITYRGAHNSIGVISCANLALDSSIRYLPENMFLTGIIPGPSEPKGDQMDHFVRPVIEQFVQAWS # PGFKVSRTASSEVPVVVEAGILLSVNDLPAARKVAGLQGIRSSFICSICQLRGTDQVFNTNCDHWNLRDVHELRYWANAYKNASNFAEQMKIWDDHGV # RWSSLWLLDYWNPTRMLVIDSMHCLLEGLIQYHCRHVLRVDASSTKISSMVSNMLSTGRGFLMMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 Scaffold_4 AUGUSTUS gene 277893 278357 0.99 + . g62 Scaffold_4 AUGUSTUS transcript 277893 278357 0.99 + . g62.t1 Scaffold_4 AUGUSTUS start_codon 277893 277895 . + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_4 AUGUSTUS CDS 277893 278357 0.99 + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_4 AUGUSTUS stop_codon 278355 278357 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MSFGSDPESFLEYALSLPDPVGPDPETSDSSDHSSPSEQESVQSGTNSDPDQSSYDSEFPGPFDYDYLYQSSDFDSDH # PGPYDLSYLHSYPSSSASDSNESFHSFTSEASEAPVLRPGDDRSVHPHLGPNGRLWTPRGKGAGCSGCAFIVEENI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 Scaffold_4 AUGUSTUS gene 283035 284458 0.36 - . g63 Scaffold_4 AUGUSTUS transcript 283035 284458 0.36 - . g63.t1 Scaffold_4 AUGUSTUS stop_codon 283035 283037 . - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_4 AUGUSTUS CDS 283035 283786 0.99 - 2 transcript_id "g63.t1"; gene_id "g63"; Scaffold_4 AUGUSTUS CDS 283966 284458 0.37 - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_4 AUGUSTUS start_codon 284456 284458 . - 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MFVRTSVQNLSFFMNRPHFPVLFGTSGLAPRFIHTVFGDRYVPCQLDRVEDVAEYRPGGFHPVNIGDEFADGRYKILH # KLGFGGSSTVWLARDQRCIGMRRYGKVVVVKALRADISSVNYPDLVVARLLQQSQPSNSLRIIDDHFVVDGPNGSHEFLVSALAGPNFTTSNLLFQLS # DHATEWSDHEVYEYFGVPVTDTVWTCNGEPVGPHAPSQLIEAIDHSMFMETHLLQEDIMAIDFGQAYAILDPPKDYRPNAMLSYMSPEAFFELRAGPE # ADVWALGCAIFEIRAGFPLFDYFFPSSTEILTHIVTTLGRLPNPWWDAFKNQAQFDEDGLPKKNTNLVVSSIRDQLCSLGTSDEILTSNERMLFEVSE # MRMDGKEVDLLVDLLGKMMRYRPEDRIEIREVVNHAWFKFSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 Scaffold_4 AUGUSTUS gene 301329 302009 0.43 - . g64 Scaffold_4 AUGUSTUS transcript 301329 302009 0.43 - . g64.t1 Scaffold_4 AUGUSTUS stop_codon 301329 301331 . - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_4 AUGUSTUS CDS 301329 301853 0.55 - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_4 AUGUSTUS CDS 301977 302009 0.52 - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_4 AUGUSTUS start_codon 302007 302009 . - 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MTIRDDINLRRKSTIAQLVCDWSLISLSHHLISSSINPARAGSTSKGMHIQIFAIPKDIISLQTKFESEIHQLRMRNS # SVGKNARTTETTDHDGDAAMEADDEDETSLPSGSSNVHSGSGASASSTASSTIDVAAIVSETLRQLNQVPSAKGKKTAKEGSQAYARQMKKNGLSALP # KQVEKEWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 Scaffold_4 AUGUSTUS gene 304340 306360 0.33 + . g65 Scaffold_4 AUGUSTUS transcript 304340 306360 0.33 + . g65.t1 Scaffold_4 AUGUSTUS start_codon 304340 304342 . + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_4 AUGUSTUS CDS 304340 305107 0.58 + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_4 AUGUSTUS CDS 306055 306360 0.41 + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_4 AUGUSTUS stop_codon 306358 306360 . + 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MLDDQDSQAVDRSELRRFQEAQEQEALLAARRKRVNASPPPKVRSKKRRLTKVVEEPVIEEVPRLVRLVIPPSRPAPS # APGSAPSTFARSSAALPLTSVQATGQLGSVQGPSPLARLADLVDQQTDSQAEASTRSLGPGSSPIKASLGDSNLPKMSPVVRPPLVPRILSQHPYRVE # NERLAARIRLLESQLASSRQENATLTSALRDTSVSLEARQGELDQLRESVSSAAQQQELYDRLLDQVQTLKRALPGPPNEEEGSADHEEVSVLQEGES # GGTAAVPLFLPDSLSATPVASAASPSPLPPRFGSVANLAIDMTADEDEEDIYESSGSVERRNRVEGNPGGDDPMEGAPVGQGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 Scaffold_4 AUGUSTUS gene 307444 309075 0.42 - . g66 Scaffold_4 AUGUSTUS transcript 307444 309075 0.42 - . g66.t1 Scaffold_4 AUGUSTUS stop_codon 307444 307446 . - 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_4 AUGUSTUS CDS 307444 309075 0.42 - 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_4 AUGUSTUS start_codon 309073 309075 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MVDVCVVIYLDDILIYSDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDW # PKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETG # EIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALT # RRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTSVIEALKRIARNEEESLVWEDGLLKRGGRIYVPDIGTLRREVLQSY # HDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRAKPYGNLRPLPIGQRPWSSISLDHITQLPVTAGPEKYDAILVVVCRLTKQ # AIYVPCHTTDNAEDFANLFVTHVFSKHGMPSDITSDRGSLFVSQFWRELCRVLGIEARLSTAYHPKRTDKRNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 Scaffold_4 AUGUSTUS gene 314563 315339 1 - . g67 Scaffold_4 AUGUSTUS transcript 314563 315339 1 - . g67.t1 Scaffold_4 AUGUSTUS stop_codon 314563 314565 . - 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_4 AUGUSTUS CDS 314563 315339 1 - 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_4 AUGUSTUS start_codon 315337 315339 . - 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 Scaffold_4 AUGUSTUS gene 323957 325390 0.93 - . g68 Scaffold_4 AUGUSTUS transcript 323957 325390 0.93 - . g68.t1 Scaffold_4 AUGUSTUS stop_codon 323957 323959 . - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_4 AUGUSTUS CDS 323957 325390 0.93 - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_4 AUGUSTUS start_codon 325388 325390 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 Scaffold_4 AUGUSTUS gene 327188 327616 0.59 - . g69 Scaffold_4 AUGUSTUS transcript 327188 327616 0.59 - . g69.t1 Scaffold_4 AUGUSTUS stop_codon 327188 327190 . - 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_4 AUGUSTUS CDS 327188 327616 0.59 - 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_4 AUGUSTUS start_codon 327614 327616 . - 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP # FRGNWEAFLKEFSQCKTWVKMGLRVGLVYEVLCCSMLGAGWSSKGATRTATEDGNDLVVPGTTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 Scaffold_4 AUGUSTUS gene 330189 330658 0.39 - . g70 Scaffold_4 AUGUSTUS transcript 330189 330658 0.39 - . g70.t1 Scaffold_4 AUGUSTUS stop_codon 330189 330191 . - 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_4 AUGUSTUS CDS 330189 330417 0.51 - 1 transcript_id "g70.t1"; gene_id "g70"; Scaffold_4 AUGUSTUS CDS 330486 330658 0.39 - 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_4 AUGUSTUS start_codon 330656 330658 . - 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPENSRRSSSISPCGSAKEWFVPDILDLDLDSLP # ADVLLQSPCKGASGQFGITMPQGKAEDSLGNLKMKETENIRFNTLAAVPTGILLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 Scaffold_4 AUGUSTUS gene 336974 338692 0.68 + . g71 Scaffold_4 AUGUSTUS transcript 336974 338692 0.68 + . g71.t1 Scaffold_4 AUGUSTUS start_codon 336974 336976 . + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_4 AUGUSTUS CDS 336974 338692 0.68 + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_4 AUGUSTUS stop_codon 338690 338692 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MTAPNIALNLDHSKQPSASRSLLLAIQKVLIIFIDSKSMEFPRVNHNINLVTLPQSPMGIISSTSAHSPNDATVIETQ # ITDDELPGISITNLLVSQRARSPLTPKHLPIKATGFTSTSINRGDIRTYLTPRDKPNVGTSYDSASPILSPTSPSRITVANTKNRKLLPLPNKPVIDL # TLDDQDNIIDSSIKSNTFGGHPGKQPRIQLPTYGETTDSQSSSWKLHNGSTSSKGSSAKQPRRLPRMVHGAPRDVQKRLGRRPRKFPIHATAAALINQ # SKERFSKKPVTVSTSETDNNQEILSTEPEGFAIPSRSIQRSPKLFDVEKQGPRIPDTSASPHNVMRNSQYKSEEEHDLVGALTSAFTRNAIPDDFDNS # SDFSSGTHSDVAPPKRSRSLRQAIKRVPQIPTSPALNLLRQERTPRGLCVPLSEEAIQKYLDVEYSSVHLPLGVSVAPENDSEYVDPNDELLLDYDSS # NEIVAMRREQQQLRLYHAPTVLVHNLRFVMEQAESSAGGISRSNPFRQYNVSTMPLTMAYVHRVESHCGYGALDSIRSSMPDWDFHPKPLKVSSSSSR # KKGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 Scaffold_4 AUGUSTUS gene 339801 341421 0.46 - . g72 Scaffold_4 AUGUSTUS transcript 339801 341421 0.46 - . g72.t1 Scaffold_4 AUGUSTUS stop_codon 339801 339803 . - 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_4 AUGUSTUS CDS 339801 340293 0.71 - 1 transcript_id "g72.t1"; gene_id "g72"; Scaffold_4 AUGUSTUS CDS 340340 340616 0.55 - 2 transcript_id "g72.t1"; gene_id "g72"; Scaffold_4 AUGUSTUS CDS 340706 340712 0.86 - 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_4 AUGUSTUS CDS 340771 341421 0.81 - 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_4 AUGUSTUS start_codon 341419 341421 . - 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MFSAPKSVTTNRLSSSTQPFVHRQPATSHSEIASATSPEHLQPPPTADPREIETPAAQTSFDIHSYPPHDLLRLLASL # LTQIASTNDKLDAASSSSTLSSSSSTSSELHNVVWRSLTTASRSALSTPSSTLTFHARNIPTISLESYLLRILKYCPTTNEVFLSLLVYFDRMTKLTS # EATGRSFVIDSYNIHRLVIAGVTVASKFFSDVFYTNSRYAKVGEYAEQLILFSSNKSPSLGVSSSSSSITPRPTATSATAPPQSNDMVPMHCMGALFD # AYGGPIPGGESPASSSLPPSTNLPFFAKWYIDDKARCSQHQPHHALNGLVNGNGFSSSLRMQHQEDSEFEGAETETETETEAETETDGGWTTDDEPTI # RPPKSSAGSSSSSSRSSSASDALSICSSVSENDSVEGDDEREDHVMSDIDDDEEGGRTPEHSAQAETSKDGEKTPERKPFQSLLGMSKITPPGRREHE # ATDSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 Scaffold_4 AUGUSTUS gene 343286 344080 0.27 - . g73 Scaffold_4 AUGUSTUS transcript 343286 344080 0.27 - . g73.t1 Scaffold_4 AUGUSTUS stop_codon 343286 343288 . - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_4 AUGUSTUS CDS 343286 343425 0.27 - 2 transcript_id "g73.t1"; gene_id "g73"; Scaffold_4 AUGUSTUS CDS 343798 344080 0.67 - 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_4 AUGUSTUS start_codon 344078 344080 . - 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MAVLEAVRGWEEIAGLPHINDVGTDSVSDEEAGVEEDTVSDVAQSKEEVDDEMWSAEELENDLDDLLNSDYISLLLEH # DEYVQSPPEGSVREFFRQRMESKSVIEVLCVPFNPPFVATHMRFASSVKPNRFPTREDLLSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 Scaffold_4 AUGUSTUS gene 346292 346789 0.91 + . g74 Scaffold_4 AUGUSTUS transcript 346292 346789 0.91 + . g74.t1 Scaffold_4 AUGUSTUS start_codon 346292 346294 . + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_4 AUGUSTUS CDS 346292 346789 0.91 + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_4 AUGUSTUS stop_codon 346787 346789 . + 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MSGDQFKALYKPAIDTELIKPSKKRHLPPILEPIRLYPLDLLMPPINVRMPILFKIIPALDLESSSAIYEEFEIIVAK # LKASLAEALELYPPVAGTIHKSPGDASAITIACDGRGATFATQVERQSYMESEHTLDGLSAGDLLALDDSQTPFGVKLTLVSTFLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 Scaffold_4 AUGUSTUS gene 347236 347784 0.96 + . g75 Scaffold_4 AUGUSTUS transcript 347236 347784 0.96 + . g75.t1 Scaffold_4 AUGUSTUS start_codon 347236 347238 . + 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_4 AUGUSTUS CDS 347236 347784 0.96 + 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_4 AUGUSTUS stop_codon 347782 347784 . + 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MLFTNNDAELESLGVAVDGRERLGLGAGSPTRFFGNLNLSLAVYAPRADLLGATLKATSDVALIIRRTIQDESRPETI # ASRVAFLESKVEATKPYTHRIVLEGDCRSTNWSKYDLTKLDFGLGSNVKSVGTTLGTKSTYPAGMFLIVKSSGGLVVATTVEKEADVLLKMDPLLTQY # AEVLVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 Scaffold_4 AUGUSTUS gene 347881 348858 1 + . g76 Scaffold_4 AUGUSTUS transcript 347881 348858 1 + . g76.t1 Scaffold_4 AUGUSTUS start_codon 347881 347883 . + 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_4 AUGUSTUS CDS 347881 348858 1 + 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_4 AUGUSTUS stop_codon 348856 348858 . + 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MSYYIGVDVGTGSARAVLVDDHGKTIASHTKETTTWRDHDDHRIFEQSTNNIWDSISSCIKKCLAESKIQPSSVKGLS # FDATCSLAVSDFNGDPVVVTKGKDLGQKGDRNVILWADHRAEKEAELINSTGSVVLDYVGGTMSVSAPNKRWSMYPDTDLNHSLRWKFLKHFGSKNHM # EPSLFTRCQFFDLPDFLTYRATKDSTRSCCSVTCKCSFVPKSGWQADFFEKIGLEELVQTNYMQLGAANGEVLTAGKPVGNGLSKQAAEEFGLVEGTP # VGSAVIDAYVCSQTRQYLLHPCLCAVDMLDGWELSPDDIRKTASSLMLSLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 Scaffold_4 AUGUSTUS gene 350987 351736 0.47 + . g77 Scaffold_4 AUGUSTUS transcript 350987 351736 0.47 + . g77.t1 Scaffold_4 AUGUSTUS start_codon 350987 350989 . + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_4 AUGUSTUS CDS 350987 351736 0.47 + 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_4 AUGUSTUS stop_codon 351734 351736 . + 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MNDLSDDFGIYGSEYTGVPLFSDSSLSMYQLLESPELAEEVLFKAYELPKLVPELTSASATTSDIVTPISLDGSTTGN # PAVPTTSDPAPKTGKGRRSNATGTRKNVTPESLVPVDAPIQARKYATPSATSRKEIPAAFLKSQKRKRSRIQAFGDDEIPNPSVGGALSPEDDAAEEQ # PPLNATEKELIEWKRRQNTLAARKSRKRKLEHQQFLETRVKDLETENEMLKVKSEALEAALRAHNIFLPPIEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 Scaffold_4 AUGUSTUS gene 354434 356434 0.56 - . g78 Scaffold_4 AUGUSTUS transcript 354434 356434 0.56 - . g78.t1 Scaffold_4 AUGUSTUS stop_codon 354434 354436 . - 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_4 AUGUSTUS CDS 354434 355717 0.99 - 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_4 AUGUSTUS CDS 355820 356434 0.57 - 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_4 AUGUSTUS start_codon 356432 356434 . - 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MTAHKRRDTGEGKVNNNGMMMPPPSLPLQDQLSNGISSSPSLSTGNGSLPISIAPQTSVSAMSGMIPPTLGQGMSGTG # SLPDAGMSEAQLNQAVREQRMANMRAQQQRPGGLPGMPSTPQPQQGGRHMSPPSASIAASSNLQISPTSSNHSGPSTVVPGGGGGGGGRLIIRTANAA # ASLYASANSTTSPGITVYASYDTQFQLPFVLQSRQQQQQQQQLHQQLQQQQQQQQQQSPPQSLQPQMNGIPNGVFPIHTSPISPVAQQAQMNPMILAG # GQGGMNPGPSAGNSAGMSGGGNNINNMGMNSMTPNQRQQLMLMQQQRGGGSMGSGGMNPMNNMNNMNGMSSQQYAMLQQQRQQQQAQQGMSQGAISPT # QSHHSGGNGSPMIPGSDLNNFPALRSNAAIPGIARSARSPPDGSIGGGGGGIGIGGISGSGPGNQSPMTPRMPARGPSMGQDEFARMMGGSVGPSPRG # GMMSGSGPGNFTPQQMQNWQQQQMAGGMRPPSAHGGGYGGGGGGSMGAPSPGSAGGGFGSGSSGGMGSPSYPFPTPSPGSGHPGDLSSSNLGLGMPRH # MSATPGPGQQMRNPNMNMNGMNNMSNMNNMNNMGMGMGMNMNSPMSADPFSFMSNDIDSFSWTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 Scaffold_4 AUGUSTUS gene 361974 364023 0.32 - . g79 Scaffold_4 AUGUSTUS transcript 361974 364023 0.32 - . g79.t1 Scaffold_4 AUGUSTUS stop_codon 361974 361976 . - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_4 AUGUSTUS CDS 361974 363028 0.48 - 2 transcript_id "g79.t1"; gene_id "g79"; Scaffold_4 AUGUSTUS CDS 363891 364023 0.37 - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_4 AUGUSTUS start_codon 364021 364023 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MNLLWTYASNSSHFLLLDRMRMLQAEENPAFGAATLTPELQTARYSTGVSTPSEIGVPIPALNVEKERSYTNGHQYQA # QPSYYHQPYRPYQQLAQQPYVSQLQTAHADLPLVSSIGYNQRDQIQYSLQEQYRTRLSELPHTQGLPYESEYGRHSYSNSKSLPDHSSSTLQPTSSPY # VLPQINLQSSGTSSQSLYQPLSHRSDIPLHAIPTYNFDALTETIFRKNWRKGTPILVTDVSQRFRIRWTPEYFIKEYGDQGCLIIECQTDVNRRVTVG # QFFSKFGKYAGRENGPMFEEISLGSQDSLLPAPDNEDRLGTKKSEIWKLKDWPPSADFKMTFPELYEDFSQAVPIPNYVRRDGTLNIASHFPHNALAP # DLGEYLGFSIDFCLLILFRSQNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 Scaffold_4 AUGUSTUS gene 370534 373407 0.47 - . g80 Scaffold_4 AUGUSTUS transcript 370534 373407 0.47 - . g80.t1 Scaffold_4 AUGUSTUS stop_codon 370534 370536 . - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_4 AUGUSTUS CDS 370534 372462 0.92 - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_4 AUGUSTUS CDS 372565 373407 0.47 - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_4 AUGUSTUS start_codon 373405 373407 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MLPSNSGKLTEAGPSLAGEADGEHLVQDAVVLDMAPFNKFSIISPSEPSRPISTPTSSDRPALSSSDSGGDSSDDDDS # GQERENGDTFDANHSPSIPRLRPILPGPPIQNHPRFSRAFSLPLPSQLGHLKHPHRSSLSSLMKPIHSEPVSPQSHPFTELSLELADSVQTVIQTMLQ # ISPAQLLDPAKEQFSACALSVPTPSMSAMFTAMKNLNYIAANMVEFAAEKQHSESTPPSSSSKKHDDFDIGELLQCTGDALSASAAQVGVDLVLFHGD # VALRHVWVLTTCQRGDTIEIGLFVNRSPSTRRQNSSSSDSVDADVLRSTALHLEGEGPFHCTIEIFHRFSPASTSEGLSRHEPSFTSLNLRRLLVTVG # ATLSEYKPSFDGPLKIGHSCRLSFVLDGGISPQQTPATVTEDNSISTSEPTLEQLSTFVDSLKGKKVHLYASSKGSFAHHLTSYLTAWGMDVSHIPSE # GGVENALEQPPSPTATSNIEGYMPSGIPPKMELPQQPKSQPASFIFIDDDVNILKDRVQAIKEEQVYPLHLNSRKRPSLAAHHRPRSSPQVVRMSAGA # NAAPVVILHFTSLANYKVTKDVVQSVLNSYRGTLLPLPEIMVVPKPAGPRRFLTLLHTAVTKPVVDPFFSPIATTPNSPYTIGGGSFFSPQHHHSGSP # RTPSVHRPSGSRSNSDRSSRSVNNILENHVNLPPSPLSMQESSEYFSETVSRLGETSVKLGDTARAGVILQSPDGQPTGIFFSPRAEKTNMFSSYGME # RDRGHLSVVSGTRRSSSSVEGPPVTFSSLHLDHAASAESSPRSSGIRVNVQIPSRQNSRSTMSPHTDTSEAPHSEPQTPRKTSIDFGSRKGMLHVSPP # GSPLVDSTAIRNTRRSKLDSKGLSPIVTGKKGKSPAEGNIVPPISVLIVDGMKFTLFRASN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 Scaffold_4 AUGUSTUS gene 375021 375440 0.86 - . g81 Scaffold_4 AUGUSTUS transcript 375021 375440 0.86 - . g81.t1 Scaffold_4 AUGUSTUS stop_codon 375021 375023 . - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_4 AUGUSTUS CDS 375021 375440 0.86 - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_4 AUGUSTUS start_codon 375438 375440 . - 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MKPFVNKIRVTPDVASRPERMEKDLANTKILAGLLEEEAAVLRKFKPSKDNTQPKPEGADDVPMEENNPETADVDVEE # EEEPQERGSDAVERRIEKVMAELRDQGLVDVGNEEAYETKRVPLIVFLTFSPTHEIISSSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 Scaffold_4 AUGUSTUS gene 375628 376161 0.75 - . g82 Scaffold_4 AUGUSTUS transcript 375628 376161 0.75 - . g82.t1 Scaffold_4 AUGUSTUS stop_codon 375628 375630 . - 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_4 AUGUSTUS CDS 375628 376161 0.75 - 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_4 AUGUSTUS start_codon 376159 376161 . - 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MFEHHKKSPWFWEKYDPAPEFQKLRQRVRKEGWKGRLNTFLLDLETGKYDPDMNESVDANESTGSKDANGEELHIDGL # GEALKPSGDDDIPFHMDAEDEVGADTNGKSASDNRRWNNAEEIAVPPEGNQVMIRTIPPDIGRVKLEDVSFLLAAHSILQLMCSLVVQIHSWLCLSCS # W] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 Scaffold_4 AUGUSTUS gene 378823 380248 0.19 + . g83 Scaffold_4 AUGUSTUS transcript 378823 380248 0.19 + . g83.t1 Scaffold_4 AUGUSTUS start_codon 378823 378825 . + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_4 AUGUSTUS CDS 378823 378831 0.27 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_4 AUGUSTUS CDS 379856 380248 0.89 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_4 AUGUSTUS stop_codon 380246 380248 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MIKPAASVDFSGISFSAGDSVTVTATVISTSEGTLTIENNSKGTTVSKTVSSSAKLCETNAEWIVEDFEECEGSSCSL # VPFANFGTIEFTGASATTSSGTVTPAGSTLIEIEQSNKVLTTVSQSGSTVTVVYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 Scaffold_4 AUGUSTUS gene 381223 382363 0.35 - . g84 Scaffold_4 AUGUSTUS transcript 381223 382363 0.35 - . g84.t1 Scaffold_4 AUGUSTUS stop_codon 381223 381225 . - 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_4 AUGUSTUS CDS 381223 382275 0.83 - 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_4 AUGUSTUS CDS 382340 382363 0.35 - 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_4 AUGUSTUS start_codon 382361 382363 . - 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MLWCSMKRHHLEDDIPKYLISASDERKIYWRSRCTILKISQLLPGTDEEFNAHDSEEVEEHQVEEEEEEEDGGDTGSE # LEGDLNGGMGQGMDPQGFAGPKIVKPLTTEALAAYKAAQDRAGVIYISRIPPGMRPSKVRHLMSSHGEVGRVYLQQEGAINCFKKSSSDTYISVTADA # KRAYLRRKYTSTKKPHFTEGWVEFIDKKVARSVAEMLNAQPIGGKKGTRWRDDVWTMKYLPKFKWSMLTEQVGTYLKIIRLYDPRKNAYAYSSLAHEA # AIHTAKLRVELSQSRSEQRDYMRNVELARVLEKRSQRKKEQGEEMVLKPLSRTNKRSSEVEGDVARKRHRDNEDGLDTVLGSIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 Scaffold_4 AUGUSTUS gene 388562 389389 1 + . g85 Scaffold_4 AUGUSTUS transcript 388562 389389 1 + . g85.t1 Scaffold_4 AUGUSTUS start_codon 388562 388564 . + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_4 AUGUSTUS CDS 388562 389389 1 + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_4 AUGUSTUS stop_codon 389387 389389 . + 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MGRKNRLSTTAEIVSVESHVIDSKLCLDGQLDDKDSGSEEDIFYTPDTSPMAPLVNQLDLPPNVDNDSAIATRTPFTP # RSTTTSISSNSLDGHSIFSLDSSPLSDSTFITTPNVSDTGHDIDYVTKSARRSNPDRTKQPSLTYTDEDWAKDVRWLAPPSAKLSTKRKSKPSANNNT # VASTSYYIAQLPPKIVPQPPLPRPRPRPKIRSKSVGITAHYSIMSSMTALLEEEDEDRESAHHPSQGSLRSAAAVAASPSERLRTHSTLLLLVHDHPT # H] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 Scaffold_4 AUGUSTUS gene 391043 391801 0.72 + . g86 Scaffold_4 AUGUSTUS transcript 391043 391801 0.72 + . g86.t1 Scaffold_4 AUGUSTUS start_codon 391043 391045 . + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_4 AUGUSTUS CDS 391043 391801 0.72 + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_4 AUGUSTUS stop_codon 391799 391801 . + 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MVEVLTLKGGGGGCEDGVAAVVRVIERLVEDGDVFDAVLDTVGGKEIWEASERLLRNTGVPSPSPDSIFPSISSSSEI # KLSLLGRRKRKKDKNNDASPLPGNQSHPGGTGQFTTLVGDTPSRPIPTASDHFRAGLRSMKNTHNATTTKDGTNGSPVKKGANGNGKVGYAWVSVAQD # VDWEGEDIRDSLGAVVKMAMNEGVRPWVGGGESGGNGEVNDNNGDERVVPFERTPRIFVANGPLSNGGTAVVKVVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 Scaffold_4 AUGUSTUS gene 394589 395479 0.69 - . g87 Scaffold_4 AUGUSTUS transcript 394589 395479 0.69 - . g87.t1 Scaffold_4 AUGUSTUS stop_codon 394589 394591 . - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_4 AUGUSTUS CDS 394589 395269 0.76 - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_4 AUGUSTUS CDS 395369 395479 0.69 - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_4 AUGUSTUS start_codon 395477 395479 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MENGNGPDLDKEPKTFLSNEGDVIDDGEEYQEYCHNACPPILVASSLTNSAASILAVNADSPRHACPNTVRRLLNDLT # SIHDQRQEAQRKDWDAFVRQRSTAKARSQQSQAMKSATGNSASGSNGGGAVSSAAALLGLGVKSYDAGEEDELDHSEGLIGFAQLGLPANKEERKEFA # RLVRKGIPLVYRSKLWLECSGGLEMREPGLFRDLLADVAKDLAQGTGGGVIAEIEKDVGRTMPLNMFFGGDGPGVDKLRRVLTAYSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 Scaffold_4 AUGUSTUS gene 395703 398352 0.31 - . g88 Scaffold_4 AUGUSTUS transcript 395703 398352 0.31 - . g88.t1 Scaffold_4 AUGUSTUS stop_codon 395703 395705 . - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_4 AUGUSTUS CDS 395703 397508 0.61 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_4 AUGUSTUS CDS 397585 397724 0.31 - 2 transcript_id "g88.t1"; gene_id "g88"; Scaffold_4 AUGUSTUS CDS 397800 398352 0.7 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_4 AUGUSTUS start_codon 398350 398352 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MSSISASASSTPVDSHPLSPDEILSSSRSRRNRVSNHSTQNALPTNYFTLKAQLEQHQYDNDTWDGSVRRLAKSDRQN # SLDNEHIRANRPSLASSFYSDDFSPETFTAPLIIVGSDDQHLPVDDIVDTTSLSLQELAIDPVITSRVLTTKWHEYSDEAIQSAISSISISESPAEVS # SHPYHSALQKENTRRAKAEELAREMKSEKEREIARRVVKEIFGDNDVDEGEQRSRSLADSISEAIEDQVPLSRSVPLDPILTPIPSSPNLDGHSPGDD # ASSIASRASQTNVSEDESTDPLTIIPARTASAASVASDRSTNTIGDWMGSLWGKRGPRSRVVSTSEASLSNKPTAEESAIEPPVPRSGAHSRLQRRKT # AKSVFGTLGISILNPGLASSSAKDSLPEVDRSSVDYVDGENTATPSNPQTSVIASSSVAVESRDESSPLVDDDVSVRSVRSARTTHTATTTYTINTMN # SSAAGFSAVSSSVLPAPPQLSMNTSLETSTTTSSTTLGTNTNTKMSSSEESPALPASGQPVQGSSLRAIANATRIMSSDPSSILSDPGETGPLIKSLA # MDLIRNAREEGVVFKESRSARTKGQKLKTNNINPIIEGISSPIISDASATSFAPFSSDGDAASNVVSHTSDAAKKLSRALGLGPALEANSKLTRGGGF # KNTVSSIVPLPSPSLFGWVFLAKARHDLGKEDLPQHLVTLLEELVLLELLMTQPQRVTTNLQRKIVVSVPFRPVSGGGEKSNTQCPSVPLESIIPAFA # KPPTQYLSRTYTPLTSRNFRFDINTINNAHTSIVSPVPGAPPSSAKGFHFLFLHSTPTGLRLRLVRYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 Scaffold_4 AUGUSTUS gene 418849 420876 0.18 + . g89 Scaffold_4 AUGUSTUS transcript 418849 420876 0.18 + . g89.t1 Scaffold_4 AUGUSTUS start_codon 418849 418851 . + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_4 AUGUSTUS CDS 418849 419859 0.18 + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_4 AUGUSTUS CDS 420127 420876 0.95 + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_4 AUGUSTUS stop_codon 420874 420876 . + 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MIAEGVDVNRRDHVGRMPLHVAVLAKAEDVACDLIDAGARITSRLAEGKTALHIAAQLDQLKVVKKLLERSKMNEDLL # KKDGDAEEGNGDVEMKEAVRDSSEDDWSSADDGVISMEEVEDTDVDDEDDGDDVDDDNGDDNDGSPRKKTKSKEVSEPPKTPTEYNALPEDDSGEPDV # FDINAPDWDLCFTPLSYAILFASLPVIDTLLLSGADANLATTASYPDAPRLHPLLLTVYHSDEEQACSIAERLLQAGAASSAADQGRTILYKMIEAGK # TKLVNSLLRLDPKAGVVLNLPSMNMNNGRPTFPLIAAVQLNNLEMVTTLLAYGANVVFKAEDVEILRTYLDWARYAIGWINRYISEQQDKMKLETKKL # DSITTAPTTPWRTFVSRTIYLSDNGVLPGSELQKKKFVEDQVELEKTIRKCVALKGFFGDAERLLVSKGAKTYNILFADTEKRSTATSNVSIQIDHHD # HILWQQNSSSTKYFFLGQHDYSREAVPMYLNDDMMNFLKHVGKGRHCLCENFVFPMKERKMHLRYRLQWLIQPISGCKPVCKPPFLHFSQEWLTLILQ # ILHHLSLLLRGDTGVLFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 Scaffold_4 AUGUSTUS gene 421000 421947 0.6 + . g90 Scaffold_4 AUGUSTUS transcript 421000 421947 0.6 + . g90.t1 Scaffold_4 AUGUSTUS start_codon 421000 421002 . + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_4 AUGUSTUS CDS 421000 421947 0.6 + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_4 AUGUSTUS stop_codon 421945 421947 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MLIDEDDEDNLSDDDSAASDVTASAQKRNQPFIDIAQISPAVKVPFPPSRLLNSHYVTYEEGGGSLVLIKAIKTKDFE # AFVHIADLYKLTEPPLELGQGYILDAILAADEPEMLDEYIRRTGSGIDLQSHGDETEEKEIRAINDKNKIYLGLSVHGKKRKDLAQKNDPANFHYQLQ # DQDVTPILWRAILSSSKEVKIIEYLASTRPLEAYRFYAMTHGSELSIRLRRITDLEQILPDRLGWCTNNLGESPLVAAILSNKLNVIKLLFAKKPKLM # SAALKERYVSYKSITMPEVLMGFQDEIQWLQPFNACSPSWL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 Scaffold_4 AUGUSTUS gene 422082 422894 0.66 + . g91 Scaffold_4 AUGUSTUS transcript 422082 422894 0.66 + . g91.t1 Scaffold_4 AUGUSTUS start_codon 422082 422084 . + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_4 AUGUSTUS CDS 422082 422894 0.66 + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_4 AUGUSTUS stop_codon 422892 422894 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MLAASSVPVLFEHLLLKLPRDVNELLLQQHCKGNLDTVCLVLSPCVVSFIHLVQPLHLAVSRGDYRTSSIIIDYTRAG # LAIRNVYGSIPLHIAISKSQAKTVKKLIDSSPDECLFMENGVGNTPLEMTTLLDLLGRLQNVSRDREPELAAQHVNLDPSRITLDKLQQDVPNLRQTI # NTLLKNGPLKVDDKLTKELFAFSRFMETKLTAATAEAEATKRGNEDEPDVKDKWKDPEDRGTTLKIIKEAILARPHQRQLIHLVDVQNRRQSPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 Scaffold_4 AUGUSTUS gene 428242 429374 0.3 - . g92 Scaffold_4 AUGUSTUS transcript 428242 429374 0.3 - . g92.t1 Scaffold_4 AUGUSTUS stop_codon 428242 428244 . - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_4 AUGUSTUS CDS 428242 428973 0.98 - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_4 AUGUSTUS CDS 429081 429374 0.3 - 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_4 AUGUSTUS start_codon 429372 429374 . - 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MAPRTRRAARNQTPATSTTTNTTNSPLFSTNASVAEDSPATTDVEQVPVTKRTNTRSQSQRGKKRPPPVHSENEDEDE # EADSRPAPKRRATGKSLYVEKAVKLTTKGKGKQRAPPIDDENSETEGGLDYDDAKSLVDSNSSGSEFVASEGEEDDIDEEEELVMPKARSSPVKKRVP # STAMSLDGNNSDEDGDTVMLAAAIQLSRQTYRNTNGAGPSSGTQVNAKAALMAAAAERRLADHARTGVDDSVMDFDSAVNDFDNLSALSGSDSDSEPL # AKKKSKGKKHTKSKSKSKKSKLGIEEPELMTWLQARREQKREQRELSKKLGRKLTNVNHLAFISSLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 Scaffold_4 AUGUSTUS gene 429615 431345 0.78 - . g93 Scaffold_4 AUGUSTUS transcript 429615 431345 0.78 - . g93.t1 Scaffold_4 AUGUSTUS stop_codon 429615 429617 . - 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_4 AUGUSTUS CDS 429615 431345 0.78 - 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_4 AUGUSTUS start_codon 431343 431345 . - 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MLNSSLANLDVTSIGVDMSQFQAAFQGVPGTDYQGIIDSIGQQQQTSPTPGVNYHAIIGALTKIQHAAVQAQNQNHPQ # AHPAAHVHSNANVGAANNYQAIVNAQAQQIHQMQAMMNSLSMQQQHGQQMQNINMHSGQTMNHNPAHQPPRPPQQTQSQSLMQTHLPTPLHTQTPFLS # HGQAHPNQAAQSVHTSPHSAPSFPTAHGNSAAATPYHPQSVHIVPSSNYGPASSPPPPLPSVYSTNVPPPSQQQSYTGGPNTTSPQALPDHLPPIQNT # SSPANPSLTTMLGTVGHGLMNAMHQSPQSSHVQNSSSPGHPNQHQHAHTQQQQQFHAQQSGSSAHGGNSGSESSTGGSGGPSMLSTVGHEALNLWHHH # QQHEHQQQAPQQDSQAYGGDNDSNGQTYDTSLLNGGNPYSDGSSYNDGNQTQLNYDAPPDFYTMNNSFGPNPSQDQNVDMSDNGFDLNNGFVNGDEFP # GAMFPTDLNANQFDFTDGTAGTYEYTSYTSDGQNQSQTFGFGTDGQGGMVGFDSTSFGDPGTGDIYQNTDTTFSNGGFMDSVDTTDVFDNSGDLLFSS # TNETVFMT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 Scaffold_4 AUGUSTUS gene 431429 434080 0.52 - . g94 Scaffold_4 AUGUSTUS transcript 431429 434080 0.52 - . g94.t1 Scaffold_4 AUGUSTUS stop_codon 431429 431431 . - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_4 AUGUSTUS CDS 431429 432420 0.98 - 2 transcript_id "g94.t1"; gene_id "g94"; Scaffold_4 AUGUSTUS CDS 432490 434080 0.52 - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_4 AUGUSTUS start_codon 434078 434080 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MFQTNVVPARISYFHPSTEYYAETNRVAVDEAGPSSSSNSYVQQGSSSSSKLQGRNENSDWKPDQKDPMLFNHNAGPI # TSSSSSSGPSTGPAPSISYSPSSIGHLPPDPTSSVDPSSPPQYSIYSESSDEHSTLSAVVAPGPGSDSSSSPGETTTANVVSPPEYHNPSFLSSPPPA # SSPAPPPPPSSSLPVTQMVGPPSSQPVPPENHPQPFPSTPHTSNTTNTVNVNSLPAPHPDSTGMNLVSHLSQAQVVNNASPSLIHTGQNPHAHVPGMH # LVDRPSQAPVGVSSLSLPPHPPIPQPTSAPVTTTTAPPPPNVPVPTSNAPTPAPATAGHEGLTLAQRLYASAFSSRPSTTGGPSGGRVSTSSPNIHLP # IDSHSHMPPTVSLAAVSAEAYNNTNISNNRPNAAIANSFYKTGVLQNLQSQNQPIQQHRPQGGRLSYHAGSMNYTTAAVASNVSLLSTVHSQSSSAAS # TVAGGRPQLPSRPQSQQLLLNNVVRPQSQKIEHYNSSGSAGRPVSKPTTVPSVTLVARPPRLSNPHPTTASMNSHSAVANGPASQSATTSNTAMQGQI # GVSGIQSPPTSITSVPGAPSVPARPPLAVGTSGNLSNNNNNSNTLNAPPPTANLPTSSTLPQHFVVQNPNVHAQNQSGNGNFNAPQTGSMADLPSPPP # QVNSHVSVNNPLPPVPPSGAGVASMHSSPVSLGHGPQSSISSQTHSPPPPSHSATSTLPAHAPQFTTSPPMYSTSPVANVQSSAQSQSVPTFITSPGT # VSPTGYSPGSVPQPSSPPSLPQRPPQRPPQRPPQHPSYTLPMVPTTHNPDHLDRIPPPFLSGQPPLLYRILATCLPISVKPQAASLAELLCVTRGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 Scaffold_4 AUGUSTUS gene 440077 440547 1 + . g95 Scaffold_4 AUGUSTUS transcript 440077 440547 1 + . g95.t1 Scaffold_4 AUGUSTUS start_codon 440077 440079 . + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_4 AUGUSTUS CDS 440077 440547 1 + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_4 AUGUSTUS stop_codon 440545 440547 . + 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MAGVVCVELGLERFVVEVEAVALGLAVLVTLGVAVDDDDNNDELGLAEDEDEEAITFDVDNDVVDGPPPADDDETFAG # EVPPPTPCCDCGILLCGFLGEFSADIPDGDEFWLFWAPRVCGEEPELLLEADGVGWLDDNDDELGFAELEGLVTEGER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 Scaffold_4 AUGUSTUS gene 442516 444636 0.51 - . g96 Scaffold_4 AUGUSTUS transcript 442516 444636 0.51 - . g96.t1 Scaffold_4 AUGUSTUS stop_codon 442516 442518 . - 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_4 AUGUSTUS CDS 442516 444636 0.51 - 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_4 AUGUSTUS start_codon 444634 444636 . - 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MTPEVFFSGNPNGPNPNNNNHARSLSAGGNNINGNISSISSMPSTPPNTNGMLIDSQSLPPSLGGTPTQNQPPQNHPP # NPHPHPHLNPHSNQNSSNPHTPFTLTPAQQFQQMQGQVHGGGPNGGGDAMSIDNPNFNGIGGPFGGGVGVGGGGGMPPPARPLSQSSHLNHTFPPQQH # LHQQSHQPHQQQNQSPHQHGHPSQNIQNHPNHPNHSNHSNHHSPHPSHPSHLPGDPITNMYPPNPPAQGRSPSRPQSQAGSPSAPGPSRSASRAGPGG # MSGIGGMSNISGMGNMGGLSGMGNIPGGISGMAGLANMANMGNIGNIGGVGAGMGFPPSQHAGNMTLPPPPQQQPPGMSGLPPPGMIPSGPGRLPVSG # SQGHPGVGGGGPGGGGNQGNGGRPQSSSGLVVQNNQTGLGGGGPGQAGPGGRPQSSSGLGGLGPAALANIAPRPAPLHQPSHGQHQSIQQGPHPGQPG # QQQVQPGQPGSGQSGGQPGQHPHQGPPHSGHPQHSQSAPSSSAPHLAQHNHNSAHNPAHQHHHPGHGGPGQMGQLGGQLPPPSAQLHPQRIDSPSSPD # PNDMILGRGFGDMGRDMGIRDMNIREFNMRDMRDLNMRDMRDMRDMRDIREVRDMRDMREMNIREMRDLNRGMGDMREMRDIRPDMRPTIGAMSGAVS # GGMPSGSVSGGIPIATGPGPGAGLSMGVWGLRWLGLWVCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 Scaffold_4 AUGUSTUS gene 444698 445452 0.25 - . g97 Scaffold_4 AUGUSTUS transcript 444698 445452 0.25 - . g97.t1 Scaffold_4 AUGUSTUS stop_codon 444698 444700 . - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_4 AUGUSTUS CDS 444698 445182 0.47 - 2 transcript_id "g97.t1"; gene_id "g97"; Scaffold_4 AUGUSTUS CDS 445287 445452 0.42 - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_4 AUGUSTUS start_codon 445450 445452 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MQGQPMINGAGFMGNGMNSMNNGMGNLGNGMSNGMGNGLGNIGMGNQPGPPNSNSGGQPRVSMRGPNPGMPGFPVGGG # IGGLGGGPGPNTLRRVASQPQLGPGGAGNLGIAGMTGMGGMPNMGSMGSMGGMAGMSMNMGGGGGGMGMNPQTSMPAQLRAAHQQHQLRQQLTGPGPG # GPGGGPDGVMMGNMRTVPRPVMNSLSQPSNGGPGGSSFVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 Scaffold_4 AUGUSTUS gene 453989 454432 0.6 + . g98 Scaffold_4 AUGUSTUS transcript 453989 454432 0.6 + . g98.t1 Scaffold_4 AUGUSTUS start_codon 453989 453991 . + 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_4 AUGUSTUS CDS 453989 454432 0.6 + 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_4 AUGUSTUS stop_codon 454430 454432 . + 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MGLSGSEEVGSGKQSWNHALRLEGGLSGGCDVPPSREVSDGHSMTDPQHANRTQTAPICVLQANEDYPGESDMGLDFF # PDALDQSEDVNLFTRNDGEEGAFRPERVKEILRKVKIGPNLSTEQRAKVEHLLSTYADCFALSVGEVTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 Scaffold_4 AUGUSTUS gene 454970 455865 0.69 + . g99 Scaffold_4 AUGUSTUS transcript 454970 455865 0.69 + . g99.t1 Scaffold_4 AUGUSTUS start_codon 454970 454972 . + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_4 AUGUSTUS CDS 454970 455184 0.71 + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_4 AUGUSTUS CDS 455286 455865 0.92 + 1 transcript_id "g99.t1"; gene_id "g99"; Scaffold_4 AUGUSTUS stop_codon 455863 455865 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MHAKWTETLALIQHSTLRVKVTLVCEAPFGLTGAPSTFANMTALHLDDLIADGTIELFVDDGGAADDDFDAIRKNQQD # GVTVDPAKLTVIVEWRQPEDALNLASFVGLTGHFRDLIRNYARIEGPLRNLLKSVPLPQNYTKSTYRKAMESFKLADRWTLDHTKAFLALKKALVSEP # VLKAPRWDGSSFIITTDGCKEGFAAVVTQRFEVVHPNGTTTYKTHPVGFASKRTSTSEQNYKPFLLEFAALKFGLDKFSDMIWGFPLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 Scaffold_4 AUGUSTUS gene 459300 460548 0.43 + . g100 Scaffold_4 AUGUSTUS transcript 459300 460548 0.43 + . g100.t1 Scaffold_4 AUGUSTUS start_codon 459300 459302 . + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_4 AUGUSTUS CDS 459300 459585 0.43 + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_4 AUGUSTUS CDS 459680 460548 1 + 2 transcript_id "g100.t1"; gene_id "g100"; Scaffold_4 AUGUSTUS stop_codon 460546 460548 . + 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MHNDSFASQASDTPVVHANPDPSDRDGGQLDPQEFSFGDRASYGHVAYQDFEYEGGSTDGDYPIFTEEEGHKESPSFG # EEGVRDGKMAPSDYPRSPRKELKTIQRHLLTPDYYPGHADIPGLVVTQDPLSDANTIPLHIPNSSPFDEEETQDATMPSDLNYHPGYPDVPSLALTAN # SFSDDDTVPLQQPNHTPFEEEGAQDARTPPDPDYYPSYADVPSPVVIVDTFFDGNIDPLHQPNYSQDYSHEQSMNTMPSLNGQSSPPVESACTSQGVE # VSSDYNPDNDIDTLRHVCTESSSYNDDPTLVVQSIQERNTQKQEPADINVSMDVLRRTRRIRARQMRLRNKASKVIQQYLFESQTSLTCSFFANRRGR # YRRIFNPSSSIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 Scaffold_4 AUGUSTUS gene 460581 461990 0.91 + . g101 Scaffold_4 AUGUSTUS transcript 460581 461990 0.91 + . g101.t1 Scaffold_4 AUGUSTUS start_codon 460581 460583 . + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_4 AUGUSTUS CDS 460581 461990 0.91 + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_4 AUGUSTUS stop_codon 461988 461990 . + 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MVRIPFIYPFDAASSEGTESYYSQSNSAIPEDGEYRGGSVIDRINAYEGEHEFDAASSEGTESVYCQSNSAIPEDGQY # RGSSDTDHINAYECEHKFDDAPMHDVTWGAFFDTSSNPPPSPDAPVVDHPHQPDVGEDSGVLLEGGFDYHGHDVTKDSGVDNNYQGFIDHHSGSGVIY # GDTVNHDSGLGYDHSWFNNHDPHAGAFRDHDGVNRPGSGAPGDLNQESQDSPHHTSLHGIVTGDEQGVSEDHHRPYQVDTNDEMQIDACLHNFVNDNT # EPEDFETPNHHVSPTSNLYNVVTVEEIEDANDYAHTLNNLGMGDPIIRPVSAMGQTERFHGRGFEYFESSCPVDHKANNESNFLDNDATMDHGTSEFE # NSAGHREHFETGNEDYLRGLSPLTDIPDTPRPQTSSEHEQFETGNESYLRGLSPLTDIPDTPRPHPHVFATEDEALDSLFKELNSLVENGVKSPSMV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 Scaffold_4 AUGUSTUS gene 465648 468798 0.75 + . g102 Scaffold_4 AUGUSTUS transcript 465648 468798 0.75 + . g102.t1 Scaffold_4 AUGUSTUS start_codon 465648 465650 . + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_4 AUGUSTUS CDS 465648 467444 0.76 + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_4 AUGUSTUS CDS 468253 468798 1 + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_4 AUGUSTUS stop_codon 468796 468798 . + 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MTTEYEWRFLEKIQLHLANLKENPLRFWNPAEIQFREDLGEYPDNSDLTFPLDHDSRNSVFMGHVDWLRESQRFLERT # MSMRKFSHAFSCKHKVVSAAIEEELKVTQHQLKVEWDQRHRRMVTGQCHVYSTGTYHQLSCIETLSNQVSLAAPVGDLESGRSVFFLVLVVAAILHIM # CNLSLVPVGFLLGGIRIILKSEGHDPQETDAHIPKDMRTVLNRLDLYPKYTAYVCCPKCFQLYDIDNYPELCDNKSAEKSPPCKRRLRRSTSPHTTDS # TPANADRRRPTTSPVRSYHYQDIKQWINWMHNRRDLAPHLERSYDPEPPADGKVRDIWESDYFRTFLGPDGKKLFLSPESPNESRLVFNLNADGFNPY # GNRMAGKKASVGGIYLVCLNLPPEMRMKPENIFLVGVIPGPKEPSAHQINYVLRPLVDDLVLLWTSGISMARTHRHPRGRSVRAALVLLVCDMPAARL # LGGFAHFSSNADPCSTCKTSNLNDLNDQTFIPRTNDEHRRGAHAWLVAQSEEERDLLFRRNGVRWSELLRLEYWDPVQNTITDPMHGFYLRVFQRQCR # QIWGMNIDLEDCDGLWEIKLPTEEEKAIARDNASPSGAGDSTTEVRLFIHHRISIHGVRNQLTQTGSSPGDDPLELFFNATKSQIEHFPKKTLDRIIH # AVKVWKAAATHTRQNRSTKDRSQQDENQVDFFTTELDFDSEQYNMDDSDMSDCRSSSDFDEEIEIIMPTDNRGKRNLLHDIVRIGNSFNRGMLTRSRF # FISDSRQASLTKKVNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 Scaffold_4 AUGUSTUS gene 469406 470107 0.54 + . g103 Scaffold_4 AUGUSTUS transcript 469406 470107 0.54 + . g103.t1 Scaffold_4 AUGUSTUS start_codon 469406 469408 . + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_4 AUGUSTUS CDS 469406 470107 0.54 + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_4 AUGUSTUS stop_codon 470105 470107 . + 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MFSRFCMMQKLKSLFHGGTFPPMVTALATLYRETFENSDTRGSRINDALAFDDTFNSDSAVDWPISLPNLDATTVRKL # LEYGPFSAQIRIHNRLKIRGLTFTPEDRSFPDAQVVYSIKSAEEWCAGSIRRIFTARKLVDGRHIGQKFAEIYPYKPLVASHAETDKYRTFGFAGGRL # FYDILEDDTILIPVEQISSHFGHSLYWDSSIDVPTIHALPLNKVSFHGQCRVFRSHH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 Scaffold_4 AUGUSTUS gene 487442 487861 0.72 - . g104 Scaffold_4 AUGUSTUS transcript 487442 487861 0.72 - . g104.t1 Scaffold_4 AUGUSTUS stop_codon 487442 487444 . - 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_4 AUGUSTUS CDS 487442 487861 0.72 - 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_4 AUGUSTUS start_codon 487859 487861 . - 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MYAVYHGPIGCRRISHKVHGFAQVFKDSVESFGYDVANATFFDTITVKVSNAKELHDVSITAGINLRHIDDHNVGVTF # DESVTSNYLVDLINVFATASSSSPVSLQQLREPDALAIPSSLERTSEFLPHQVFNKAPFRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 Scaffold_4 AUGUSTUS gene 493972 494924 0.71 - . g105 Scaffold_4 AUGUSTUS transcript 493972 494924 0.71 - . g105.t1 Scaffold_4 AUGUSTUS stop_codon 493972 493974 . - 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_4 AUGUSTUS CDS 493972 494506 0.93 - 1 transcript_id "g105.t1"; gene_id "g105"; Scaffold_4 AUGUSTUS CDS 494839 494924 0.78 - 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_4 AUGUSTUS start_codon 494922 494924 . - 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MSVSQSSTLQVNVRLDQGVKYVFKVNGPNNPQTAASSSDQQTSTSAHSGQFNPGAGTPRSAPQFNLMSAANAQGAPLY # IPQPHTASTGVDYAMKKVKGEDGTPRRQSLAEGPSNGSVINDVSVGPGNNKRKMDFDADRLVPSVTYSRMYNPSPLAAGSSSSHALPATYTSMSTSSH # VATRSHSNSPGPFQNPSTSSAADDGPRTSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 Scaffold_4 AUGUSTUS gene 503557 504153 0.55 - . g106 Scaffold_4 AUGUSTUS transcript 503557 504153 0.55 - . g106.t1 Scaffold_4 AUGUSTUS stop_codon 503557 503559 . - 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_4 AUGUSTUS CDS 503557 504153 0.55 - 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_4 AUGUSTUS start_codon 504151 504153 . - 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MKGPIKMRWARTDDVKKRGAKSDSEFYKKHGRMAGKELFNGRELPMKKRRRNDEEPNVLLQKEQLDDELNEFLAEGEA # EDATALDPQPPPSKMRSDYIATDGRTLLGDASPKPDLVSRLFAPLPRRAQKGRNSNHHGGVSLEDRLWSDKFDLSERTVAEQTSRSGRGRGRRNRDGN # RDRPKKSQQELDDELDTFLREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 Scaffold_4 AUGUSTUS gene 505995 507970 0.15 - . g107 Scaffold_4 AUGUSTUS transcript 505995 507970 0.15 - . g107.t1 Scaffold_4 AUGUSTUS stop_codon 505995 505997 . - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_4 AUGUSTUS CDS 505995 506866 0.42 - 2 transcript_id "g107.t1"; gene_id "g107"; Scaffold_4 AUGUSTUS CDS 506965 507970 0.15 - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_4 AUGUSTUS start_codon 507968 507970 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MGTIHDGNSFAIYRQNSMMTTNTFQACISAGVKKFFYASSACVYHELLQISSSGQDVSLREDDIFHSNEPPRPQGLYG # LEKLTSEFLIQQPVLNFGLDIRIARFHNIYGPGGAWNNGREKAPAALLRKALVYRPTISPGVSVEPFEIWGDGSQRRSFLYIDDAVEAIIKLLESNHS # KPINIGSDSSISIQELARLALRIASIDPKSVVFNHDITKPVGVASRNSNNVLVNSVLGWSPTTSLEDGMKHTAQWIEGKMGRLLLQGPSTSISMREQM # QQSQLIHLSPEATIVFAVLLPITSRGSGDPAQCLSHLRKFAESLNRTTRQRDTFGLAKTKFCFLRTKTLLCNHPRGHVCKLWRDLAKAAWDDSCDYFV # LMGDDVVLKDRGWMEDVHAQFQRFSEDQAGVPFGFGCVSFTDITFPGMPTFPVIHRTHLDIFNGEVIPSVFINQDGDPFLYQLYRRWGCSTMIESRIS # NEVGGEFAARYEKQHTQDWTFEILDSAVFAIECWLQDRAEGNSILIPQKLLTLDIVIPCYRVDSEIIDRILQLKTSKFCSTMFIIIVDDPNNPNIAVL # NQRHGHRPGCSNPVSNSVNSGASYSRNRGMQESAADWVHFLDDDIVPPLTYSWKPKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 Scaffold_4 AUGUSTUS gene 509306 511039 0.8 + . g108 Scaffold_4 AUGUSTUS transcript 509306 511039 0.8 + . g108.t1 Scaffold_4 AUGUSTUS start_codon 509306 509308 . + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_4 AUGUSTUS CDS 509306 511039 0.8 + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_4 AUGUSTUS stop_codon 511037 511039 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MSANLPVRTKLDSTIPFNVDPNRANQFQFTDAQDWFSHNIPHWRNLFSFITSPRPRILEIGSWEGRSAVFLLQNICGQ # GTDIGIAGSERNDQMDFEGEKVARDLGSLSSFHFIFVGADIVCIDHFDLFRTSAGRERFRKINHNLSLTGKPFRVLPQFSVPALMKLLEKEILKEESL # GNAGDANVPEYEGVSGSEQVGFDWIYIDGSHEADDTFLDGELAWRLARKGAIFIFDDYHWDKEPEDSKHHPKKGIDTFLDLHRGEYVKLTEPEHYQVV # LRKTSEMRIGFLVDKEGLSEDEGDAIKKVFGYGINVALVVDPAYAMSAAVVILSTVENTTGRITIYIVDCGLSEENKQRFLRLIDPLRANDVTMMFIA # LNAEGLGKELGPVWAKLDLAEVLPIERVLYLDADTLIRTSIEMLWQTDLQGQTIAAAPDVGHPMGHDQMGVKMPYFNAGVMLVDLAKMRSKSAELKQL # GRSMKDSKFRDQDVLNTFYASQWKRLSLKWNAQGLGTYARYPSPERDMLRLLDPTIDTPDPAIVHFTGPVNPSVEEVLSLYVQPPTAKPWGIWVPLGI # HFKLSGGQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 Scaffold_4 AUGUSTUS gene 512194 512835 0.67 + . g109 Scaffold_4 AUGUSTUS transcript 512194 512835 0.67 + . g109.t1 Scaffold_4 AUGUSTUS start_codon 512194 512196 . + 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_4 AUGUSTUS CDS 512194 512835 0.67 + 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_4 AUGUSTUS stop_codon 512833 512835 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MIRRELAKDPKLATESWDRFLPQFRKNHLKTSDKTAKKNERLEAKNAARTAAGLPIESSADVAAKKKVYTPFPPAQLP # RKVDLQLESGEYFLKKHEKIAKESAQRRQKVGLNGSLYISSIYQSFQQTESMEKRRAERAEAFVAPAEDAAPTVEEKRKRKRKDMGSEMTRDQQEAVG # TKKSKKKKHKVEERGEMRLIFDCLHVYRRVSASTSCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 Scaffold_4 AUGUSTUS gene 513515 514636 0.21 + . g110 Scaffold_4 AUGUSTUS transcript 513515 514636 0.21 + . g110.t1 Scaffold_4 AUGUSTUS start_codon 513515 513517 . + 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_4 AUGUSTUS CDS 513515 513528 0.58 + 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_4 AUGUSTUS CDS 513578 513617 0.95 + 1 transcript_id "g110.t1"; gene_id "g110"; Scaffold_4 AUGUSTUS CDS 513777 513909 0.54 + 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_4 AUGUSTUS CDS 514068 514636 0.37 + 2 transcript_id "g110.t1"; gene_id "g110"; Scaffold_4 AUGUSTUS stop_codon 514634 514636 . + 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MKKLGDTHSRNSNPPLHSTADASNAKIEDFLSSSMLSNQSKELDDDDEEIPLNVQVKISPTQQDETLEFGRSAKRNRA # SPAPVLPPIVESKRGPSPSRLELPGMADAVVQPPPIPVLSKLVQPKSKPSSSTSRSQPAAPLPLSPMPLAAGSDSEEEEWDEVAAPSSVAAGPMTVED # DGGEEIDINELETLINNHLEDDEQEPENFLDMAIPPEESPVLSMGPPISLKQFAGGDSADDDEDEYSSSDDSDED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 Scaffold_4 AUGUSTUS gene 515110 515607 0.78 - . g111 Scaffold_4 AUGUSTUS transcript 515110 515607 0.78 - . g111.t1 Scaffold_4 AUGUSTUS stop_codon 515110 515112 . - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_4 AUGUSTUS CDS 515110 515607 0.78 - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_4 AUGUSTUS start_codon 515605 515607 . - 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MLGGNPFSISLPYNQCVVPSTVNGPVAIYVTSDDNPLQSNVVNRASANNILAGPTVAFIDAQPETLGQMVRSSGTGTA # SASSSTQTISPDVAASIVSAQGSATAAGATATDSTSVSATDSSAAAASTANSVNDSSDPSAPFRDDFTGLAPGNAINVIGWSNIPSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 Scaffold_4 AUGUSTUS gene 515830 516210 0.73 - . g112 Scaffold_4 AUGUSTUS transcript 515830 516210 0.73 - . g112.t1 Scaffold_4 AUGUSTUS stop_codon 515830 515832 . - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_4 AUGUSTUS CDS 515830 516210 0.73 - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_4 AUGUSTUS start_codon 516208 516210 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MGHVQLNLTSLQEELTALGQNPNSTCSFNFDSALTDVTTMAATARVVENLGVMAYLGAASLLTDPQLLEAAGSILTVE # ARHQTILNVLSGTGTAIPSAFDLALTPSEVLAVASPFFSGTCDLGIPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 Scaffold_4 AUGUSTUS gene 523721 524248 0.57 - . g113 Scaffold_4 AUGUSTUS transcript 523721 524248 0.57 - . g113.t1 Scaffold_4 AUGUSTUS stop_codon 523721 523723 . - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_4 AUGUSTUS CDS 523721 524047 1 - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_4 AUGUSTUS CDS 524143 524172 0.57 - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_4 AUGUSTUS CDS 524240 524248 1 - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_4 AUGUSTUS start_codon 524246 524248 . - 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MHNSDYISILLRQWAVPGYVAELTGEEEADNEDEDKEEAEEEDQDITEYKVAKRPPLRGTVTSIEKDYDADWFIWYLN # EFFTDYSIDRANGDPLTNDTVFPIYKQIRLSLPSLPEAYPKTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 Scaffold_4 AUGUSTUS gene 531973 532767 0.86 - . g114 Scaffold_4 AUGUSTUS transcript 531973 532767 0.86 - . g114.t1 Scaffold_4 AUGUSTUS stop_codon 531973 531975 . - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_4 AUGUSTUS CDS 531973 532767 0.86 - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_4 AUGUSTUS start_codon 532765 532767 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVK # HLLRYLKGTIDYELELGPDPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYK # VASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPITSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 Scaffold_4 AUGUSTUS gene 532826 534307 0.13 - . g115 Scaffold_4 AUGUSTUS transcript 532826 534307 0.13 - . g115.t1 Scaffold_4 AUGUSTUS stop_codon 532826 532828 . - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_4 AUGUSTUS CDS 532826 533581 0.44 - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_4 AUGUSTUS CDS 533697 533827 0.81 - 2 transcript_id "g115.t1"; gene_id "g115"; Scaffold_4 AUGUSTUS CDS 533941 534307 0.28 - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_4 AUGUSTUS start_codon 534305 534307 . - 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVF # IGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLHSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPNLQHQPIQVE # PRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVL # ALAAIDDMELRSVDISHAFINSDIDTTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVKLGFKRLESDPCVYLFQRGDIKVIVPVW # VDDITLASKTLVSSINSSLNYPRAKTPRSRRNYLLARHRNQERSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 Scaffold_4 AUGUSTUS gene 534393 536213 0.86 - . g116 Scaffold_4 AUGUSTUS transcript 534393 536213 0.86 - . g116.t1 Scaffold_4 AUGUSTUS stop_codon 534393 534395 . - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_4 AUGUSTUS CDS 534393 536213 0.86 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_4 AUGUSTUS start_codon 536211 536213 . - 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 Scaffold_4 AUGUSTUS gene 540718 541224 0.89 + . g117 Scaffold_4 AUGUSTUS transcript 540718 541224 0.89 + . g117.t1 Scaffold_4 AUGUSTUS start_codon 540718 540720 . + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_4 AUGUSTUS CDS 540718 540886 0.94 + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_4 AUGUSTUS CDS 540968 541224 0.91 + 2 transcript_id "g117.t1"; gene_id "g117"; Scaffold_4 AUGUSTUS stop_codon 541222 541224 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MFCIHDSFYVVESSQHSYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTP # PAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGQTLLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 Scaffold_4 AUGUSTUS gene 541703 543230 0.41 - . g118 Scaffold_4 AUGUSTUS transcript 541703 543230 0.41 - . g118.t1 Scaffold_4 AUGUSTUS stop_codon 541703 541705 . - 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_4 AUGUSTUS CDS 541703 542063 0.41 - 1 transcript_id "g118.t1"; gene_id "g118"; Scaffold_4 AUGUSTUS CDS 542152 543230 0.44 - 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_4 AUGUSTUS start_codon 543228 543230 . - 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKK # FQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQK # VHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIE # RAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALHTIKDWDFKPGQ # LVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMHQKM # ITYSMPYRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 Scaffold_4 AUGUSTUS gene 544065 544454 0.4 + . g119 Scaffold_4 AUGUSTUS transcript 544065 544454 0.4 + . g119.t1 Scaffold_4 AUGUSTUS start_codon 544065 544067 . + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_4 AUGUSTUS CDS 544065 544075 0.4 + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_4 AUGUSTUS CDS 544142 544454 0.58 + 1 transcript_id "g119.t1"; gene_id "g119"; Scaffold_4 AUGUSTUS stop_codon 544452 544454 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MNDFNLNGGLVVDMDNGRRCDFITKLGEERTIANTSLPTALDATNSASVEDRVTTGCSLLLQLTAPDPILMMYPVVDF # PLSLLPPKSASLIAVIKSGAVGSGPSSNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 Scaffold_4 AUGUSTUS gene 545204 548169 0.93 - . g120 Scaffold_4 AUGUSTUS transcript 545204 548169 0.93 - . g120.t1 Scaffold_4 AUGUSTUS stop_codon 545204 545206 . - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_4 AUGUSTUS CDS 545204 547591 1 - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_4 AUGUSTUS CDS 547642 548169 0.93 - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_4 AUGUSTUS start_codon 548167 548169 . - 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPASDSHSIPWTLNYNLWLSS # DNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKGIQANKAKVTEVDDDGVT # ESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEARQVLFSRVLHVPSLNNNL # LSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLE # SSAKPDPVCEPCLGGKMQCKSFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKIL # RHDKGGEYISKEFEKFLQDEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNV # ENLRVWGCMAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAP # NELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPAPNDDSDDSNDDYYGDAE # LASISTQQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWISLTSHQERKQLGLLGYSGLNTMLMVLLNDLKPASVLRVSAKDLVLTIWKPMLPL # CAGPHYVLSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 Scaffold_4 AUGUSTUS gene 549462 550394 0.89 - . g121 Scaffold_4 AUGUSTUS transcript 549462 550394 0.89 - . g121.t1 Scaffold_4 AUGUSTUS stop_codon 549462 549464 . - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_4 AUGUSTUS CDS 549462 550394 0.89 - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_4 AUGUSTUS start_codon 550392 550394 . - 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MRTLRSNAVAPEEMRKQKNQNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDV # DESDDEDTIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAAL # SPAIRKIIMRKIRNRRVCPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDE # RRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAGYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 Scaffold_4 AUGUSTUS gene 550424 552034 0.62 - . g122 Scaffold_4 AUGUSTUS transcript 550424 552034 0.62 - . g122.t1 Scaffold_4 AUGUSTUS stop_codon 550424 550426 . - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_4 AUGUSTUS CDS 550424 552034 0.62 - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_4 AUGUSTUS start_codon 552032 552034 . - 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MSENRHRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEAT # ESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIEPASEQEKMRIFRLLFDAEMK # KLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDKVMNAAEKYMIGSSFDNYYQTLSIASLSPPINNPNSFSRGHIN # LPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKG # MINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGW # DRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 Scaffold_4 AUGUSTUS gene 570759 571523 0.99 - . g123 Scaffold_4 AUGUSTUS transcript 570759 571523 0.99 - . g123.t1 Scaffold_4 AUGUSTUS stop_codon 570759 570761 . - 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_4 AUGUSTUS CDS 570759 571523 0.99 - 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_4 AUGUSTUS start_codon 571521 571523 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MTATKSNTTWSQNSSVGSSTIAGGKILNKKCLGVLIYTVEGCQFIGWPQVESAGLQKQLSARCHCDGQLKHDHCSSRS # YLITWGQQDGDISTTQYRYINGTAHTHSRLPGVVRTTAAEDQRFRTIYENRPNATSTQLIIGAPAPQGFGPGAADVGQKFLQRAYTSYRLNQEKEKDG # NGPTSAFGNLLNLQKWKGKHLTVLCKDYVSSNIVCISLQTEWMQQQTLPDMSDGSDTLYGLLSDAAHKYWEDPNGCST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 Scaffold_4 AUGUSTUS gene 574741 575022 0.73 - . g124 Scaffold_4 AUGUSTUS transcript 574741 575022 0.73 - . g124.t1 Scaffold_4 AUGUSTUS stop_codon 574741 574743 . - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_4 AUGUSTUS CDS 574741 575022 0.73 - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_4 AUGUSTUS start_codon 575020 575022 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MELKVAVNFEQVVKSKVVVSHEQAIELKNVAQSVQEPEMESMIARYGVQLKKAEMLELNLMGVTLTEKTEARKVVAIA # EAAEIRDSVSEITDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 Scaffold_4 AUGUSTUS gene 578452 580124 0.26 + . g125 Scaffold_4 AUGUSTUS transcript 578452 580124 0.26 + . g125.t1 Scaffold_4 AUGUSTUS start_codon 578452 578454 . + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_4 AUGUSTUS CDS 578452 578961 0.28 + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_4 AUGUSTUS CDS 579708 580124 0.59 + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_4 AUGUSTUS stop_codon 580122 580124 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MGHRGMDLTLRAGVQLMIIDARALYDHQVEASHTGRPEVVLQEHTGHRGCPRTIINADFLSWAYGHRTTSGISDFLGV # SRATVRRRLLENEIALPGPNSFPDSWIDNLVQSEVPEDNAINGVLGSEMEVPVSLPDAIYTEAASIASTSSSATYLSSISDDQLDSLLGHLRISQRNG # PSRSPEDMFGFDMIVNGLRGGSLDEVSMTNEELEVFGLDWDGLRDKVLLRSLRQNYNNEGSSSWLGQWGPPPELNQVVVDPPPGLFTLEQIAWMDEQL # SRLARGPQEEDVVQLWITALAIARSMTGNNSTYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 Scaffold_4 AUGUSTUS gene 581287 582261 0.45 - . g126 Scaffold_4 AUGUSTUS transcript 581287 582261 0.45 - . g126.t1 Scaffold_4 AUGUSTUS stop_codon 581287 581289 . - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_4 AUGUSTUS CDS 581287 582261 0.45 - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_4 AUGUSTUS start_codon 582259 582261 . - 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [METQLLGFLDYDLRFDEEEACHMFAPFMATPAQRASTRALAVDRVVKAGRARVQAQQIPDSSVESIPPHLPSQSSSTS # SGLASTVRTLAKRISNTHISSSRSQSTTSTASSPMYTSLSTTSTLSSSSSDVGSLIEDSGSSSGSSSGWNTSDSESDLEEYAEPEVYSNSSMSLYPRD # EQVPERLIKSSSIVRSMPSYAQKSQQLRSRKPSDASSICTVTQSPLISAAHSRRCSNKRAVSISVAGTDHVKDSGISSSATMPIISRGTSGNFLARMW # GAAKGQAWQDKTLDDGDHAESQGSSTLRRLVLVHSRSGLSRGASSSGVDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 Scaffold_4 AUGUSTUS gene 586855 587446 0.27 + . g127 Scaffold_4 AUGUSTUS transcript 586855 587446 0.27 + . g127.t1 Scaffold_4 AUGUSTUS start_codon 586855 586857 . + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_4 AUGUSTUS CDS 586855 587009 0.27 + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_4 AUGUSTUS CDS 587059 587446 0.85 + 1 transcript_id "g127.t1"; gene_id "g127"; Scaffold_4 AUGUSTUS stop_codon 587444 587446 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MVRLPARLHLGMGLCTLGLLLQDFALAQNLTDSQISDVETRLAEGATHPCVNWELGTRAQALLEHNVRDFSVFSLTLP # STSVPSDTSSAIAPVFSIAKGVVNNRTAVNGNITGPQPLVTDDSAADPASIGPAVLLANWTNLGDGVDYAGAALDQLNFLYEKVPKTSDGAISHRTGE # VQLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 Scaffold_4 AUGUSTUS gene 589040 589855 0.66 - . g128 Scaffold_4 AUGUSTUS transcript 589040 589855 0.66 - . g128.t1 Scaffold_4 AUGUSTUS stop_codon 589040 589042 . - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_4 AUGUSTUS CDS 589040 589855 0.66 - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_4 AUGUSTUS start_codon 589853 589855 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MVAIVFDKLMQYQIVDPTDVVSWTFLHVSEVDEFEADLKAPLNLSAFEWNLLKGALDKAIGRVNIARRRLALLRKEDD # ENRARAKANGGNMDVDGEAKSGKDDFFGRRKSCSPFPEIETCFFLSDEPVPEDPALAVAVKAFSSLTREQKAALSRTLEGFVSCLAPSISSSHPNPKA # REILTENSWHNRANWGKDEWIAWETWGWYRHFCRAVSFCFLIIELSTKFHLFQYSPYLRNYAATFTAVSFARFEGQSDPASDLLQKIWDISIGQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 Scaffold_4 AUGUSTUS gene 593035 593406 0.89 + . g129 Scaffold_4 AUGUSTUS transcript 593035 593406 0.89 + . g129.t1 Scaffold_4 AUGUSTUS start_codon 593035 593037 . + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_4 AUGUSTUS CDS 593035 593406 0.89 + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_4 AUGUSTUS stop_codon 593404 593406 . + 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MKGIRSREEALDELKRRRKALISKADTAEKKLSKMSPEHKNLGVQTDTLNRLRDEIRSMDSEIMSDEASLGDYKRSRT # KAWMGLKFGGLLECCEKGTIIGEFGRLVINVSETSRNQSLCLSFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 Scaffold_4 AUGUSTUS gene 593437 595092 0.42 + . g130 Scaffold_4 AUGUSTUS transcript 593437 595092 0.42 + . g130.t1 Scaffold_4 AUGUSTUS start_codon 593437 593439 . + 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_4 AUGUSTUS CDS 593437 595092 0.42 + 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_4 AUGUSTUS stop_codon 595090 595092 . + 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MARPMYMNHQKVNSLISDATRCVDEVAFSTAPAPGTAPPVHQGMADYLAPPQGLGTGQFLDTSDITGNMGSSIPPSPT # SLNAYPEASRSADDFGVASRNSPIASRFSTFPTTSGNGGAGFSLRDGSSYHAEDDSFSSSIAAALDARKSTEEPAPSYETHQVHLTRPPAGAAPPLMM # PSPWELQESASQNTNQRAVSAYGDDVGLAYMTNPEEEPHPDHGLDHQRNTSKEVHFGQVQDIAIELDNRHEQGNIENYQADGIAPPGEARSSPKRVPP # PSMSPEEEERALNADAARKLSREMDSFSFDPSSSALSAIPPPIVQPSQERGVERPSSLTPEFETNNRSTSPLIPPVAPFAQQRGVSPSPIDINSHHDD # IEKTSSPIHNSPPRLTISDRTASSISNGSSYRTPPEYPRSIGTSPFGQRSNSSFSGSMPSSPAIGAPRTISAAAFRRPAGAPGRTTSADLGSGSGLSG # SHLADVSPLQPKKRGLPNAPSSSLSHSNPSLRPYEAHNLNAGNRVSQAGSDDYDYISAYTDAPQDTGSPQRNDYGVSVRLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 Scaffold_4 AUGUSTUS gene 598166 598477 0.64 + . g131 Scaffold_4 AUGUSTUS transcript 598166 598477 0.64 + . g131.t1 Scaffold_4 AUGUSTUS start_codon 598166 598168 . + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_4 AUGUSTUS CDS 598166 598477 0.64 + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_4 AUGUSTUS stop_codon 598475 598477 . + 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MNAKKNVKKEFQFTWGMAIGDLEHKLDRAKAELKRGSRVDLVFAPKSGQKSPPMAQMRERMQLIADKVADVGVEWKSR # ELSRGIGALFVQSLGLQCEEEGSAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 Scaffold_4 AUGUSTUS gene 603574 604903 0.66 + . g132 Scaffold_4 AUGUSTUS transcript 603574 604903 0.66 + . g132.t1 Scaffold_4 AUGUSTUS start_codon 603574 603576 . + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_4 AUGUSTUS CDS 603574 603576 0.88 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_4 AUGUSTUS CDS 603735 604222 0.87 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_4 AUGUSTUS CDS 604267 604903 0.84 + 1 transcript_id "g132.t1"; gene_id "g132"; Scaffold_4 AUGUSTUS stop_codon 604901 604903 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MFALTRGIASTTVGVSATIVDAALFGGVTVTRPVVGGAVSAAIGLVEQLTLVPIHLGEYLTSTSVIAAHSSINLLSVI # FPGSHEASFSLASFITLVKREWAQPIDGENLPEKQFGVTSIARAVSAWAALQGVTQEWQERRWFKYLKEIDVKNTPKHFDSLRNRKSMQCRGSRVRVT # SDVIFPGNLGQLVAADIGEAPKRAQSIFISNRVISPPPNTQVKGVPHSSRRLSNTELKVELRRLSKMVLAGYGGASLLFFGIPLSSSIGANVSSSSPQ # AKAEEAQLANAVNASEAEAEGDGLRPEIMHEEQYSWWDVLLGRHDHDILAKSANDPNETIQTEIKIGREHLMPRFWVLTDHSRAQVVLILRGRSFNGI # GGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 Scaffold_4 AUGUSTUS gene 606917 607549 0.95 + . g133 Scaffold_4 AUGUSTUS transcript 606917 607549 0.95 + . g133.t1 Scaffold_4 AUGUSTUS start_codon 606917 606919 . + 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_4 AUGUSTUS CDS 606917 607549 0.95 + 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_4 AUGUSTUS stop_codon 607547 607549 . + 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MGALFHVYVLCSYSPGYQFSLNFFSNSEGVPIGITSVALALIASMGGFIFGYDTGQISDILLMPDFLLRFADCSSGAT # LATATDTCSFTDVRSGLIVALLSIGTLAGALMGAPIADFLGRRYAMVVECGVFIIGVIVQITTTQTWQQFAVGRMISGLGVGALSAAVPMYQAETAPA # QIRGSLTATYQLFITFGILIACKYRTSTFTINVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 Scaffold_4 AUGUSTUS gene 613153 613461 0.94 - . g134 Scaffold_4 AUGUSTUS transcript 613153 613461 0.94 - . g134.t1 Scaffold_4 AUGUSTUS stop_codon 613153 613155 . - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_4 AUGUSTUS CDS 613153 613461 0.94 - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_4 AUGUSTUS start_codon 613459 613461 . - 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MQGGSAQLNSTSRPAATEVPSSITTSDLSSDVSPAGSTMQVKHVGVDPSVLDATSLKPLSSLKWPYIADEEPIYPDPL # ERNDPKPLRTRHYEAIGIHISLGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 Scaffold_4 AUGUSTUS gene 617579 619201 0.69 + . g135 Scaffold_4 AUGUSTUS transcript 617579 619201 0.69 + . g135.t1 Scaffold_4 AUGUSTUS start_codon 617579 617581 . + 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_4 AUGUSTUS CDS 617579 619201 0.69 + 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_4 AUGUSTUS stop_codon 619199 619201 . + 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MRNITAYIDRPSFTQHFSSDEPFYDSPPPQYSFIGSALISLAPISRSLSCTYTVPIFCRSTAEAIGSCRVDIKLVNIA # LPSKHASGQPSGSTSQGSGIIPTGSKLSFFFTVDTVKGLSLHDFSAVHLQVRLSSFVGPTLSAEEVFPSTAVDLESSSLSELRFRRSFSIVASPKVLN # HLRQGYAPIEFFAAVTPTYLERMERWDEMREQKIYFPGSQESRLSSPDSQSTNTPPMRRSETDFVVEQNHDVIVWIQVCELAPDGQYAPVPVLSQGTL # DPGSFSLHQGLQRRIVISLSSNSGQQFPWSEFTKVRIGNVRVIDAKGRVQESSSKALITLPLLQEQNIEFKPDGTGSLFGQALWDSSVHNSSLLNKVT # PMNQRVLLQLTCAVSVETCADPVQFNIDVAITIGTRDARPPSKLLTFFGSKKILSKSSHLFRVRLSPPLTRSVKELWRLDTAEKYVRGEESLGAWRPR # GISVVEDYLRLIMMEQRAADVQATRAILTTSRPLVTQPDALAWRADDLVRKALELWQRRYYGNVCVFYQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 Scaffold_4 AUGUSTUS gene 625419 626911 0.63 + . g136 Scaffold_4 AUGUSTUS transcript 625419 626911 0.63 + . g136.t1 Scaffold_4 AUGUSTUS start_codon 625419 625421 . + 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_4 AUGUSTUS CDS 625419 625698 0.97 + 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_4 AUGUSTUS CDS 625777 625841 0.63 + 2 transcript_id "g136.t1"; gene_id "g136"; Scaffold_4 AUGUSTUS CDS 625943 626911 0.93 + 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_4 AUGUSTUS stop_codon 626909 626911 . + 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MFNQPLTYSSLKSAIKASSNKPKKDKKKTKKDYVSAEPSDNEATSKQATVVTADDFVDDEWGPLKDKGKKIKKGKSNQ # HKAVEENIEDVETKPESIAEPHDEGVVDEIPGESLGEAKKKAQAAKKVNVTEAALPDTQEALLPSEPIPEENDREVDEGGKADSKNKKKKKKTKKDEE # PPPPPPNDEEEGRYQCTQGNDGRKEKVRRGSQAGRGGGAETHRRGRTKSGGGGETEGRGKTEKERERESKSASTDKTSSILKSCLSVQAKRELAKKEG # RLLTKKQKEEKAAAEIRKQALLASGVQIEGLQQSTNMPTKKVVYSNRKKKGPTANGASPASSRPRTPESPVVHEEKEDSIINLADGSLAPANKLEEAE # EASAKDDWDASSDEETKPASDGKKDSWDASSDGGAELKPTPSYSSTGKSPSKCMLAILKLWEMRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 Scaffold_4 AUGUSTUS gene 628079 628839 0.09 + . g137 Scaffold_4 AUGUSTUS transcript 628079 628839 0.09 + . g137.t1 Scaffold_4 AUGUSTUS start_codon 628079 628081 . + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_4 AUGUSTUS CDS 628079 628253 0.09 + 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_4 AUGUSTUS CDS 628379 628839 0.7 + 2 transcript_id "g137.t1"; gene_id "g137"; Scaffold_4 AUGUSTUS stop_codon 628837 628839 . + 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MIMLLVNLTQQRMSDRLMYLSELECTVLEVKVIEGLGTTIDVVLSNGILREGDKIVVCAYVHHKEVKAALGVKITAPD # LEKAIAGSRLLVCGPDEDEDDLKEEVMSDLATLLNNIDKSGRGVCVQASTLGSLEALLDFLKSSKIPVSGINIGPVHKKDVMRSATMLEKARELACIL # CFDVPVDKDAERMAEEMGIRLFKGNKWLLFPLVAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 Scaffold_4 AUGUSTUS gene 630481 630786 0.36 - . g138 Scaffold_4 AUGUSTUS transcript 630481 630786 0.36 - . g138.t1 Scaffold_4 AUGUSTUS stop_codon 630481 630483 . - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_4 AUGUSTUS CDS 630481 630786 0.36 - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_4 AUGUSTUS start_codon 630784 630786 . - 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MRKVLEDLSLEDDADVDMDNAEPALTTLEASPKKKSKKEKESKKKRKLDAIDVDRDDDGSDEEVVVKKVKLSKDEKKA # LKKEKKAKAKAEVNEQVSPTGYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 Scaffold_4 AUGUSTUS gene 631034 632312 0.31 - . g139 Scaffold_4 AUGUSTUS transcript 631034 632312 0.31 - . g139.t1 Scaffold_4 AUGUSTUS stop_codon 631034 631036 . - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_4 AUGUSTUS CDS 631034 631947 0.31 - 2 transcript_id "g139.t1"; gene_id "g139"; Scaffold_4 AUGUSTUS CDS 632105 632312 0.42 - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_4 AUGUSTUS start_codon 632310 632312 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MPITHALFESSSGYALFDVKLTEDIVSHSQAAQDSIKDLGKFGKMVELRSFVPFKSAAHALENINDVSEGNIREATGV # QCDASEKAQDIIRGIRLHAQKLLSSLGEDDLTKAQLGLGHSYSRSKLKFNVNRMDNMIIQAIALLDQLDKDVNLFSMRVREWYGYHFPELVKLVPDNY # TYARVIFFLGDKDTFTEDKLSGLEELLEEAQSAAKSSGETITGLESTSTTASNILSAARNSMGSSLSPVDMLNISAFAQRVVSLSQYRRSLVAYLATK # MNDVAPSLTALLGERVGARLISHAGSLTNLSKYPASTVQILGAEKALFRALKTKGNTPKVSEREWASLFLSLELTWLIFHSQRTVWFAIPFNLHWPGS # T] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 Scaffold_4 AUGUSTUS gene 639355 641630 0.69 - . g140 Scaffold_4 AUGUSTUS transcript 639355 641630 0.69 - . g140.t1 Scaffold_4 AUGUSTUS stop_codon 639355 639357 . - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_4 AUGUSTUS CDS 639355 641037 1 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_4 AUGUSTUS CDS 641085 641564 0.96 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_4 AUGUSTUS CDS 641622 641630 0.69 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_4 AUGUSTUS start_codon 641628 641630 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MLYEFGIDIIGEDNKTIVHHKVAARVMCILSEQDAQIAARAEQYQMQQMQQFAGPSSSLSPASNGSMINQTGPSSGPG # SSNSASFNFSGQQPPRRPQMSQQGISGMGGMGGSMRPPGKSGLTFDHILNRLQGELQKSRETGAELHTLTGAMSDIHDTLGGGNLPTTAPPFPHALPP # VRPPQSAAPPPSQPDVPSAPSTQDQQELMSNEPLTTSTTTTHFQMSSASSSALLVELQTQLKDTQTSLSQHIDKIRVLEDALKEQEAIRHEVRLLRDM # MDAVQRHDEPSQNTTSHKTRRQSNVEPQGGFDVDEEEETDNFDDEFEDDSRSVGTAVPHELERVDEEDEESASITDDESLPSQVDELDLEMAVREEAR # LQPSAPDGAFDGEFEDNEVEEEEQPQELGRPRTPEPSHLGMGTSRSKALNSPSKHSQGLSSTVVDELTTRLTTLSAQLESALALSSTLQAQHSTAQST # ISALESKVEALESLVTATLSAQQRQPAVTTEEQTAPQRAERESLISMVVEWKKSVEGQWSNVQEEWNQERERLNRAREEWEIKVRLVDDGLERMERMR # NVALSKDTPFFHGNGDIKHGLVTPPSPRSLSSDSNRPRRKRSGSARGRTGSKKRSLSRGAETDDTEATLANEEPHVFEKAASKLIASTQTNQHSELTS # GSPLAVSEPSANPFARSDHAEDSLLPARTTKAPSINDHNVSIAHCILAIKITDQLSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 Scaffold_4 AUGUSTUS gene 642490 644112 0.34 + . g141 Scaffold_4 AUGUSTUS transcript 642490 644112 0.34 + . g141.t1 Scaffold_4 AUGUSTUS start_codon 642490 642492 . + 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_4 AUGUSTUS CDS 642490 644112 0.34 + 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_4 AUGUSTUS stop_codon 644110 644112 . + 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MRKTLYMVFSKLEAEIQRSAEAESQAQAYIKRFKELNAEKLNVERESHTLEAELTLYKIQYDLAQKEIVKTRDTVLAL # QTQLDAAENDARKARGDARKVKEALEIWKAREEGRRQGFEAGWNRAREEFGASNAQTVLEYGNEYSDNLPPPELSSFQRTDAQGSGDGGDSISYRTYP # PPDQRGLLQFPEVPMVPASIFNDPPPQSLPIAESISRHSSVSERPQQAIPTHVSSRPSSTRFDMATPAVQMYSLPIPPANEVEFHNRPQSSIRRTNSK # QPQPQLQPWLAETPITRASSPRPPDNFIPAASEDGHIALPPPHELAEYPPSPQPTVNTLPGNTAYSSHGASMEEGPRREYTSSKGKARATDSWYNHRG # EVDSRAHTPDIAVAKGVLQPEASTSWYQDRPRRASMSSRYSANSSGGLLDAWGYPIQTETKRSGGLGNTLKNIFKGKGKDARMLSMIKENPLSRQGSL # NVGPVLPPSVEPSGSFRGHTYQGTSPTGSNQRFTEDIRYDNPDPTKRERPRPLEVRFEISMHCILLPIQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 Scaffold_4 AUGUSTUS gene 645862 646398 0.5 - . g142 Scaffold_4 AUGUSTUS transcript 645862 646398 0.5 - . g142.t1 Scaffold_4 AUGUSTUS stop_codon 645862 645864 . - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_4 AUGUSTUS CDS 645862 646398 0.5 - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_4 AUGUSTUS start_codon 646396 646398 . - 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAFYVAIQAVLSLYASGRTTGIVLDSGDGV # THTVPIYEGFALPHAILRLDLAGRDLTDFLIKNLMERGYPFTTTAEREIVRDIKEKLCYVALDFEQELQTAAQSSALEKSYELPDGQVITIGNETVGS # RS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 Scaffold_4 AUGUSTUS gene 649499 649747 0.86 + . g143 Scaffold_4 AUGUSTUS transcript 649499 649747 0.86 + . g143.t1 Scaffold_4 AUGUSTUS start_codon 649499 649501 . + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_4 AUGUSTUS CDS 649499 649747 0.86 + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_4 AUGUSTUS stop_codon 649745 649747 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MVAPARGRSTTRIDSPILQAIARRTGKQPQRCAASESPRDPPPHFDLDAGDHDDQEPPVDPNDPGADNDNDNLDDNSG # GLPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 Scaffold_4 AUGUSTUS gene 653737 654048 0.74 - . g144 Scaffold_4 AUGUSTUS transcript 653737 654048 0.74 - . g144.t1 Scaffold_4 AUGUSTUS stop_codon 653737 653739 . - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_4 AUGUSTUS CDS 653737 654048 0.74 - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_4 AUGUSTUS start_codon 654046 654048 . - 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MSGQELDGRSVRLDYSQPRDSAGGGRGGGRGGRGGFGGGGGRGGFGGGGGRGGFGGGGGRGGFGGGRGGGDRGRGGRG # GRGGPRGGNPRSGGIVPHESKKITF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 Scaffold_4 AUGUSTUS gene 654083 655576 0.76 - . g145 Scaffold_4 AUGUSTUS transcript 654083 655576 0.76 - . g145.t1 Scaffold_4 AUGUSTUS stop_codon 654083 654085 . - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_4 AUGUSTUS CDS 654083 654675 0.76 - 2 transcript_id "g145.t1"; gene_id "g145"; Scaffold_4 AUGUSTUS CDS 654746 655240 1 - 2 transcript_id "g145.t1"; gene_id "g145"; Scaffold_4 AUGUSTUS CDS 655393 655576 1 - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_4 AUGUSTUS start_codon 655574 655576 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MGKSDKKVSKKAEKADTKVVEKATDKKAGKTSKAIKSKAAFKQTPTSSKDILAKAVNSIFYFAANSICFQAKAPASSN # ESSEDSSSEDEKPKAVQVKKALAAAKKGSSSEEDSSDSDSKPQSKAKKPTPAAKLSKTAPSSSSADSDSDTSASDGEGAKKPLGKKAAVTASPAEKDS # SSESESDDEEKEDLVAAAPTKRILHRVLPTHPLMKVLRRKPLPQKRPRMNLSFFQHLLRSLTFIEIPVLGKRKATEDTQAPPKKVKLANGEASPAEEE # VKSIFVGQLSWNVDNDWLGQEFADCGEVVSATVQMDRNTGRSRGFGYVHFTSSDAVTKALEMNGKEIDGRPVKVDKSTPPNKDSVREKRAQTFGDQTS # PPSHTLFVGNLSFSANEDSVWEFFNDYGVKTVRLPTDRETGKPKGLWLCRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 Scaffold_4 AUGUSTUS gene 661465 662262 1 + . g146 Scaffold_4 AUGUSTUS transcript 661465 662262 1 + . g146.t1 Scaffold_4 AUGUSTUS start_codon 661465 661467 . + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_4 AUGUSTUS CDS 661465 662262 1 + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_4 AUGUSTUS stop_codon 662260 662262 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MLLGNNKKNICKLESTVDKLRAANAAAGLQQNELQIELDTLRQNASNLESSSEKLRIQNSSLAEERTNLQSSLDRYRH # DSSKLKSDVDIRISEISSLRERVGSLQEQNSDLARLKEERTLLQSTLTKKELENAVLYSEKTSLQKSLEKLLDDLAQLRQTTEKNRTELSEMLEQRLL # LHTTIEGLQEDMKLQMQARDEASKEYQANLIKQEEATERLLSAVTKRAETAEQGLGELTRELTSRIASMEIQLETVNVVPVRVVNRKVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 Scaffold_4 AUGUSTUS gene 662699 663061 0.43 + . g147 Scaffold_4 AUGUSTUS transcript 662699 663061 0.43 + . g147.t1 Scaffold_4 AUGUSTUS start_codon 662699 662701 . + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_4 AUGUSTUS CDS 662699 663061 0.43 + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_4 AUGUSTUS stop_codon 663059 663061 . + 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MWMSSPLTDFNAPILAANATNATDIDSTLPLAFSQPPEISLPPVPPTQGARPSRSPKTPTFAKLEEDISDFDDIPLTK # LGKRNRPASPSNKATQDTSARPARRGVRSPIYSCCLVSDVRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 Scaffold_4 AUGUSTUS gene 665063 666730 0.87 + . g148 Scaffold_4 AUGUSTUS transcript 665063 666730 0.87 + . g148.t1 Scaffold_4 AUGUSTUS start_codon 665063 665065 . + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_4 AUGUSTUS CDS 665063 665226 0.87 + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_4 AUGUSTUS CDS 665305 666730 0.9 + 1 transcript_id "g148.t1"; gene_id "g148"; Scaffold_4 AUGUSTUS stop_codon 666728 666730 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MTLTSPSLNASILASSIPLHSDNVKYLAYEGDHTAVWDVRRKIIEEDEANHTEIFNPNSKPLQDQRLVKVFESTIVPR # YLYPCSEECSFHDTPCINCHSPDYHSTYPAARYLPRRPWRRPWHAFLDAVRAALIRGVNYNNTASDETQKHWALALKNGFIVANMTMRPNSDEWVTSG # WEQTRPLLYVHVQIHPTLDPSPRLIVHPTVLQTPYCTLGQRPIAGTALTLLPHGTPAYFVAAYSGPTSALTAQFRNASVALLWMDGKVPIARRGTAEA # EERLRMWVKYVIVFIPVHTGSEGHKGLTIIYPSLLALAIPPSVRPTMNASLLPTLPAPLQPSPMVPAAIVSGTPSVATNGALSSPLAGPRSAYQFPPP # GPSYPPATANTFPTLNSPVVFAPGLNRNQPPPQRQQQLQPPLYSQAANNSGNIGGTGTNAGPGTPFPLSTSAPSTLASPFTQSHSVSPSMDSHTNRSG # TLSNNDLLRAHRVASTASRLFALASPSPVNTPAAVPTPGVPTPGTVSVPTPGGRSSPCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 Scaffold_4 AUGUSTUS gene 666800 669865 0.9 + . g149 Scaffold_4 AUGUSTUS transcript 666800 669865 0.9 + . g149.t1 Scaffold_4 AUGUSTUS start_codon 666800 666802 . + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_4 AUGUSTUS CDS 666800 669865 0.9 + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_4 AUGUSTUS stop_codon 669863 669865 . + 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MNIPGSTTSTLHQTAAEVSAYVEYVAREREKERERLKEVQAQRNRVTSSSSVANSGASTSASSNSNFGLRSVPPISIP # PSIPPPFTGAIMHSGTDAQLFYPSPPTNPPSVSAAGVAVSPTAYQGTALLPQIPQGLPSMHDASVASSRISPSVSGTTSEVNKIVEGIMDISTIEMSH # DTTQGPLPETDASGTDIDNGIVNTGLPLTNVSAPPLVTTERLSSAPMTAPEPIVRSAPATNSDPTSGWTYFGSEGADFDGLGMLGNIGMNGIDNLTGN # GMTTDNVDMTLFGAGGGNTFNFENLDSFGGGMDWNMDSTFSFGSGLTPSTSTSDQVTKSSTGVHTGMYADTRSTNTSFSSFQSADVFSQPMPPPTAPA # VTAPTQTNASGTQQLGGGPGSGLGIGMDFEADFTDDDFSFFDNKASNTVNPVEPTSDSLILSASAPPNAATSPDPLAFLNSDDSSSFFSSLGLAPPLP # IGSAPTPGFYGYPSHPTPFSISHPTPGGPTGFTPLTVDVEVEVEMNPGLPSPPEETNHPFARAYEVQLEQGTETSPFRLSSVHTPPPTLTSYSPPAPS # SPSKDKKFAPIPFAKSHSQADGKYRVAGGKFALLRNSGRWLHKKYRPAYFTLDAPRRARAASWTGIMQGESSNGCFGEQVDLSEKDSRINGPSQGRWC # LPSPPVDSDTTDSSAGESDDDQPHTSLEPPPPPTSISDASPPPPGSTDISMSSSYTHKTSRPGWRPRYDRATDPRIGVVRRLTGSKQRSKKRLKRAGW # SEIHTRPKWLKDWEDDTGRHIDVANTGQSQEDEAEDDEDEDGGTADEEQDTDGGTLEELDDTPDMKASRRSGGREWSRSATPLPAYLPPGPSLVSTCF # HWVHLASMAVGDNVSQTSTIEGMIHDSAPTPIHLNRGVGTTHGGMSSILLSVSVPVSILRTNVAPTPVSPVALAGSSAASFPTPAPTWPQALTPSADI # DFIPEEEKAWSLETAVNCIAQECVENPFWADAWKSMDEFMGNSKNGAVNQKARDVGMDVVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 Scaffold_4 AUGUSTUS gene 674895 676547 0.57 - . g150 Scaffold_4 AUGUSTUS transcript 674895 676547 0.57 - . g150.t1 Scaffold_4 AUGUSTUS stop_codon 674895 674897 . - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_4 AUGUSTUS CDS 674895 675079 0.85 - 2 transcript_id "g150.t1"; gene_id "g150"; Scaffold_4 AUGUSTUS CDS 675351 675530 0.82 - 2 transcript_id "g150.t1"; gene_id "g150"; Scaffold_4 AUGUSTUS CDS 675899 676547 0.72 - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_4 AUGUSTUS start_codon 676545 676547 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MDTSQLPNYQCLAIDDPSALSDKLIAVGRAPSTGYIIGFISSVLVKIPDFSEGEVLHIGLACLSPSSKLETVSGLAKH # LMASIVYGYLLKNPSTNKVWVTNRSSNLSTLGRFAQTVDEVFPSPSHPTSPPTSLHVTIANEIIGSSSRSLNVTPGELDPRTFIVRKSLFHAGKDEDQ # RNDRYHYSNPEMWEFYRGYLDENGSREDESVILQVGHISPPSQNTVSAFKADASPESGRGKYTGNGMRRMLGDGGSIEFDTSREALRSVGTADGVTEA # ARENDPSPTTSTVTADEAKPAGTEKGGKTTIPVSKADLDSGILLSGSASPDINESWVGVRVKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 Scaffold_4 AUGUSTUS gene 680456 680926 0.55 + . g151 Scaffold_4 AUGUSTUS transcript 680456 680926 0.55 + . g151.t1 Scaffold_4 AUGUSTUS start_codon 680456 680458 . + 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_4 AUGUSTUS CDS 680456 680926 0.55 + 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_4 AUGUSTUS stop_codon 680924 680926 . + 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MLVSQSLKFISTALRSGFYKSSIFSAPGIIPTLIEGIVVPNTTLREHDIEQFEDDPLEYVRLDLAVSAAGTDTATRRQ # SAMDVLQTLVSSGYEVEATEIVGGWINKGLTEYQSNKEVNWKAKDTAIYLLTAVATRGVTTQVLFQNILCICLLTCTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 Scaffold_4 AUGUSTUS gene 683734 684138 0.81 - . g152 Scaffold_4 AUGUSTUS transcript 683734 684138 0.81 - . g152.t1 Scaffold_4 AUGUSTUS stop_codon 683734 683736 . - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_4 AUGUSTUS CDS 683734 684138 0.81 - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_4 AUGUSTUS start_codon 684136 684138 . - 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MGPGRTGVKGVIRDRDEAEEINRQRRITEMDEIRRKMEKSSLGGKTFLEEEREKGGDEKVDELVAKEREKENERRDVF # GRPREGKFGHLREVDVHNYLNAVEKEEKGVWVVVHLYEPVSNLLLNQELLLTFIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 Scaffold_4 AUGUSTUS gene 688573 689415 0.87 - . g153 Scaffold_4 AUGUSTUS transcript 688573 689415 0.87 - . g153.t1 Scaffold_4 AUGUSTUS stop_codon 688573 688575 . - 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_4 AUGUSTUS CDS 688573 689415 0.87 - 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_4 AUGUSTUS start_codon 689413 689415 . - 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MRGDPHKLVEGCLVAGRGMNANAAYIYIRGEFYQEASHVQQAINEAYADGLLGPNACGSGYAFDVYLHRGAGAYICGE # ETALIESLEGKQGKPRLKPPFPADVGLFGCPTTVANVETVSVAPTICRRGGAWFASFGRERNQGTKLFCISGHVNNPCVVEEEMSIPLRELIDKHCGG # VIGGWDNLLGIIPGGCSVPVLNQQKSGEVLMDYDSLKDAGSGLGTGAVIVMDKSTDIVSAIARFSQVLSRVLEPCQTLTEREFGSFTNMSRAVSVLLA # EKVQPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 Scaffold_4 AUGUSTUS gene 708165 708584 0.96 - . g154 Scaffold_4 AUGUSTUS transcript 708165 708584 0.96 - . g154.t1 Scaffold_4 AUGUSTUS stop_codon 708165 708167 . - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_4 AUGUSTUS CDS 708165 708584 0.96 - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_4 AUGUSTUS start_codon 708582 708584 . - 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MCPALNTAVDSYEQTKYPDAFAAAEAVDFDLFISFDMTYEWEATDMVSLVKSYATSSSYYHWEGKPLVSTFGGDSDTN # DFWNTFKTTLANEGISISLAPAFIDYRDPDEAAQMFSNFVAIDGFFNWWSWWGRHTYLSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 Scaffold_4 AUGUSTUS gene 712613 713068 0.31 + . g155 Scaffold_4 AUGUSTUS transcript 712613 713068 0.31 + . g155.t1 Scaffold_4 AUGUSTUS start_codon 712613 712615 . + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_4 AUGUSTUS CDS 712613 713068 0.31 + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_4 AUGUSTUS stop_codon 713066 713068 . + 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MYFSRVARIFEDAEVSKPDIKRMIDACGRGGSHFQHSQTNATVTAPNIDTGINMKMPLPNNTLSTTAGADLRSTSAPN # LAAAASVVDLPLPLPEEWSLPLVSSSLIRFKLSWEAFIDSLMREWKTLNVVSALLLSYGLLFFDDIHDLQLQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 Scaffold_4 AUGUSTUS gene 714192 714869 0.57 - . g156 Scaffold_4 AUGUSTUS transcript 714192 714869 0.57 - . g156.t1 Scaffold_4 AUGUSTUS stop_codon 714192 714194 . - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_4 AUGUSTUS CDS 714192 714869 0.57 - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_4 AUGUSTUS start_codon 714867 714869 . - 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MCPNPNLVDNDPKTLAHFVPLDPVSRRAFALSCEHLPPAILNHSLRVWIYAATLSGLEKLSSSRLPLLFTACILHDIG # ATPAFSNLDSEKLQRFEIEGADAAASLLREAGDSSISQDDIEEVWRAIALHSTPQIPERMAGLVRIVRLAVLSDFQRGTVAGKEGLQEETEAHFERLE # IEKVLGDAVVQQTLCSRVPEAKAPAASWPHDLLRAHREYPEWEGVNKGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 Scaffold_4 AUGUSTUS gene 718356 719484 0.11 + . g157 Scaffold_4 AUGUSTUS transcript 718356 719484 0.11 + . g157.t1 Scaffold_4 AUGUSTUS start_codon 718356 718358 . + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_4 AUGUSTUS CDS 718356 718401 0.15 + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_4 AUGUSTUS CDS 719165 719484 0.23 + 2 transcript_id "g157.t1"; gene_id "g157"; Scaffold_4 AUGUSTUS stop_codon 719482 719484 . + 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MFARNAARAFTAPSARGHSGPTIVPLLSQVAKGKGLQGETYEQLVHRIQFGGDEVVKAKDGAGSATLSMAYAGAKFTN # SLLRGLNGEKGVITPTFVKNPLFADKGIDFFSSPVELGVCSQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 Scaffold_4 AUGUSTUS gene 726525 727253 0.88 - . g158 Scaffold_4 AUGUSTUS transcript 726525 727253 0.88 - . g158.t1 Scaffold_4 AUGUSTUS stop_codon 726525 726527 . - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_4 AUGUSTUS CDS 726525 727253 0.88 - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_4 AUGUSTUS start_codon 727251 727253 . - 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MQSLPATEFATSFIELDSVIDHFKTTLKLPISNDSNESILFTTHMIAHLATILLHSKIATMAPTLDSSLNSFPLKASE # SGQKRLNAAVAIAEFSRKRWSLKRNSGFETSTKIADPNPNPFLGSLWLAVGQVLIEEVNLVRVLSNGTGFTLNVELDSDENSPSEREAELMDKLECVF # ESAQMSRVYHSPLAGQCVSNYSCFNISPWNMSVDYLFNKLQKIHRSRLHNVDDALPNQANNQMGKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 Scaffold_4 AUGUSTUS gene 727428 728279 0.5 - . g159 Scaffold_4 AUGUSTUS transcript 727428 728279 0.5 - . g159.t1 Scaffold_4 AUGUSTUS stop_codon 727428 727430 . - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_4 AUGUSTUS CDS 727428 728279 0.5 - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_4 AUGUSTUS start_codon 728277 728279 . - 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MGVRLEAFFRHATDLNFFLHTPRFRRAVLLPVDSPGRPCQGLISVVLLLGFSLSERYILKPEESHSHNNILNDGVFAS # ASVSSQEALYLSRAQIDVAGILSSSHPDRIVHGIQAEILLSTYLFRSGRILEGKYHLSAATSIAFGAKLHKIRSLNGDRDILTSAALPWVVCLTSSTS # KFENRLNVDSAKDPEPLFPHSVDPISEGERINAFWTVITMSNCWALAADSSPNPILERYMEDIDTPWPMDIEDYEKVSIYSPGPSNLINTSPVMRIYL # RTIWIVLPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 Scaffold_4 AUGUSTUS gene 742900 743955 0.88 + . g160 Scaffold_4 AUGUSTUS transcript 742900 743955 0.88 + . g160.t1 Scaffold_4 AUGUSTUS start_codon 742900 742902 . + 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_4 AUGUSTUS CDS 742900 743955 0.88 + 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_4 AUGUSTUS stop_codon 743953 743955 . + 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MNRVPPPQFLSNLHDLEQNWQMTDELMAEIERADLQQAQGLAAAAHIYPSYPVGSGYNATNVKTDSSLRDPGVERVRA # AEKSSPKAVDGQLGRRPSVRESRESPKARDRPSFSPNQSQTPERRKSPPYITPLGSPGEQYNQYHHEPASVARRPAHDSRPNLTLATQTPPLQAISAR # TPDKSLPLQEEPEEEVPVAIKAEVNGREHSRYMHQIHQQREPELGSPTPSSDLNPEGSYIQDGRSSRAAIRPEDEDTLYEKSDKQESSNDGSGTPRSP # SAGIPTAENTEQNRFRPAQQTQPRGAVPAPHRGRGRNGSTDQLGLRGLDTSLFEQVEQARTSEMPPSMQKLLNRYQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 Scaffold_4 AUGUSTUS gene 743996 744994 0.75 + . g161 Scaffold_4 AUGUSTUS transcript 743996 744994 0.75 + . g161.t1 Scaffold_4 AUGUSTUS start_codon 743996 743998 . + 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_4 AUGUSTUS CDS 743996 744994 0.75 + 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_4 AUGUSTUS stop_codon 744992 744994 . + 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MHPDDFQGLMDDPTSAYIQAYLRSPRPDAPIPPTPHSQTSPPSPSPMLSGRYENTKDSYPPFSPVAPAGSPYPYPFTH # VRRNMSYSGHSQTNSNLGLNPAVIQEQFVKQFQMYAQNHSGNITDSTLSPSSTPYPPTYNPWAYWHTQRLMGGQIPDTVTRQSSPSHEPIPLPPHPPM # VSLRRKSDSSNLRAYRPAPKANRKPPPRVDSTQPRETSPEPSTSGEETAGEDTRFAVSEEGNWVNGTTSAIPIPIPIPIPIVDDTASAEWVDEDEEED # EEDLLELEYHPTYVNNVEKRRRRWETKWDALLQAVSENFVKSSSKGHFLSKWVQFRQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 Scaffold_4 AUGUSTUS gene 751274 752457 0.41 - . g162 Scaffold_4 AUGUSTUS transcript 751274 752457 0.41 - . g162.t1 Scaffold_4 AUGUSTUS stop_codon 751274 751276 . - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_4 AUGUSTUS CDS 751274 752151 0.46 - 2 transcript_id "g162.t1"; gene_id "g162"; Scaffold_4 AUGUSTUS CDS 752227 752340 0.52 - 2 transcript_id "g162.t1"; gene_id "g162"; Scaffold_4 AUGUSTUS CDS 752436 752457 0.65 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_4 AUGUSTUS start_codon 752455 752457 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MLVDIEDIDYDDDDDDDDYFWDSTGSDDESEEDDFGDSCDEDGGRLERLCNLFELEPSPALYLAILAVSDQPGKTTAE # LMKTVSRIATNSSSTFAAALAIYAIECEALKISKLLDTHSHLLRSQDVKPYQAAVIVLIQETKYRSRAIKIIEKELQETVHSLRLLVQSSFCGLKVES # NKTELRRILKLQMASQPRIDRVNNWVDAVITPSSALIHPVAFAAAMVMGFPPGLEDGDDNDVMSYLDLDPDDPDLEDLREEFRPQLRDRFDGWVSIAL # GFTGGQTLLSKLYIKMAEEMPFLSTADVTQEMLNRYVLSILSGGLIIILLRLLFALIYCLLTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 Scaffold_4 AUGUSTUS gene 753727 754645 0.52 - . g163 Scaffold_4 AUGUSTUS transcript 753727 754645 0.52 - . g163.t1 Scaffold_4 AUGUSTUS stop_codon 753727 753729 . - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_4 AUGUSTUS CDS 753727 754169 0.69 - 2 transcript_id "g163.t1"; gene_id "g163"; Scaffold_4 AUGUSTUS CDS 754233 754433 0.71 - 2 transcript_id "g163.t1"; gene_id "g163"; Scaffold_4 AUGUSTUS CDS 754555 754645 0.56 - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_4 AUGUSTUS start_codon 754643 754645 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MSYRPGLPNVLHNVNLSIDAGEKIGIVGRTDEYVCFQVVSPKSYLFRIRHSVNISEIGLKDLRTKIAIIPQDVCDGAF # LENIKIADSMLLYVQPSPYWTVRSTLDPFSVYDDVRLWDALRRSFLIEDRQSDDSATDIDESSNGYITLDTVIEPEGTNLSLGQRSLLSLARALVKDS # RVVILDEATSVLYSIVYLYLINNLSSASVDLQTDKRIQDTIRSEFQDRTLLCIARKFSSSTMLDVAKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 Scaffold_4 AUGUSTUS gene 759137 760091 0.91 - . g164 Scaffold_4 AUGUSTUS transcript 759137 760091 0.91 - . g164.t1 Scaffold_4 AUGUSTUS stop_codon 759137 759139 . - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_4 AUGUSTUS CDS 759137 759581 0.96 - 1 transcript_id "g164.t1"; gene_id "g164"; Scaffold_4 AUGUSTUS CDS 759847 760091 0.93 - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_4 AUGUSTUS start_codon 760089 760091 . - 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MAGNNGNLKASNDDFREQSLSHSEKIGDVDSTANTKSQLEEEDISDKHDSQTHSKNENTGKSIELDAGDLKVRIRGRW # WQFCGVVKGSQKLKVLGYQRTLQASDLWKMDHSQESGYLSEQLDAAWARRAEAANEWNIKLTSGELKPGILKRILWQIQATLKLGSTVKGSRRERIEE # LEIQWREIDGRKEPSLAWSVNDVFGNMFWVAGIYKVNATYLMTALSEYLLGIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 Scaffold_4 AUGUSTUS gene 761165 762002 0.34 - . g165 Scaffold_4 AUGUSTUS transcript 761165 762002 0.34 - . g165.t1 Scaffold_4 AUGUSTUS stop_codon 761165 761167 . - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_4 AUGUSTUS CDS 761165 761677 0.63 - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_4 AUGUSTUS CDS 761784 761809 0.42 - 2 transcript_id "g165.t1"; gene_id "g165"; Scaffold_4 AUGUSTUS CDS 761951 762002 0.57 - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_4 AUGUSTUS start_codon 762000 762002 . - 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MALFNASIVLLVNVWRGHGSKQAVSSCPPDTGPCLMKRSLEAASDDTTEDSSSVRARGSNTPEEYCDRQISSDHNSMD # TATLPRWMQSPPFQSSGTHNDTDFESMSLLPTHSSELGSLPIYESFTDWSMDEQWSFDAGTSSSNSQQTWPNADPHIHASMTMQTQSATSLLHNRSST # YSPTLVFDSLNTTSLGTFIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 Scaffold_4 AUGUSTUS gene 766093 766704 0.46 + . g166 Scaffold_4 AUGUSTUS transcript 766093 766704 0.46 + . g166.t1 Scaffold_4 AUGUSTUS start_codon 766093 766095 . + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_4 AUGUSTUS CDS 766093 766704 0.46 + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_4 AUGUSTUS stop_codon 766702 766704 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MRIKLRHISTEKMLHSHDIRPPVSEVEFQNEVSAYGAPGFQGDANDDWILEIDEVASRDRRDREAVKRLRTLRTKFRL # RHALTGCYLFSHKVKLPEWGFEQQEVTCNKNAVRANSLWFVETAMHPDRKYRPCLAFWNFSVILSVITVPADAPKVNYRLPGFFAKFLELQQVMWTTN # AGLTDRHLFDSRPDAWPRLRRGIVSRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 Scaffold_4 AUGUSTUS gene 767719 768015 0.29 + . g167 Scaffold_4 AUGUSTUS transcript 767719 768015 0.29 + . g167.t1 Scaffold_4 AUGUSTUS start_codon 767719 767721 . + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_4 AUGUSTUS CDS 767719 768015 0.29 + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_4 AUGUSTUS stop_codon 768013 768015 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MEQHDNNKVAEGEETVGEGKYIGNTAKNDKLQMNAEKEPEKVQIQTSSPVPPEEDVEGMDPVILPALNDEKAKENGPL # GEADAAADKVAKELFPEEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 Scaffold_4 AUGUSTUS gene 769573 770902 0.65 + . g168 Scaffold_4 AUGUSTUS transcript 769573 770902 0.65 + . g168.t1 Scaffold_4 AUGUSTUS start_codon 769573 769575 . + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_4 AUGUSTUS CDS 769573 770127 0.91 + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_4 AUGUSTUS CDS 770261 770282 1 + 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_4 AUGUSTUS CDS 770409 770902 0.72 + 2 transcript_id "g168.t1"; gene_id "g168"; Scaffold_4 AUGUSTUS stop_codon 770900 770902 . + 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MSLPKGSPGRPSEGLISTVYLLGFHLSGLNVGDVQQREQAYLSRALLDVANILSSPHRDRTVHAIQAEILLAGHFFST # GRILEGKYHLHAALSITIAAKLHKIRSQNTDPGFPGMSSSDIFGNISQLDVPLDQIAEGERINAFWTTFTMSNCWAVAADSPQNFIVESFGPTVDTPW # PLDMDGYEQEIILSSPYMWQQRAEIFSVQFTALDNLLSSFNSSLIPLSQNAPASSEYFSYAFVTHLTTKAAIITLHSKLRDISSESAEKVLSAAEACT # DMIAGNISSDSTAHANPLLPSLWMTVGQVLIEELRRLRSEHQFRAVARAPGREEAVDVKLQQVLTTMRHTPAHSPLNGEIGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 Scaffold_4 AUGUSTUS gene 776412 776792 0.9 + . g169 Scaffold_4 AUGUSTUS transcript 776412 776792 0.9 + . g169.t1 Scaffold_4 AUGUSTUS start_codon 776412 776414 . + 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_4 AUGUSTUS CDS 776412 776792 0.9 + 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_4 AUGUSTUS stop_codon 776790 776792 . + 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MSRRSLRIQEKTVASKGANAISKNSSATATKAGRKRVKEPPSEGVAGREQEKGRPPRKKARKNTSNTAQPLSDVEDEE # DEDEDATSTKKKQRMPKQFRKVRGKLGLLERLAKDVPLDVIFEVCSAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 Scaffold_4 AUGUSTUS gene 783276 784553 0.46 - . g170 Scaffold_4 AUGUSTUS transcript 783276 784553 0.46 - . g170.t1 Scaffold_4 AUGUSTUS stop_codon 783276 783278 . - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_4 AUGUSTUS CDS 783276 784553 0.46 - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_4 AUGUSTUS start_codon 784551 784553 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MFTLLTIPEIEVAGQTFESPLIGASGDNGPFYVPTDNSPITDVTSENMFCGSVATAATSTPSIDLSQGNTISFYWESG # YSTSNWPHNTGPIFLYMAKCDSDCTSQTASSTNFIKIEQQGFVNGAWAQAALNTGSPVTFTIPSDLASGNYLIRHEIINLASTDENFPACSQFAITGG # SNTYSSAQTAQFPGAYSATDAGLADAGSAIYSVKTNAEYTFPGPDPVLSSDGSDSSAASGSSSDSNSASSSSSTVASTSSSVGATATVATGATSSSST # ATGVVVLPSSVRLASASVTLATTTSSVSVSAVTTPAAAAGPSSSSDIDTCATQWTTCNAAYMSATASDNSTTVAYSCQTAYVNCVAQAESAVESSSVA # TAVTSEAASSSSATDVMATIDTAAATSTPVVNSRAFANHLRRHHAGVSRLDFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 Scaffold_4 AUGUSTUS gene 787297 788769 0.66 + . g171 Scaffold_4 AUGUSTUS transcript 787297 788769 0.66 + . g171.t1 Scaffold_4 AUGUSTUS start_codon 787297 787299 . + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_4 AUGUSTUS CDS 787297 788569 0.66 + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_4 AUGUSTUS CDS 788621 788769 0.66 + 2 transcript_id "g171.t1"; gene_id "g171"; Scaffold_4 AUGUSTUS stop_codon 788767 788769 . + 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MLIYDKLFITSKLFSFATDYKKVLKSVDSSKVEAEIDLPTASESPAPKRKHSSVDDYAASNDCSSVCASNSKRSRVLV # VSPLPATLRNSVSPTRSRRKDVHDSFDSFLAKSVQCTPLVNNDGLPIRPGIKTAESHVDANHSKIGVVEPAPISALSFVARSGSEVRQDCSQPFSEPP # TGSASSPHIFPMSSGPIHLSPVNQYSSLPLPKIHAFSEREFTDDSAETELSEDEVDELFSDEGDLNSKLDEEKAKNDSKGFRSNPSTQTERSSCSTEI # TKETDKLECHKDTVEERRQGLQASNRKFTPIIIESDDDDTNFLQGTVSKSTNVPSPDAISNGRRDTLTDPGKIRQRNEKLSSFIDLTTLDDFGENDPG # VMDFPAGKQRIQSDSRGDSPDIVDLSLEEYQANVQASQRHSRENRSLNRKNRNSGKGLKSTPSPQSSAQLSVASSMNGQNPNAVEITNLESSNLPAGK # LIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 Scaffold_4 AUGUSTUS gene 791477 791845 0.97 + . g172 Scaffold_4 AUGUSTUS transcript 791477 791845 0.97 + . g172.t1 Scaffold_4 AUGUSTUS start_codon 791477 791479 . + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_4 AUGUSTUS CDS 791477 791845 0.97 + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_4 AUGUSTUS stop_codon 791843 791845 . + 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MFHSTEQKWRSNSAVWGNSRTEAGEEERPKTDEENEVPLSRLKVALELSGTAGAVGPRAEEEGLGKEAAIEGSLDLGL # SDSGVPSGTAVAVSTGAKGVGRTVSEVAIVVSKTGVAVDADKRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 Scaffold_4 AUGUSTUS gene 792268 792772 0.44 - . g173 Scaffold_4 AUGUSTUS transcript 792268 792772 0.44 - . g173.t1 Scaffold_4 AUGUSTUS stop_codon 792268 792270 . - 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_4 AUGUSTUS CDS 792268 792609 0.46 - 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_4 AUGUSTUS CDS 792671 792772 0.45 - 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_4 AUGUSTUS start_codon 792770 792772 . - 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MSSIESTDVDLVTTLVRQQGEELLKVRKDLEESKKLYTTAVDVVSTSKFRVENAIRTSSQWQSKFATMISDLAFLQSE # HEASLAELKATSTELRATLGLFNSRDVPTTVSAPESPISNANPAVLATPEDPVDGYTSESSIVSWSFKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 Scaffold_4 AUGUSTUS gene 796947 798274 0.45 + . g174 Scaffold_4 AUGUSTUS transcript 796947 798274 0.45 + . g174.t1 Scaffold_4 AUGUSTUS start_codon 796947 796949 . + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_4 AUGUSTUS CDS 796947 797518 0.45 + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_4 AUGUSTUS CDS 797632 798274 0.99 + 1 transcript_id "g174.t1"; gene_id "g174"; Scaffold_4 AUGUSTUS stop_codon 798272 798274 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MNSSPSGQPRNPESNDTDAPRLKIKIPNILGSMAIKPAAGSPPIPLRRSSRNHRGSEPSGSEYQQSEKSMMDEEPEVE # DEEEEEEAPVIMKTQRGRMIQKKSYVESDGDEDGEGELEAQDDDLLNFKEEVDAPGRRITRGSKRASASAEDTREGLRRSTRSRNLPDFVVPDEGEEE # YDDDEADNRPHTRSRHNQKEDDYNPGSSSPHSADADGSDDDNAPGTDDLDLELEPPPEPEPEPEDDVSGPDGTGNGKPYALRQRQRINYAIPPPLEDL # SRPPAHRSNNANNNRLYNRAGGGRGVGGGYHGGRRKGGLGWSASGAELGKWMGLPADDSDSDVPTRTPRKPFGGVGMTGGFEGAVAGGGGLLSGDLAA # AGTPSNLGKVDDSSKCLVFPATCVILIFFHFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 Scaffold_4 AUGUSTUS gene 798620 799333 0.77 + . g175 Scaffold_4 AUGUSTUS transcript 798620 799333 0.77 + . g175.t1 Scaffold_4 AUGUSTUS start_codon 798620 798622 . + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_4 AUGUSTUS CDS 798620 799333 0.77 + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_4 AUGUSTUS stop_codon 799331 799333 . + 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MTVLAFFMRKGADALSKWVGEAERQLRLLFSQARSSAPSIIFFDEIDGLAPVRSSKQDQIHASIVSTLLALMDGMDGR # GQVVVIGATNRPDAIDPALRRPGRFDREFYFPLPDLIARERILSIMTKGWIGWGSGEEDPRVKARVNGLAELTKGYGGADLRVGYVVRLYIPEMLILL # LFCAQALCTEAALNAIQRKYPQIYKSEDRLLLQPETISVALRDFMVAIKSMCVLFFVERCH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 Scaffold_4 AUGUSTUS gene 800556 800885 0.87 + . g176 Scaffold_4 AUGUSTUS transcript 800556 800885 0.87 + . g176.t1 Scaffold_4 AUGUSTUS start_codon 800556 800558 . + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_4 AUGUSTUS CDS 800556 800885 0.87 + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_4 AUGUSTUS stop_codon 800883 800885 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MAAAASSAQSDPVAQAVVSTIEIMSDGAMDVVQESIQTQPQRDPSLNGQVNGAEVPPAGFDIDPSQTQSHPKPLDAVQ # TTPHLPSPRHNPHSTTWILKRCTSFFTKIAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 Scaffold_4 AUGUSTUS gene 800936 802627 0.42 + . g177 Scaffold_4 AUGUSTUS transcript 800936 802627 0.42 + . g177.t1 Scaffold_4 AUGUSTUS start_codon 800936 800938 . + 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_4 AUGUSTUS CDS 800936 802627 0.42 + 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_4 AUGUSTUS stop_codon 802625 802627 . + 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MYSHRDPDRHYKAQAMLTATEVSMQDNFDLILREECERMAGRVRKRRMEYKMKRKEEKEKEKEKEREKEGVEAQAPPF # LNGTRRSARNNGQRPELAITDPVALERKLKRQREGADGAVGDAGPRGEMDQDGARDAKRSRTFGDSNDRDPLDIITPITTPPRPGGVRFAPSVGSVNP # DHPHQPQYQSQYQPPMFDRFQQQYGSMNMNINQFQPSMGLMGQSSSSSHLQPPFYNPSIASGSNTNPYPRQNSFENGLINEQSGSFPSQQTTYSQQSF # SYSSQQDFSNQPQQQSSFPQQRFHPQSSFQDVTFQPQPQYHQQVPFPLQQQQEPPFYPQRPSSSYLPQLLPPPGPTGYQSSSNPTPVPYIMQNDNSMS # VDQPQPPSTPRGGGVAMLLNPVHPGEERERTVSARPSPAPQNSHQPSAPVPGDDGNPFLTVSDATRNVPNRKSASPLPQIPAHPTSILKSPAPPEKAA # SPMPIIERTPTPLPNFHVDTLLLEQLHASLRESTFGLTIEELEQLRATCLGCVWRHRTEWDRDALVRELQDVVSDFVAEISANANASDLDESP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 Scaffold_4 AUGUSTUS gene 804376 804717 0.52 + . g178 Scaffold_4 AUGUSTUS transcript 804376 804717 0.52 + . g178.t1 Scaffold_4 AUGUSTUS start_codon 804376 804378 . + 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_4 AUGUSTUS CDS 804376 804717 0.52 + 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_4 AUGUSTUS stop_codon 804715 804717 . + 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MVFQDLETVVQGSSKWDYIAKAMKYLRTKATESQLEFKFETGGEERWQKLLEKCGGKGSEQQGELKTSEVHTSSGSNE # ERKPSYGEFGKKGKMPTFTDILVGGSAGDATESKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 Scaffold_4 AUGUSTUS gene 814631 815335 0.46 - . g179 Scaffold_4 AUGUSTUS transcript 814631 815335 0.46 - . g179.t1 Scaffold_4 AUGUSTUS stop_codon 814631 814633 . - 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_4 AUGUSTUS CDS 814631 815335 0.46 - 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_4 AUGUSTUS start_codon 815333 815335 . - 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MVIGSFVKQSYWVTAISQEPMTPRAAALIGAFYAVASSLNTILFTNTATSVLGYASVAGDETRLPIQTLVGIGLYALG # MVLEWASELQRLRFKKDPKNKGRAYTGGLFGLARHINYGGYVLWRVGSSIAAAGWIWGAAVGGFHTYYFLKDGIPELDAYCSKRVSCSLVVPPQYTLL # TFCDISVQRAVERVQEGSSIQALSLYFVNELNFEPPRQPLYRYLLWLNTHLTKKLWAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 Scaffold_4 AUGUSTUS gene 816274 816816 0.55 + . g180 Scaffold_4 AUGUSTUS transcript 816274 816816 0.55 + . g180.t1 Scaffold_4 AUGUSTUS start_codon 816274 816276 . + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_4 AUGUSTUS CDS 816274 816816 0.55 + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_4 AUGUSTUS stop_codon 816814 816816 . + 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MAIGSFIKQSYWVIAISQDALPPRASAYIGTFNALANSLNTVLFANTATSVLNSVGGDETRLSAPTIVGISLYAIGML # LEWGSELQRFKFKKDPRNKGRVYTSGLFALARHINYGGYVLWRAGFAMAAAGWAWGAFIGGLHTYYFVKAGIPELDDYCSKKVGLLLESMYTIVFFLP # ICHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 Scaffold_4 AUGUSTUS gene 817338 817676 0.85 - . g181 Scaffold_4 AUGUSTUS transcript 817338 817676 0.85 - . g181.t1 Scaffold_4 AUGUSTUS stop_codon 817338 817340 . - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_4 AUGUSTUS CDS 817338 817676 0.85 - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_4 AUGUSTUS start_codon 817674 817676 . - 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MRSFTCARNDAHADDGIFAASDNNPDNILLQFTGTSVTSVELIDYGPPYTYLIDKNTDKQKIVSANEFNSGICSSSPK # ITILGGCLCSFQCMDSTVVTSSWWDVSVGSASYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 Scaffold_4 AUGUSTUS gene 821642 822178 0.95 - . g182 Scaffold_4 AUGUSTUS transcript 821642 822178 0.95 - . g182.t1 Scaffold_4 AUGUSTUS stop_codon 821642 821644 . - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_4 AUGUSTUS CDS 821642 822178 0.95 - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_4 AUGUSTUS start_codon 822176 822178 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MKVASTDVTSLEGINDRLWAGGRNGMILCMISFLDLDSDKFVGRHPGLPVLQISADPFGIEKYRRLGVVSVGRDELVG # LWDGLLALNWQDTELQKHEQSYSTFRELKVLIISWNCDSAKPDSLHGHPANINFFHDVLNSVDRPDIISFGFQEVIDLESRKMGEEHVDVCQVRCQGE # KR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 Scaffold_4 AUGUSTUS gene 823059 824370 0.57 - . g183 Scaffold_4 AUGUSTUS transcript 823059 824370 0.57 - . g183.t1 Scaffold_4 AUGUSTUS stop_codon 823059 823061 . - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_4 AUGUSTUS CDS 823059 823821 0.81 - 1 transcript_id "g183.t1"; gene_id "g183"; Scaffold_4 AUGUSTUS CDS 823907 824370 0.63 - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_4 AUGUSTUS start_codon 824368 824370 . - 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MDTPDIESSPTPAVKNLLSRFESLAVDNSATASQRKSLQVPMPPSPARAPSDASSPAVSPGLRTVSSSSSLKSSTSDT # NVSTKRPPPPPPPSSTRSYSRGLSPAPPSPSVSPLLRPVPIPNVLNTSVNRVPQHGLPHSPNVSINENEHEEGLTPTNVASNTPSRPITHSPKPSISS # MIDKPLAPPRVHTSSEPLISFDSPEEYHSQSSSNSMSDLDDPFSEDTTDSATDDPDSSTTAVAPPLPARKPHHHHHHQESTSSSSRNSSESDSGHLSS # YNGSASSSQSSILPPRPPPRPRALALPEPEVFISNSNSLNTPPPLPVRRSTVAQAEDLAAPRTPRPSARLAPLHHIVPILLRIHLAHVSVSDLDHPPA # ALLPHLNVNPLANFLPHPRGQSLWGTNCLLNVRNNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 Scaffold_4 AUGUSTUS gene 828313 828655 0.23 - . g184 Scaffold_4 AUGUSTUS transcript 828313 828655 0.23 - . g184.t1 Scaffold_4 AUGUSTUS stop_codon 828313 828315 . - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_4 AUGUSTUS CDS 828313 828590 0.86 - 2 transcript_id "g184.t1"; gene_id "g184"; Scaffold_4 AUGUSTUS CDS 828637 828655 0.25 - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_4 AUGUSTUS start_codon 828653 828655 . - 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MNKKAFSKVLSLSPQDIGDPINGDRGQWSSGVAKLTKNYWKLKGGFRRYSKDNIVMKKLNVPVGNNDMGEVKALKDVG # LYVDSGFARIGPMTDKFRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 Scaffold_4 AUGUSTUS gene 845997 848154 0.24 - . g185 Scaffold_4 AUGUSTUS transcript 845997 848154 0.24 - . g185.t1 Scaffold_4 AUGUSTUS stop_codon 845997 845999 . - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_4 AUGUSTUS CDS 845997 847184 0.38 - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_4 AUGUSTUS CDS 847408 848154 0.24 - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_4 AUGUSTUS start_codon 848152 848154 . - 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MAENDSLQLVWQIGEIWLKPVPVSFKDTRKGGENEMADPETDTVSFLADKDSHADVKYQQKQVFYRRMLGWADEQRAS # ENVFSKTVLLPITLSDKKMDNIEMEDASNHQNPTSTPARKIRTRSSTISERKCPTSAKRTLNEKEDREDVRISKKGRLAKPSRGFPSTPSTPRKSRYS # NRNRNAVETIDLEPEISAYPSLAFEVQVADGQDFLLDFISSQIAALRHDSRVDCDAKLSSNKDDNEIADIAFRKVRNTSNTRSMTLDTLRSDSDTYTE # TTTPIRGRSVAPATAPRSSSNAKKLIDIRARSVPPLSTRSMRISSSLNAITTKITTSPSLDMSANEAEPMHGNHPNTVNSDANDQSTFIHIGRQIMFE # RLAQEFGKTVDEISGIYSDLGNLDNTRKVLIRLSGMGTPLGLQTSSLLGHSASRSDVSNFFPGSRQESLSVASSVKSNRNALARSQSVAPPSRSPSLY # SSTASPSFLSIPTRNESRSFLTHPQPWSPKKRSISSLISPSPSIASFSKLRHVNNSENDSSGGGNSADESDVLLERKKRSMQKRSTKKKRKTVNESSS # LIQASTSSSSSSAQSLRKTNLTSTEREIENDTEAEKARNLGIATGEQQYEGSHVYMHKHRLDSLARSIELILRNGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 Scaffold_4 AUGUSTUS gene 867019 867435 0.73 + . g186 Scaffold_4 AUGUSTUS transcript 867019 867435 0.73 + . g186.t1 Scaffold_4 AUGUSTUS start_codon 867019 867021 . + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_4 AUGUSTUS CDS 867019 867435 0.73 + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_4 AUGUSTUS stop_codon 867433 867435 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MRSISSIQWFFNNTVDEDEGFYRMVLEHSRFDNDGPFLTAAQHAGFAPPPSDSLEPPLHRRMLALSTPLPHSDGAGRW # DDIVPALPSIDQLTADWEQLMLDYIHHITDTPLPGPNPPAPVSAVDPVTEPSGGGRRAVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 Scaffold_4 AUGUSTUS gene 882395 883004 0.35 - . g187 Scaffold_4 AUGUSTUS transcript 882395 883004 0.35 - . g187.t1 Scaffold_4 AUGUSTUS stop_codon 882395 882397 . - 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_4 AUGUSTUS CDS 882395 882854 0.82 - 1 transcript_id "g187.t1"; gene_id "g187"; Scaffold_4 AUGUSTUS CDS 882982 883004 0.35 - 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_4 AUGUSTUS start_codon 883002 883004 . - 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MEEDQQFNWRAANSAVQLGKHPQQLINTAGSAFSAGQRSPASILALANIHVLQMCHTGKQPQCRATSHSPCDLPPHFN # LDAGDHDDQDPPVDPNNPGANNDIPDNDNLDDDSSSLPHGGPGGPGGSCTPISPDIPNEQCAMLELLSGFKGSIETILAALN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 Scaffold_4 AUGUSTUS gene 896164 896865 0.35 - . g188 Scaffold_4 AUGUSTUS transcript 896164 896865 0.35 - . g188.t1 Scaffold_4 AUGUSTUS stop_codon 896164 896166 . - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_4 AUGUSTUS CDS 896164 896364 0.71 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_4 AUGUSTUS CDS 896578 896865 0.38 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_4 AUGUSTUS start_codon 896863 896865 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MAAKSKGEVLVFRRGHIPVQESKSSDDEESAQPVQQLVVDVEEKVKRDGAVSGLQKQTSIFHWEDVCYHINIKGEGRR # LLDNVDRWVEPGTLTALMTSTVREALIFSARLRQPQDVPDAEKVAYCSEVIHLLGMEKYADAVVGVPGEGACSGSEIVESFFYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 Scaffold_4 AUGUSTUS gene 917588 918277 0.67 - . g189 Scaffold_4 AUGUSTUS transcript 917588 918277 0.67 - . g189.t1 Scaffold_4 AUGUSTUS stop_codon 917588 917590 . - 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_4 AUGUSTUS CDS 917588 918277 0.67 - 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_4 AUGUSTUS start_codon 918275 918277 . - 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MSLVRTQTRGRVSSALPRSNAEKTTRRLNPVCDVIEITDSSSDDDKCSVIELTNSSDNEDAPTKKDVLKVRPRKQPAP # TAYTKKHFHKVRPRKQSAATSTDEAQLNPPKGDQLIGPQAEGKTVSAMLAQVLELVPDVQPRLARDLILRHFTVGQNQVLEAVIQSLFEPTSGRRVEK # RNSTEQGQLEGGGHKRPRLGEVDYSRVDRNQKGGPDYQGLCMVRLSIWLWCVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 Scaffold_4 AUGUSTUS gene 924056 924868 1 + . g190 Scaffold_4 AUGUSTUS transcript 924056 924868 1 + . g190.t1 Scaffold_4 AUGUSTUS start_codon 924056 924058 . + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_4 AUGUSTUS CDS 924056 924868 1 + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_4 AUGUSTUS stop_codon 924866 924868 . + 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MAPSTQDPSHGNNARPDHSSPSSNSTSTVGSKEKRTTVTKSDEPSSSILSSFHKVFVNGIPLADYVKEDPHWNLLLDI # ATPCMECEHKRIECTVPAKYPRCEPCGSSNCSISRLARHRAFARQHGKDLAFSRKFLDEHGATKKDSYIIPLNYWRTYDSLLRKRNHPPEISAEFRIF # EQNEDLTTQETSPDPHINESSVQLLSKPSKEKKKVPKCLTEEATPKDTKKGKGWAEETTAKNTKKGKKRSAEESVPPDMNKAKRRFDRRVPVQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 Scaffold_4 AUGUSTUS gene 926160 926549 0.62 + . g191 Scaffold_4 AUGUSTUS transcript 926160 926549 0.62 + . g191.t1 Scaffold_4 AUGUSTUS start_codon 926160 926162 . + 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_4 AUGUSTUS CDS 926160 926549 0.62 + 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_4 AUGUSTUS stop_codon 926547 926549 . + 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MTLDDQLPAVPNFDQGMVLWDRYLQVYLEALLNGTLLEPVCRILDDPLREKSHPPAVDTSLPHCGVEPTDVASDGSYV # KNLSMSCGGPVPGSPDENIATASSSSVSIVDGPIEEKTVDLSSDNGSLFTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 Scaffold_4 AUGUSTUS gene 927116 927764 0.97 - . g192 Scaffold_4 AUGUSTUS transcript 927116 927764 0.97 - . g192.t1 Scaffold_4 AUGUSTUS stop_codon 927116 927118 . - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_4 AUGUSTUS CDS 927116 927607 1 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_4 AUGUSTUS CDS 927732 927764 0.97 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_4 AUGUSTUS start_codon 927762 927764 . - 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MGVATSPKVPDKVVTPLEGLRKHYEGTRKSSTSHEGLMKVDRGFMKVPRGLKQPSQGNLRVTKRLEGLHRCYEGTRKA # CTTFLNYLEGCQHLEGLRRHCEGTRKSSTSHEGLMKVDRGFMKVPRGLKQPSQGNLRVTKRLEGLHRCYEGTRKACTTFLNYLEGCQDFGRSTQAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 Scaffold_4 AUGUSTUS gene 937805 938212 0.93 - . g193 Scaffold_4 AUGUSTUS transcript 937805 938212 0.93 - . g193.t1 Scaffold_4 AUGUSTUS stop_codon 937805 937807 . - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_4 AUGUSTUS CDS 937805 938212 0.93 - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_4 AUGUSTUS start_codon 938210 938212 . - 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MPSSIARAYGVGDAYVKRLLHWLEGNVWVTHSADKSQSNFVVDFAHEFPIVQAKALILRWMLQQRDIAGNVTQESARE # VRRAIEKENFARENWFKRYWPSEEQWDELLSGNKDITVDFAWDKSPKGFTYYIRNAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 Scaffold_4 AUGUSTUS gene 938441 939304 0.2 + . g194 Scaffold_4 AUGUSTUS transcript 938441 939304 0.2 + . g194.t1 Scaffold_4 AUGUSTUS start_codon 938441 938443 . + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_4 AUGUSTUS CDS 938441 938494 0.22 + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_4 AUGUSTUS CDS 938666 939304 0.42 + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_4 AUGUSTUS stop_codon 939302 939304 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MELSLDILKGRSKSLKYSYTTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSIL # TVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSL # YSLNSLNSLNIISKVSILTVLTEHHQYSLYSLGHPSNIIHSQQRVPQLPNSKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 Scaffold_4 AUGUSTUS gene 946756 949748 0.05 + . g195 Scaffold_4 AUGUSTUS transcript 946756 949748 0.05 + . g195.t1 Scaffold_4 AUGUSTUS start_codon 946756 946758 . + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_4 AUGUSTUS CDS 946756 948103 0.07 + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_4 AUGUSTUS CDS 948631 949748 0.31 + 2 transcript_id "g195.t1"; gene_id "g195"; Scaffold_4 AUGUSTUS stop_codon 949746 949748 . + 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLW # LYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKID # EESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNL # ERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPR # VNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQREGGAYALENEGGGKGGFNPPP # RVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPW # YYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTL # NRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAAPWPLQVVTGREEPRSYD # EWTRVFTKLDGAVRAQAESLRNSTVKKCCKDGESLPRVELAPEAPYKSPLRRERDPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 Scaffold_4 AUGUSTUS gene 950541 951143 0.54 + . g196 Scaffold_4 AUGUSTUS transcript 950541 951143 0.54 + . g196.t1 Scaffold_4 AUGUSTUS start_codon 950541 950543 . + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_4 AUGUSTUS CDS 950541 951143 0.54 + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_4 AUGUSTUS stop_codon 951141 951143 . + 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGSTNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 Scaffold_4 AUGUSTUS gene 951544 954834 0.89 + . g197 Scaffold_4 AUGUSTUS transcript 951544 954834 0.89 + . g197.t1 Scaffold_4 AUGUSTUS start_codon 951544 951546 . + 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_4 AUGUSTUS CDS 951544 954834 0.89 + 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_4 AUGUSTUS stop_codon 954832 954834 . + 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MDHLLREGTPAYFLHISPTKEESPTEEMLRASDSSVTEGVQQPKDPESGDPSSEQGGVVRELDKEESKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALN # KITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILI # YSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTK # LLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQ # WRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATIL # MNEDLLVNRVREAPKDTTIIEALRRIARNEEESLVWEDGLIKRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYV # RSCHPCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVVVCRLTKQAIYVPCHTTNNAEDFANLFITHVFSKHGMPSDITS # DRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCAYDQDDWDLLLPIAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLER # VQGAEVNEYAANLKELHTYLQERIRTANEVYTKYANQKRQEAPDWKEGDRVWLNMENVKTRRPMKKLDHKWTGPYSILSQVGSHAYRLDLPGDLHKIH # NVFHVDRLKPHFPDKFRRQNSPPPPIFVKGESEHFVESILDSKPIKGKPEEVEYLVKWEGYDEDFNSWVGWEGMAGSLELMKQWHREHNRKRKPKRDQ # WELLEKQAEDDRGEAVGSTGGTGNERENKDGWRRRNTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 Scaffold_4 AUGUSTUS gene 955149 955712 0.9 - . g198 Scaffold_4 AUGUSTUS transcript 955149 955712 0.9 - . g198.t1 Scaffold_4 AUGUSTUS stop_codon 955149 955151 . - 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_4 AUGUSTUS CDS 955149 955712 0.9 - 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_4 AUGUSTUS start_codon 955710 955712 . - 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MLTHSRFPSHDAFLTAAQHAGYVDARPGSLEPPLHRRFFSFDHPIPIAPSPTSDHLPAVPAMDSIMVSWERLIANYIR # DMIDTPGPHYFFPTSADLTVVGGGSSPVEGSVLAEEDDENAPREVVEVAGEVGANVATPAEEDDRGLPVGGSETPAMARTPLFLLASRSPSSPLLPPS # VPVVPHIIDLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 Scaffold_4 AUGUSTUS gene 964620 965770 0.28 - . g199 Scaffold_4 AUGUSTUS transcript 964620 965770 0.28 - . g199.t1 Scaffold_4 AUGUSTUS stop_codon 964620 964622 . - 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_4 AUGUSTUS CDS 964620 964912 0.74 - 2 transcript_id "g199.t1"; gene_id "g199"; Scaffold_4 AUGUSTUS CDS 965206 965770 0.29 - 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_4 AUGUSTUS start_codon 965768 965770 . - 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MDLCRSKEELIQKHFTLYNPEEWQIRIYHSDGPYEGLLEGTPVDNAAQECDPVTTEGQVEQNSESTTTPIISALVEPS # GLLQSEATTYSIQCLSSPTPPEVDSSSSHESSTDVERPENLVQPPALSRTFNPLELDIDKIKAGKDDRTAIMFKDVPPEVTGQYLEQIITEVCGAQKI # DFLYLPGKAPNFVNLVRTKEKFVRRYCINKLSRVKSTVPQEWQPRLFHSTGPQQGLPEDLPGLEDPQYILSSPQTRKYEVVQEALAGNIGNLLKEKPG # DVTGLDLGDFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 Scaffold_4 AUGUSTUS gene 965902 966741 0.29 - . g200 Scaffold_4 AUGUSTUS transcript 965902 966741 0.29 - . g200.t1 Scaffold_4 AUGUSTUS stop_codon 965902 965904 . - 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_4 AUGUSTUS CDS 965902 966741 0.29 - 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_4 AUGUSTUS start_codon 966739 966741 . - 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MQVYGSTNGESITSVLLPSIPNVNLHTISPFIYGTPPDWKPIRIARIAIPYTYLSARQSGHGSAFKSIYAVFASGSVS # YSWFYFWFFSTSSYPRTRQACGTSCSQTESHPTSASNTAEFECQETFLQSPPVSASSCSSAPTQVISTGSGDTSASVLSAYDSMSASYMLSQPYELSE # RIIEKMEAGEDNRTSLKIRHVPHSVTIDQLEEMIKNVVGPRKIDFLHLPRFKNGGEYSFVATYYQLSSSEYSLCVIYCADRQCWLWIRQLHPYERSRV # VCQKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 Scaffold_4 AUGUSTUS gene 973272 974510 1 - . g201 Scaffold_4 AUGUSTUS transcript 973272 974510 1 - . g201.t1 Scaffold_4 AUGUSTUS stop_codon 973272 973274 . - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_4 AUGUSTUS CDS 973272 974510 1 - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_4 AUGUSTUS start_codon 974508 974510 . - 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MRVHVLTDHWTLENFEKQKDLSRRQLRWQEEISQFDLEIAYIPGDDNVGADALSRIRAGALPWDVVESEPPSVVNVEA # WKINPFMCASVLSLSADKQFLAQIKLGYKSDPFVIKLIKGGSLVPNVTHKNGLWFVSGCLVIPNYLSLREDLFHLAHDTCGHFGSDKSYVMLADSYYW # PHMHRDLCKFYVPGCEDCQRNKGRTAKNRKGPLHPLPVPEGRCDSVGMDFIGPLPNDQGFDCILTMTDRLGSDLKIIPMNVDISAPALAKLVFDHWYC # DNGLPLEWVSDRDKLFVSDFWKTLNGLTGVKIKMSSSFHPETDGSSEHSNKTINQAIRFYVERNQMGWVNALPKIRFDIMNSVHTSTGMSMFELQYGR # SPRVLPPLVGDFDVGHFDPSESSDDAKEFLQRIALMVREA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 Scaffold_4 AUGUSTUS gene 979050 979652 0.84 + . g202 Scaffold_4 AUGUSTUS transcript 979050 979652 0.84 + . g202.t1 Scaffold_4 AUGUSTUS start_codon 979050 979052 . + 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_4 AUGUSTUS CDS 979050 979652 0.84 + 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_4 AUGUSTUS stop_codon 979650 979652 . + 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MNPYSNFDHRPLCADHKEINLPSETLSAVDHTTIAPSTGPTWTQKTSNRALPYSSPSPDPQLQQHRSPLSPSVSIESL # SSELEYESDQERLAHLQRARQGPYVYGNNHHTPHSPKHPSDSSTSATNSLASHSPASVSMTDDLAQAIDRSSKTVSAVPAKRRGPPALVFENDSDDDF # LIPKPPGEVGRPNRGGYSLFDVLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 Scaffold_4 AUGUSTUS gene 992185 992744 0.49 - . g203 Scaffold_4 AUGUSTUS transcript 992185 992744 0.49 - . g203.t1 Scaffold_4 AUGUSTUS stop_codon 992185 992187 . - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_4 AUGUSTUS CDS 992185 992576 0.59 - 2 transcript_id "g203.t1"; gene_id "g203"; Scaffold_4 AUGUSTUS CDS 992723 992744 0.5 - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_4 AUGUSTUS start_codon 992742 992744 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MPLNLDFAQQVELDRSSPDSDSREITPVVNIESNSSTLSPPSSDDDSMTTCVNESGNIELCSGKYGSEVKPGVTLSPE # DLDDLYEEARRHAKTKSTEDIENVRESSWMLFHPVCTAIGSGRRSWLILAYLWKPRQVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 Scaffold_4 AUGUSTUS gene 1001737 1002932 0.34 - . g204 Scaffold_4 AUGUSTUS transcript 1001737 1002932 0.34 - . g204.t1 Scaffold_4 AUGUSTUS stop_codon 1001737 1001739 . - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_4 AUGUSTUS CDS 1001737 1002513 0.88 - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_4 AUGUSTUS CDS 1002624 1002932 0.34 - 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_4 AUGUSTUS start_codon 1002930 1002932 . - 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MYISCLSHSFCLQLSHSFHFISPGILMAPSSDIDIDPASEEVLLTFYRRLYPFKQLFKWLNRGPERAEKESRLFLYRE # FAFTLRNDAYLRYNSYLSDFEMKKHPKDKKTVCPTHFRAEKREVVFDIDMTDYDPIRTCCSEADICKRCWGFIAIAVEVLDTAIRAQFEYTKLLWVYS # GRQGIHLWISDKEAFELNDDQWKAMVEYLTVIKNGKEEPGKRVNVHFGMKDLPPPLKYVVASAVVIVRLMLITLRDACQAINQTFDDLILQDQDCFGS # QEGYETLFSLIPDAKLASRLREKWSQKPNSPSYIKWDEMRTEILALRDKHARVRISFESRYHPVLILVSPAKHEICHGRHSSTICLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 Scaffold_4 AUGUSTUS gene 1005634 1006269 0.39 + . g205 Scaffold_4 AUGUSTUS transcript 1005634 1006269 0.39 + . g205.t1 Scaffold_4 AUGUSTUS start_codon 1005634 1005636 . + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_4 AUGUSTUS CDS 1005634 1006269 0.39 + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_4 AUGUSTUS stop_codon 1006267 1006269 . + 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MLTTLRNYGYNIPWDTLISKYISKLPSGPRYVYLKQVLEEESDEPGVVPNRKLFDKFTIHLENTRNQELLDLSESGGG # LYNCCFQKTGPTTNDKPLDSQKPRDTPNLSKPDMKPTAYVTTSNSHAMPMTSKIENVDTVPDVTTVLPANNTTVCSTYPAHRLKPFAALLSTFPSSPL # PNEYSMNDQSFAYSSLVQKKHTLLDSACTNHIVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 Scaffold_4 AUGUSTUS gene 1009577 1010008 0.55 + . g206 Scaffold_4 AUGUSTUS transcript 1009577 1010008 0.55 + . g206.t1 Scaffold_4 AUGUSTUS start_codon 1009577 1009579 . + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_4 AUGUSTUS CDS 1009577 1010008 0.55 + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_4 AUGUSTUS stop_codon 1010006 1010008 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MDWLAAEEKEITGLFELGVFEATERCLKDKFLIGLKMVYDLKLDGTKKARLVAQGFTQQPEDYGNVHAPVTRMVSHQI # VMAWTAKMNLELFSFDVKQAFLWQKKSTLNRFQDVLYLINHLRSIIYEEHYRPSPSISGMVFDIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 Scaffold_4 AUGUSTUS gene 1012454 1012876 0.89 + . g207 Scaffold_4 AUGUSTUS transcript 1012454 1012876 0.89 + . g207.t1 Scaffold_4 AUGUSTUS start_codon 1012454 1012456 . + 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_4 AUGUSTUS CDS 1012454 1012876 0.89 + 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_4 AUGUSTUS stop_codon 1012874 1012876 . + 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MPSGARRPARAKQLVRAYLKFRIWCKKPQLEQCRREGYRTNSSFWRIVHRIQDLSSGSDSSTNSTSSDSLQSQVFSSD # LSSITMSDLSEESDDLMADDEWSSSDSSPETDFDDSDSEGIELEQLIVGRQIREEIENMYAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 Scaffold_4 AUGUSTUS gene 1013845 1014265 0.53 + . g208 Scaffold_4 AUGUSTUS transcript 1013845 1014265 0.53 + . g208.t1 Scaffold_4 AUGUSTUS start_codon 1013845 1013847 . + 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_4 AUGUSTUS CDS 1013845 1013880 0.53 + 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_4 AUGUSTUS CDS 1013990 1014265 0.54 + 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_4 AUGUSTUS stop_codon 1014263 1014265 . + 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MQIVIGNIVDLISESDDAIDTYVPQRGECLSARRLREGRARRIQLKEQLLRSQERRAQTIDITHRDIHLQNESFVSKP # VLFRKASLNSPEPWYSSRPFSSRPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 Scaffold_4 AUGUSTUS gene 1020918 1021355 0.64 + . g209 Scaffold_4 AUGUSTUS transcript 1020918 1021355 0.64 + . g209.t1 Scaffold_4 AUGUSTUS start_codon 1020918 1020920 . + 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_4 AUGUSTUS CDS 1020918 1021355 0.64 + 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_4 AUGUSTUS stop_codon 1021353 1021355 . + 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MDHLLREGTPAYFFHISPAKKESPTEERLRASDSSAPEGVQQPKDPESGNPSPEQGGVVKELDEEASKHQETEELKKS # IPVQYQDYLDVFSPGEARMLPPHRPYDIKIEMEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 Scaffold_4 AUGUSTUS gene 1034007 1034426 0.43 + . g210 Scaffold_4 AUGUSTUS transcript 1034007 1034426 0.43 + . g210.t1 Scaffold_4 AUGUSTUS start_codon 1034007 1034009 . + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_4 AUGUSTUS CDS 1034007 1034426 0.43 + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_4 AUGUSTUS stop_codon 1034424 1034426 . + 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MALNIVQEYQANKSHGPCDLFEEGDLVMLLTYHCHEIFKKAGEKCAIKFFARFDGPYKIIKAFPATSHHTLNMPNQPN # AYPSFYVDQLKRFVPNNPTLFPNCEHPVPKPTIINGHEEFDMTVFLIHVPQSWLAVLGQMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 Scaffold_4 AUGUSTUS gene 1037214 1037795 0.96 + . g211 Scaffold_4 AUGUSTUS transcript 1037214 1037795 0.96 + . g211.t1 Scaffold_4 AUGUSTUS start_codon 1037214 1037216 . + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_4 AUGUSTUS CDS 1037214 1037795 0.96 + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_4 AUGUSTUS stop_codon 1037793 1037795 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MAEKQTGKKLRIIRIDGGGELNNGLVDEYCKEHGIIIEKVPHDSSAANGVAERSFRTVMDGTRTLLEEASLPYSFWGE # ASNTFVYTNNFIPSARFPDTVPVEAWTQKRHDVSHLRPFGCDCWATLPRRRTDGKLGRQAVKGKLLGYMGRRGYRLWIPETKKIEESHDVTFEEGTPH # RTRPAPEDTNEQEWGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 Scaffold_4 AUGUSTUS gene 1041487 1041948 0.89 + . g212 Scaffold_4 AUGUSTUS transcript 1041487 1041948 0.89 + . g212.t1 Scaffold_4 AUGUSTUS start_codon 1041487 1041489 . + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_4 AUGUSTUS CDS 1041487 1041948 0.89 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_4 AUGUSTUS stop_codon 1041946 1041948 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MSDGEVTQLDISMSGNQSDMDISELEAVGGGSREMGNGLTMKRHSVALSRSMSALPNTTTMDLMGPPPPPTSPPRRAG # LRSSSSSYPSSGNTSQPQAPPKFVPELTVLEGCTVFVDVWMSDGQDTSSLYIDIAKNMGARVCGPLKHFISLVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 Scaffold_4 AUGUSTUS gene 1060729 1061844 0.68 - . g213 Scaffold_4 AUGUSTUS transcript 1060729 1061844 0.68 - . g213.t1 Scaffold_4 AUGUSTUS stop_codon 1060729 1060731 . - 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_4 AUGUSTUS CDS 1060729 1061844 0.68 - 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_4 AUGUSTUS start_codon 1061842 1061844 . - 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 Scaffold_4 AUGUSTUS gene 1061895 1063061 0.91 - . g214 Scaffold_4 AUGUSTUS transcript 1061895 1063061 0.91 - . g214.t1 Scaffold_4 AUGUSTUS stop_codon 1061895 1061897 . - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_4 AUGUSTUS CDS 1061895 1063061 0.91 - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_4 AUGUSTUS start_codon 1063059 1063061 . - 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 Scaffold_4 AUGUSTUS gene 1068877 1069287 0.68 - . g215 Scaffold_4 AUGUSTUS transcript 1068877 1069287 0.68 - . g215.t1 Scaffold_4 AUGUSTUS stop_codon 1068877 1068879 . - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_4 AUGUSTUS CDS 1068877 1069287 0.68 - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_4 AUGUSTUS start_codon 1069285 1069287 . - 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MLTSAVRGNVSSYFLNTEDIIRMIDTGYLPPRPGILAATIGVTFIDANNIPLKHLPPYLRVHRDRVRDALRWLIANNP # LYAGLKISETNLSGLPEDGIPSEISDNMKWVDNTRVLDRENAAMFQTMMKTMRLLKIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 Scaffold_4 AUGUSTUS gene 1083039 1083852 0.41 + . g216 Scaffold_4 AUGUSTUS transcript 1083039 1083852 0.41 + . g216.t1 Scaffold_4 AUGUSTUS start_codon 1083039 1083041 . + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_4 AUGUSTUS CDS 1083039 1083079 0.52 + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_4 AUGUSTUS CDS 1083207 1083402 0.62 + 1 transcript_id "g216.t1"; gene_id "g216"; Scaffold_4 AUGUSTUS CDS 1083451 1083852 0.88 + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_4 AUGUSTUS stop_codon 1083850 1083852 . + 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MALNGMGAFWKFARDGMRGGFGGGPGRDFSHSELYADYSGPDQHVPGLRMDNYGGGFGAGMGYRGYTEPEPSQQIMVR # NLPWSTTNEDLVELFETTGQVELAEILLEGTRSKNRGVVQFAQVTEGETAIGECLLVLRTTLLNASFVAKFQQYMYGGRPLGMFFLLIFLSPLIDLAK # TFGSMTVGTPLPRLLPKEGSTSSRTKISSTFTLSNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 Scaffold_4 AUGUSTUS gene 1085325 1085798 0.37 - . g217 Scaffold_4 AUGUSTUS transcript 1085325 1085798 0.37 - . g217.t1 Scaffold_4 AUGUSTUS stop_codon 1085325 1085327 . - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_4 AUGUSTUS CDS 1085325 1085798 0.37 - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_4 AUGUSTUS start_codon 1085796 1085798 . - 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MCVFLLYDQDFIAVSRKYAGVGGVTGPEDVKMSRKDRKNAVAELHAMKVPDMSEDDEGDEDDEGNDGEDDEGSDDEYR # DKNNGKGDYGNNSEDDNGSNSGGENSKDDDNNGGGENKYEDEINNGMEGDDGGLIAEGGSGRANGFNVVNLTKRESDTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 Scaffold_4 AUGUSTUS gene 1089516 1089869 0.82 + . g218 Scaffold_4 AUGUSTUS transcript 1089516 1089869 0.82 + . g218.t1 Scaffold_4 AUGUSTUS start_codon 1089516 1089518 . + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_4 AUGUSTUS CDS 1089516 1089869 0.82 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_4 AUGUSTUS stop_codon 1089867 1089869 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MEKIFLGVISGATESEEIVLCVRAILDFIEYSQFSLHTDESLEKMDEALRLEKMDEALRSFHSHKDAAFVDTGIRQAF # NIPKVHSMKYYTPMILSIGSQQDPSVSLLHSSVQSRPGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 Scaffold_4 AUGUSTUS gene 1096963 1097253 0.26 + . g219 Scaffold_4 AUGUSTUS transcript 1096963 1097253 0.26 + . g219.t1 Scaffold_4 AUGUSTUS start_codon 1096963 1096965 . + 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_4 AUGUSTUS CDS 1096963 1097253 0.26 + 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_4 AUGUSTUS stop_codon 1097251 1097253 . + 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MISNTVVDILLIKLIDALLKYKDDLKAFRVPNSQGSYDYDRASMLEAIESLGVSWHPNKGDEDFVTVTQFIGFLWNLE # LKRVSLPNDKHIKYFECI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 Scaffold_4 AUGUSTUS gene 1105599 1107437 0.18 + . g220 Scaffold_4 AUGUSTUS transcript 1105599 1107437 0.18 + . g220.t1 Scaffold_4 AUGUSTUS start_codon 1105599 1105601 . + 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_4 AUGUSTUS CDS 1105599 1106216 0.4 + 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_4 AUGUSTUS CDS 1106343 1106652 0.33 + 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_4 AUGUSTUS CDS 1106893 1107095 0.57 + 2 transcript_id "g220.t1"; gene_id "g220"; Scaffold_4 AUGUSTUS CDS 1107180 1107437 0.58 + 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_4 AUGUSTUS stop_codon 1107435 1107437 . + 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MPRQRKSRETSQKLKQTTLTGSIQSPSRGRSKPSPSQPVAKRRPIDYLSDEQNEPSDDSDIGALKLEPKGPVEDDDEL # TPSPAKRKRMRFVVGSDTEESEEDVPIARRGTRSVKRKERDKVKKRNAPVKNKIGKGHAEGKGKEPVVMSSDPDSGGGSPPRRRKLVKGKRPAAKSDS # EESDEVEPERELFENLRPVYTSSGSIIVLQGKPMESDDDDEDEEEMEEEEEAPFKAARPDSDKNSLFDGSESDGSESFIVEDDGAGLAALPVEFSMES # HQDLSHNFKKIFQFFVHIAVHPPIERHEFMEMQMKRARMSTLNGRLLGEPYDRLGFEVSLDNFTASPLFTNPYQDLDLSDESLSEGECRTDFHLGRFC # ARRTRYMLFKTINEEVDDLHVAKQEKGAGRFVRVAWPEGLQPPKDLQDADGICDWLDQRKVVEMEWEKLKGYMERARGLELAAKRGDDAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 Scaffold_4 AUGUSTUS gene 1112847 1113410 0.47 + . g221 Scaffold_4 AUGUSTUS transcript 1112847 1113410 0.47 + . g221.t1 Scaffold_4 AUGUSTUS start_codon 1112847 1112849 . + 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_4 AUGUSTUS CDS 1112847 1113410 0.47 + 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_4 AUGUSTUS stop_codon 1113408 1113410 . + 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTTSLRATFLEGPMLRASTVMDIEALHQAI # ILALPKDPSSVAGLELAKDPSNEHWSLGSDGLLRLDDRIYVPNHGDLRLQVLRYFHNHPLSGHFGQNRTLEAVRHQYTWPKVRDFVRDYVTSCTTCGH # NKPAVIGLTAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 Scaffold_4 AUGUSTUS gene 1114830 1115135 0.31 - . g222 Scaffold_4 AUGUSTUS transcript 1114830 1115135 0.31 - . g222.t1 Scaffold_4 AUGUSTUS stop_codon 1114830 1114832 . - 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_4 AUGUSTUS CDS 1114830 1115135 0.31 - 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_4 AUGUSTUS start_codon 1115133 1115135 . - 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MAQLLADNRQFQEEQVKSHTYNCHFNRKLDWLIMDAARRRSPPELPQAGPSQLPKKRRRVVDSKEEEEEEQEVEVEER # GEEERDELALKKARSEKGKEREE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 Scaffold_4 AUGUSTUS gene 1130757 1131463 0.9 - . g223 Scaffold_4 AUGUSTUS transcript 1130757 1131463 0.9 - . g223.t1 Scaffold_4 AUGUSTUS stop_codon 1130757 1130759 . - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_4 AUGUSTUS CDS 1130757 1131139 0.92 - 2 transcript_id "g223.t1"; gene_id "g223"; Scaffold_4 AUGUSTUS CDS 1131211 1131463 0.97 - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_4 AUGUSTUS start_codon 1131461 1131463 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQLSTALYTGDGQPV # QVLTPRPIARRTGNNPNVAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDLDDDSGGLPRGDLVTPVDLVVLVVPAVPAVLVDLVDLVLPY # LLTSPTSNVLCWNSSRGSRVPLRPLVPSSPLSAAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 Scaffold_4 AUGUSTUS gene 1135543 1136672 0.68 - . g224 Scaffold_4 AUGUSTUS transcript 1135543 1136672 0.68 - . g224.t1 Scaffold_4 AUGUSTUS stop_codon 1135543 1135545 . - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_4 AUGUSTUS CDS 1135543 1135989 0.78 - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_4 AUGUSTUS CDS 1136097 1136672 0.68 - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_4 AUGUSTUS start_codon 1136670 1136672 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MWKVLIYNVGASNWKKDREKRAWWRDSETLLALAQLDVSGIEEVRVCGGSCDAEGSGIHESLDPLYMMFRKMRQLRRV # DCTNSNFQTNSNFQLVSASQFIAPVAEVEDREVWFRGWRISQFQKPDPTFHPLAQMSVRPRKLECTGMLFQELEETFAIDCDDTKEVVLTVRGLLIWR # QLRRELSTSRSYGKLKRMTVTVFIKPWAEFTGADYLIALLAYPTEWENLTILHLKMTPMENGTVTTELQNSAQWEQLSEMLMDEEQFPSLFTVEIDVL # NIVRDVHPWSDRERKDDEEVLGLTEVLKRERATRKAITEGLGALEMGRDLNISVSFEREYGTINYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 Scaffold_4 AUGUSTUS gene 1138119 1139187 0.64 - . g225 Scaffold_4 AUGUSTUS transcript 1138119 1139187 0.64 - . g225.t1 Scaffold_4 AUGUSTUS stop_codon 1138119 1138121 . - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_4 AUGUSTUS CDS 1138119 1138858 1 - 2 transcript_id "g225.t1"; gene_id "g225"; Scaffold_4 AUGUSTUS CDS 1138911 1139187 0.64 - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_4 AUGUSTUS start_codon 1139185 1139187 . - 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MTEAVATNKAPAKKAKKTDEGAQKKDKGKKNDHEMDPEDDPQGVGAGGNFDTDMEDGKGEKDGKGNDDAEDNGEKDYT # VADLIGSRKPGEKFADFDKRRAKLDSLQGETYLRLVAPTDISKVKARKQFAHFHEHPVGGKISAKIRRLSQEVPWFVLEGSTMSRELSIRLLTSEQGN # LLCPYHAVKDKAIRAHDEDGKRDSQDPSLTGVPKRPTKAKSHPGDPPVGYMHCGCELDLVLLEFCYWKTGKIYSPTLGRWETWKNEQMNPRVRAFIYG # DWEQKTGMRLENMWMQKVNTNVGGRGALTSNRTEVEIVEEQIKVLQACREALKQLEEEEEQSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 Scaffold_4 AUGUSTUS gene 1139447 1139833 0.74 - . g226 Scaffold_4 AUGUSTUS transcript 1139447 1139833 0.74 - . g226.t1 Scaffold_4 AUGUSTUS stop_codon 1139447 1139449 . - 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_4 AUGUSTUS CDS 1139447 1139833 0.74 - 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_4 AUGUSTUS start_codon 1139831 1139833 . - 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MLLEKVTIVMDEDDTTDKKGTSAGAPDTNMEGNTKLSPKEDSVKASDTDFDAVADPKEDSVKPTGVDFDVAGVQVEAS # ALKPTIANLSADPNTPIRKAQDNRDKGHFGLQDVQQGTNINNAQYSEQEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 Scaffold_4 AUGUSTUS gene 1146346 1146921 0.95 + . g227 Scaffold_4 AUGUSTUS transcript 1146346 1146921 0.95 + . g227.t1 Scaffold_4 AUGUSTUS start_codon 1146346 1146348 . + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_4 AUGUSTUS CDS 1146346 1146921 0.95 + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_4 AUGUSTUS stop_codon 1146919 1146921 . + 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MSAFSEDLEELEQHSHPANFCPSSNFMPISNEPLRPLRRNADPTVKGSAYPFRIAHTDAGLSTSPVKRGKTRRSKTTL # NGRQGRTTLNGCQGQNSTREDLQPQTEVPIAGQESGQVGIETTRYDPDIPMFDPPEIDLGEWDGFVDTDNPVANDDVDEEYCNAVEWNVVGFLPIGGS # LYIVQGWSAKKKKEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 Scaffold_4 AUGUSTUS gene 1167649 1168287 0.75 + . g228 Scaffold_4 AUGUSTUS transcript 1167649 1168287 0.75 + . g228.t1 Scaffold_4 AUGUSTUS start_codon 1167649 1167651 . + 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_4 AUGUSTUS CDS 1167649 1168287 0.75 + 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_4 AUGUSTUS stop_codon 1168285 1168287 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MASRCSESLASLMATKPSSKSGAVPSLPTFVIQGIGSSQTVKESTLRSRICEVPKSVAGSRIIDDNFNDDEEEWKVTW # KGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNIKPKLIDQVYGTSNERIEKFDELKQKIISMMTC # GGVVRKCDEIGQADTSGMLGKDLVARDGNHKRHRLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 Scaffold_4 AUGUSTUS gene 1169179 1171329 0.57 + . g229 Scaffold_4 AUGUSTUS transcript 1169179 1171329 0.57 + . g229.t1 Scaffold_4 AUGUSTUS start_codon 1169179 1169181 . + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_4 AUGUSTUS CDS 1169179 1169392 0.58 + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_4 AUGUSTUS CDS 1169440 1169920 0.87 + 2 transcript_id "g229.t1"; gene_id "g229"; Scaffold_4 AUGUSTUS CDS 1169985 1171329 0.86 + 1 transcript_id "g229.t1"; gene_id "g229"; Scaffold_4 AUGUSTUS stop_codon 1171327 1171329 . + 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHYESPEDDGTEEKLVMVKGSSGSIGMDAATPYL # AEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVCKVYPLSPPEQKALDEFLEENLRSGRIRPSRSPMASPFFFVKKKDGTLRPVQDYRKLNDMTVKN # RYPLPLIQELIDKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTNRGLFEPTVISLIKDTSLSMDDILIFTDNIEEHRIIVRKVLDILKANKLYLK # PEKCTFEAREVEYLGIIVGNGQIRMDPKKVEAVRTWQPPQKKRELQSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDAFNQLKDRIIED # VTLIIPRETGKFREADSSDYANGAVLSQNVDGKWRPVAFRSRSLNEVERNYEIYDKEMMAIMDSLSDWRQYLLGAKEPVEVFTDHQNLQYFRKPQKLN # RRQARWVVEIAEYHIELFHKPGKSMGKADALSRMSGLEKGENDNTDVTLLKPEFFISQVTDQTSAPEDDLLNLIRRKKNQRDKLVQVALESKDKEWLE # TEDGLAVWQGRIYVPKDKELRGRIIQAHHDAQTAGHPGRYKTIELITRNYWWPGISRDVRIYVEGCEKCQATKTHRTKPVGPLHPHDVPSEPWEIIGT # DMIGELPESGVMP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 Scaffold_4 AUGUSTUS gene 1172364 1173227 0.21 + . g230 Scaffold_4 AUGUSTUS transcript 1172364 1173227 0.21 + . g230.t1 Scaffold_4 AUGUSTUS start_codon 1172364 1172366 . + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_4 AUGUSTUS CDS 1172364 1173227 0.21 + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_4 AUGUSTUS stop_codon 1173225 1173227 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MTYFDPGLTSGGYNAISVFVDHFTKRLRLFAMHTTITSEGMARVYRDKVFPIHGMPQKIVHDHGPQYHARFMKEQYKL # LGIESNYTTAYHPQTNGQTEQINQEIEHYIRLFVNHHQSEWHKWLPMMEFAYNGRVHSATKVSPFYADNGRHPYKGTTPKMTSQNPTAQEFANSMKWI # REEVGSALKKAAEDMKRQYDKHRNGAIEYKAGDKVWLEGTNITPDRPMKKLGDERFELFKVLEKIGPSSYKLDIPRTWKRIHNVFNETHHYPRTMNPN # SQHNPETLNHLQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 Scaffold_4 AUGUSTUS gene 1180187 1180717 0.84 - . g231 Scaffold_4 AUGUSTUS transcript 1180187 1180717 0.84 - . g231.t1 Scaffold_4 AUGUSTUS stop_codon 1180187 1180189 . - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_4 AUGUSTUS CDS 1180187 1180717 0.84 - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_4 AUGUSTUS start_codon 1180715 1180717 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MILAVSLFTVFMGNKNNSRSKQSVCRKNKNPTQEIEEDQLSSGEALTPNASLRPPCPTPRPYHRGIPAYDNACHSNSG # AEIDDTAATRLMMLFSRVSPSKSQATPACTHPMSELHAPFTRHKGSMPGDKSRTIRTLSHPQSACQTSRLLTPIIDYQSTCYPSPSTYSCKTLGQSRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 Scaffold_4 AUGUSTUS gene 1181023 1181346 0.75 + . g232 Scaffold_4 AUGUSTUS transcript 1181023 1181346 0.75 + . g232.t1 Scaffold_4 AUGUSTUS start_codon 1181023 1181025 . + 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_4 AUGUSTUS CDS 1181023 1181346 0.75 + 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_4 AUGUSTUS stop_codon 1181344 1181346 . + 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MSEILMFLFDIVLKPKSKVCDQGANFCENSNNKYSLFVLQVADAVGAIQDKNKVVREMEYKNYELALKRDKREEKVKQ # EELKLAVAQQRNVEWERATKMMESPIAKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 Scaffold_4 AUGUSTUS gene 1191329 1191661 0.97 - . g233 Scaffold_4 AUGUSTUS transcript 1191329 1191661 0.97 - . g233.t1 Scaffold_4 AUGUSTUS stop_codon 1191329 1191331 . - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_4 AUGUSTUS CDS 1191329 1191661 0.97 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_4 AUGUSTUS start_codon 1191659 1191661 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MSRSLTRHERCESSTYSVLILFQDISPVVEEANSHGLEDIATGLSTKGRADLSTTHAGQSNVGRVVEENGHELEDVVT # GLSTKGGTELSTVRATELDAGRDNNVKESNKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 Scaffold_4 AUGUSTUS gene 1191943 1192275 0.97 - . g234 Scaffold_4 AUGUSTUS transcript 1191943 1192275 0.97 - . g234.t1 Scaffold_4 AUGUSTUS stop_codon 1191943 1191945 . - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_4 AUGUSTUS CDS 1191943 1192275 0.97 - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_4 AUGUSTUS start_codon 1192273 1192275 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MSRSLTRHERCESSTYSVLIVFQDISPVVEEANSHGLEDIATGLSTKGRADLSTTHAGQSNVGRVVEENGHELEDVVT # GFSTKGGTELSTVRASELDAGRDNNVKESNKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 Scaffold_4 AUGUSTUS gene 1192431 1192844 0.89 - . g235 Scaffold_4 AUGUSTUS transcript 1192431 1192844 0.89 - . g235.t1 Scaffold_4 AUGUSTUS stop_codon 1192431 1192433 . - 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_4 AUGUSTUS CDS 1192431 1192844 0.89 - 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_4 AUGUSTUS start_codon 1192842 1192844 . - 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MVKSQRKSSGVKIIVGVNDLNIIVSDRSTDEYTFAPTRDNLKTLTEEKIEKMLKAKATTNKARDKKRDLITARKYLHE # TSGTVNATGEVKASLKVNTKVNGGGDIEADGFKYTKGVDEANSYELKKCCYWPFEEGPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 Scaffold_4 AUGUSTUS gene 1197117 1201083 0.11 - . g236 Scaffold_4 AUGUSTUS transcript 1197117 1201083 0.11 - . g236.t1 Scaffold_4 AUGUSTUS stop_codon 1197117 1197119 . - 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_4 AUGUSTUS CDS 1197117 1197646 0.75 - 2 transcript_id "g236.t1"; gene_id "g236"; Scaffold_4 AUGUSTUS CDS 1199543 1199662 0.28 - 2 transcript_id "g236.t1"; gene_id "g236"; Scaffold_4 AUGUSTUS CDS 1200783 1200924 0.13 - 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_4 AUGUSTUS CDS 1201045 1201083 0.33 - 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_4 AUGUSTUS start_codon 1201081 1201083 . - 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MIRQSDNDAVRSLKRCRSVSLTRTKHQLNMDLNGLAHTMGDEGEAYELQNLPAGKYHSTVPSATSALMVDSTSTESLD # NNSKIPAATSDFTFGTEPHSAEVDEEEDLYGNDEEDDGNDEEDDGNDEEDDGNDEEDDYDEDEEEGVIDGINGDVAVEEVIRYVDELEITTKSSNPHG # NDEELKEIGENLKDIKKEIKKERIIQVAEADDSDLDSDDGHGNDGEDSDGYDIDDGEHLIDELSPSTRSSYRRCLPLFSNYAFRSWMSIFLDTTMLAF # LS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 Scaffold_4 AUGUSTUS gene 1207470 1208636 0.92 + . g237 Scaffold_4 AUGUSTUS transcript 1207470 1208636 0.92 + . g237.t1 Scaffold_4 AUGUSTUS start_codon 1207470 1207472 . + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_4 AUGUSTUS CDS 1207470 1208636 0.92 + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_4 AUGUSTUS stop_codon 1208634 1208636 . + 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 Scaffold_4 AUGUSTUS gene 1217187 1217390 0.75 + . g238 Scaffold_4 AUGUSTUS transcript 1217187 1217390 0.75 + . g238.t1 Scaffold_4 AUGUSTUS start_codon 1217187 1217189 . + 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_4 AUGUSTUS CDS 1217187 1217390 0.75 + 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_4 AUGUSTUS stop_codon 1217388 1217390 . + 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MGEILGTEEGIEALAEFIEKSGAFKKTGQLTPEIREPRPEDAMVEEGNEEDWEEDGRIAEEASDDED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 Scaffold_4 AUGUSTUS gene 1221407 1222371 0.7 - . g239 Scaffold_4 AUGUSTUS transcript 1221407 1222371 0.7 - . g239.t1 Scaffold_4 AUGUSTUS stop_codon 1221407 1221409 . - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_4 AUGUSTUS CDS 1221407 1221606 0.98 - 2 transcript_id "g239.t1"; gene_id "g239"; Scaffold_4 AUGUSTUS CDS 1221768 1222371 0.7 - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_4 AUGUSTUS start_codon 1222369 1222371 . - 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MKGQILNLFHGTFQVHNSLLKVDVCLFFTTSMSRRRAAQQSSGNKPVASIALNAPSKVNSRETRSQKRKSAGIAGKHS # PLSNKKVYGHYISVDNQELNAEQPEQPAKRSRRQTKESGLGSALVVPAYQSSRRRKNKTGPADLTPQPLQNVLKTPTPAPTTRRRMARIPSTAISQAS # VAMAESRTLEPAMPTTTIKIPRLARNNTSSERLQAQQEFKDAQENDSDSESDMIGDIEDIEMLNQEFERENDSDSAAKYYAEEVRFHSGSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 Scaffold_4 AUGUSTUS gene 1222892 1223242 0.87 + . g240 Scaffold_4 AUGUSTUS transcript 1222892 1223242 0.87 + . g240.t1 Scaffold_4 AUGUSTUS start_codon 1222892 1222894 . + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_4 AUGUSTUS CDS 1222892 1223242 0.87 + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_4 AUGUSTUS stop_codon 1223240 1223242 . + 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MVIDPPITNTPHTSNPLLHSLPSHRDGIHIQTFGGQAGAPLPTSQPHYSSSQKSDHGFRLYQSSIVDSESNIWAPFTS # KTDWEMARWAKMRGSGSTAFSELLLIDGVRAITHIWDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 Scaffold_4 AUGUSTUS gene 1223916 1225211 0.92 + . g241 Scaffold_4 AUGUSTUS transcript 1223916 1225211 0.92 + . g241.t1 Scaffold_4 AUGUSTUS start_codon 1223916 1223918 . + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_4 AUGUSTUS CDS 1223916 1225211 0.92 + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_4 AUGUSTUS stop_codon 1225209 1225211 . + 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MTSGDGLQRRCHPILAAFVGDYPEQILATTAYSGDCASCDAEKKDLGIYPRIHPYRDIEAVLEAIHTSTPDLWVEKCL # ECNVKPIQHPFWEDLPYTNIFTSITPDILHQLYQGVMKHLISWVTDICGADEIDARVRRLPPNHTIRTFHKGISTLSRVSGTEHKQMCSFILGVVTDI # PHLSIHQSGTLLAATRALLDFLYLSCYPIHTTESLSQIDEALARFHAHRGVFVELGVRKHFNIPKLHFLCHYSRSITYYGTTDNYNTETTRLHIDYAK # DAYRASNRKDEYIQMTHWLERREKIMHHTNYISWRLSQALNSSSSEHSSHPTPITLSSDFGKRYDFPGAQRTLVDMKCVYTQKLARFPSMRRVPLSRL # EDTRSNGYCAVQFTRVLKRFLVQYRYPNIPFNQIDEWARFVIFFASSLAQTQIRQHRTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 Scaffold_4 AUGUSTUS gene 1226103 1226759 0.42 + . g242 Scaffold_4 AUGUSTUS transcript 1226103 1226759 0.42 + . g242.t1 Scaffold_4 AUGUSTUS start_codon 1226103 1226105 . + 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_4 AUGUSTUS CDS 1226103 1226759 0.42 + 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_4 AUGUSTUS stop_codon 1226757 1226759 . + 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MALDNEALKVIRLEAQMKRLQEDCATKEFDLRQSQKAIEDLKTRMQDWEQQDQDLKEREIALKERELSLYQREVSLWE # SEADLARRERQDADALYERWKRARDYHITAIESEKRMRTEIKDERKRLEEYEKEVVRREKKNAKKLEEFNDLHSLEAHQKLASLQQQLDKAEKANADL # WAFCETVGRMLSMPACEPGQMVRAAERLVEQCQGIVHGSASL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 Scaffold_4 AUGUSTUS gene 1236360 1238235 0.06 + . g243 Scaffold_4 AUGUSTUS transcript 1236360 1238235 0.06 + . g243.t1 Scaffold_4 AUGUSTUS start_codon 1236360 1236362 . + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_4 AUGUSTUS CDS 1236360 1236633 0.21 + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_4 AUGUSTUS CDS 1237140 1237463 0.31 + 2 transcript_id "g243.t1"; gene_id "g243"; Scaffold_4 AUGUSTUS CDS 1237562 1238235 0.99 + 2 transcript_id "g243.t1"; gene_id "g243"; Scaffold_4 AUGUSTUS stop_codon 1238233 1238235 . + 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MRLMQMAEDLGLPIIAMVADGAATELSAQGLMDRKITTQPPLVYENHEYGIRLSAPVFKMGPLISVTDAPHARKTARN # QPQHGTHTASLGTEYYPGIPFSIHNITTEFVEHFFGNGRDLLENFSYSEFLKIVQHIMVRQRIIESGEVSPKNLKDSASGYLFDSVTDLRIPSSKPIP # SVTISRAQIDDIVRIAYQEAVHLSAADDGSDAEYESGDEPGEDEDEDNLEEDDYEVYQLPDDDDSHSYREKLNHTAGLTAKDTAKYSALCDDLDKILE # QHDLVHTDIGLPLPSLAKLHLATTTTVESDPISQFSQIMDSASSKVSVDACLKVRKIWQSATSTKSERTVKLSDKYVLGKVMKSDAPVKKMSPQEGSH # RLRIAQDKNVELQQQQKKNKRQQRWLEGAQSIRKVSGLADGMILYDLCSFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 Scaffold_4 AUGUSTUS gene 1246027 1247382 0.57 + . g244 Scaffold_4 AUGUSTUS transcript 1246027 1247382 0.57 + . g244.t1 Scaffold_4 AUGUSTUS start_codon 1246027 1246029 . + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_4 AUGUSTUS CDS 1246027 1247382 0.57 + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_4 AUGUSTUS stop_codon 1247380 1247382 . + 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MRRACILKQACEAKPIDFETIRGYFASGDYVFEDTGCPRPEFIRHASKTRTHESTSHTLEYRVAVDPTILVQLLTCGV # KGIRRPDDEDEWAEFEELENGSSDDEDGVKGRAKKKKHPRPTLSGLLELWLPAVLVKEAVPGLVEAYEVVQKQKEEKKAGKGGRVKTMEPKAKPPRSV # KPKLKAGASTTTLTAKPYSSQLALRTDQVINLDLSDDDMDYDNRPFILSRPVHSITHPQKHLMSRIPGSTLPDLPFNDHSPSTASVSALQKLECAGTS # SHSCNIRSSFEVSEPSAQDNSKKKVSQGNSLLSIIDSIVMPKSKEGEIRQTSRFRTAPDRTPQPFPVSFDEESNNSDGPFNLNFIHAHAPPGSPQTSP # AHPQKRTCEATVVLSSDSSASERSSSSRKDEVGVLNKSPRKSKVISFQKDSTMMLPASKGRRRYVKFHILCDRHNQLSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 Scaffold_4 AUGUSTUS gene 1248133 1249512 0.84 - . g245 Scaffold_4 AUGUSTUS transcript 1248133 1249512 0.84 - . g245.t1 Scaffold_4 AUGUSTUS stop_codon 1248133 1248135 . - 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_4 AUGUSTUS CDS 1248133 1249512 0.84 - 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_4 AUGUSTUS start_codon 1249510 1249512 . - 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MESVRIVLAVIAVLGLFMFQVDFKAAFLNSPIQHDVYIKQPEGFIKEGEEHKVCKLNKSIYGTMQGSHDWQDTLGKGY # EEDGYIASKADPCVRYRRIDDEYTLSTTYGDDVNGASSTEDGRKKAIADLGKRWESSEVNSGVLLGMTISQDPTPNPSLSQKSYFERMLEHFGMENVR # IRCTPLDPKAKIVESTNPLPELDRKFMSDKPYRSFVGSLLWGACSTRPDIAFASNFLARFQLNPGIIHWEACEWLAGYIRGTIHYSITYRAPKPGDDR # LGFGLAPLGYSDSDWASCLVTRRSTAGYIFFMGGAPVSWASKRQGSVALSTVEAEYIGLSKACQQACWLRSFIQEIDLPLTGPTLLHGDNFGSVSLSE # EPRNHSLIKHIDMREHYIRERVKDGSVKVIRVRSGENVADITTKALSGTTHARIIQCLIWIIRSRGGVGLVLRMLSFVLCDPSGHRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 Scaffold_4 AUGUSTUS gene 1249715 1250641 0.46 - . g246 Scaffold_4 AUGUSTUS transcript 1249715 1250641 0.46 - . g246.t1 Scaffold_4 AUGUSTUS stop_codon 1249715 1249717 . - 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_4 AUGUSTUS CDS 1249715 1250641 0.46 - 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_4 AUGUSTUS start_codon 1250639 1250641 . - 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MIPPRSSAANGVAERANRTVLDGVRTFLVDAGFPPSMWAEAALTFCYVNAFIPSSRFPNEVPIEIYTKKRHDVSHLRP # FGCKCWVTLDAIQTDGKLGVRAVEGRFVGYIGRRGYRVWLPQTKTFHESRSVEFEEGDPRRSAPAVPDEVDGEVFVDVDVGPAPNAVPDSPANENQID # IPNASIPSTPTTPSTPSYDGIPELFAAQPSFQPLALPIQEPEAGPRRGTRIRGHQHDNYNLRNQLKENVALLSRNLAWAHDSGGIDELDENQTPAMVA # NSPFAFGAESSDKWVPNIQTGYTSSRTLEGANAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 Scaffold_4 AUGUSTUS gene 1251141 1252427 0.86 - . g247 Scaffold_4 AUGUSTUS transcript 1251141 1252427 0.86 - . g247.t1 Scaffold_4 AUGUSTUS stop_codon 1251141 1251143 . - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_4 AUGUSTUS CDS 1251141 1252427 0.86 - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_4 AUGUSTUS start_codon 1252425 1252427 . - 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MAASIIYLNIVDPVGLGVEREKPAYHIWAELKKKYERRDEMRVHQADTKLRAARFDPSNTTIEEHEKTMKNHLKELRN # LGGSCLDSQFRLIVIASMPKSWRDLLINVKGISSDDAFIHLRQVYDNKKEDEEDIRQHSQVRALIAQEMASFHSANAASAPKKDRPMCTNPNCPPRRR # RTHPIEKCWAPGGGDEGGGPKKAETSITQTANYASDGGNHTVMELFDLCTSPSAPISSTQLPNAHTCRNCVSVSTGYGANKEVIRSVEILDSSIPTHF # QPFDEYTACSARNEKTLLYATSKPRIPQTFLDSAASDHFWVRRVDFIEYENLYGKAGKSAIAGKAGEFEIHGKGTVEFETVVDGIKRRCRLNGVYHTP # SFHHNLISLRTLDAKGMKGEWGRGSLTVRTANGSIVMRGEGKGTMYEVQAHFTPQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 Scaffold_4 AUGUSTUS gene 1254566 1255723 0.96 + . g248 Scaffold_4 AUGUSTUS transcript 1254566 1255723 0.96 + . g248.t1 Scaffold_4 AUGUSTUS start_codon 1254566 1254568 . + 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_4 AUGUSTUS CDS 1254566 1255723 0.96 + 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_4 AUGUSTUS stop_codon 1255721 1255723 . + 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 Scaffold_4 AUGUSTUS gene 1256091 1259480 1 + . g249 Scaffold_4 AUGUSTUS transcript 1256091 1259480 1 + . g249.t1 Scaffold_4 AUGUSTUS start_codon 1256091 1256093 . + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_4 AUGUSTUS CDS 1256091 1259480 1 + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_4 AUGUSTUS stop_codon 1259478 1259480 . + 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLNEGSQREPN # HTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQ # PWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGA # RYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKH # DLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLR # EAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEF # WRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQVLEGLETVK # KHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQRHPRAVTQ # PLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDL # TSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAA # LHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTP # PEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 Scaffold_4 AUGUSTUS gene 1270931 1272097 0.9 + . g250 Scaffold_4 AUGUSTUS transcript 1270931 1272097 0.9 + . g250.t1 Scaffold_4 AUGUSTUS start_codon 1270931 1270933 . + 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_4 AUGUSTUS CDS 1270931 1272097 0.9 + 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_4 AUGUSTUS stop_codon 1272095 1272097 . + 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 Scaffold_4 AUGUSTUS gene 1272148 1273581 0.67 + . g251 Scaffold_4 AUGUSTUS transcript 1272148 1273581 0.67 + . g251.t1 Scaffold_4 AUGUSTUS start_codon 1272148 1272150 . + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_4 AUGUSTUS CDS 1272148 1273581 0.67 + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_4 AUGUSTUS stop_codon 1273579 1273581 . + 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 Scaffold_4 AUGUSTUS gene 1293052 1293417 0.95 + . g252 Scaffold_4 AUGUSTUS transcript 1293052 1293417 0.95 + . g252.t1 Scaffold_4 AUGUSTUS start_codon 1293052 1293054 . + 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_4 AUGUSTUS CDS 1293052 1293417 0.95 + 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_4 AUGUSTUS stop_codon 1293415 1293417 . + 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MGTDQTYVSIAWSYVFPTHGVSTRIAAASITQVATAITFMSEAYAVSPGDTVFIHTIAGGLGLIFTQYAKHLGATVIG # TTSTQEKAELARNNGADDVILYKEEDVVEKVRVLTAGRGVDSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 Scaffold_4 AUGUSTUS gene 1294529 1296297 0.24 + . g253 Scaffold_4 AUGUSTUS transcript 1294529 1296297 0.24 + . g253.t1 Scaffold_4 AUGUSTUS start_codon 1294529 1294531 . + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_4 AUGUSTUS CDS 1294529 1295075 0.24 + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_4 AUGUSTUS CDS 1295132 1296297 0.24 + 2 transcript_id "g253.t1"; gene_id "g253"; Scaffold_4 AUGUSTUS stop_codon 1296295 1296297 . + 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MEANKPRRPLPVPGVRSSSPGQTTQRPSTPTSAPAERPGIQTLASTLPLRPGTPTLAPIPPKPTTVPPSSFYADPKKQ # DATFPPRNKTLHELLEVPEQSQKSSKPGQVEVRPPGVGSSSTTFTNTPISEDYRPPELIPEDDEPTPRFVHAISDVLSDDANPDLTSNPWSNKGKLGN # QWGNQSGSSDAAAWGITDYATNTITTSIAPQIPISSRHDNDELHWWNREYISSRGYPGKGALPVLMAESVEAGIQRLLGKRVGSKGLYKVEITPPDIV # PIEHKEGNVDPPAPQISPSLVRTASNSSLDPSSHTPHRPKSPRPRPPHVPPSALEVNLAGKPHPDAYFSPKENAWMILSWRDTSSSTSIFGGDPLPLF # IPQIRASVYTLPREECRMQGNGMGINCLAYTTGSGEGHRDRQPHDLTHHFHKYPKSIDGRTLDPPVRHWKDDFPVGESIGGDGSMDVDNPTGSKSTAK # PTLDQPLLLDSYVCCQCSFFLVVSSPSHLSSTKSGTGKDIPSPPANEYFPNPNTDQIPNVIPGVIPLQTWNAYVNDRLENPNPSMSKEQTLLGGLETL # LM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 Scaffold_4 AUGUSTUS gene 1297116 1298021 0.61 + . g254 Scaffold_4 AUGUSTUS transcript 1297116 1298021 0.61 + . g254.t1 Scaffold_4 AUGUSTUS start_codon 1297116 1297118 . + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_4 AUGUSTUS CDS 1297116 1297674 0.63 + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_4 AUGUSTUS CDS 1297766 1297937 0.98 + 2 transcript_id "g254.t1"; gene_id "g254"; Scaffold_4 AUGUSTUS CDS 1298000 1298021 0.96 + 1 transcript_id "g254.t1"; gene_id "g254"; Scaffold_4 AUGUSTUS stop_codon 1298019 1298021 . + 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MLILVPRLDLPATVINELRSREVADKFSILGLTPTAWSTDLLCFAYLAQIRCDPAHTPTYFGALQVIMNALVQLSSIP # EYGSVFMNTTNEDNNGNTTSTINRALITSPSSSSTSSINLELITNLYIHEDTRGRWSEVSLANAIEALGFTYTSALREGRCGWLNMEWDGDLVKNQAY # CGDAYGHNRGNVDNPEDERDRLIWETDDYYTSEELVTLIPDEFIVNAWRECFKRDSNSASGGDIEMDLRESGKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 Scaffold_4 AUGUSTUS gene 1298807 1299900 0.4 + . g255 Scaffold_4 AUGUSTUS transcript 1298807 1299900 0.4 + . g255.t1 Scaffold_4 AUGUSTUS start_codon 1298807 1298809 . + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_4 AUGUSTUS CDS 1298807 1299038 0.41 + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_4 AUGUSTUS CDS 1299110 1299900 0.89 + 2 transcript_id "g255.t1"; gene_id "g255"; Scaffold_4 AUGUSTUS stop_codon 1299898 1299900 . + 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MGSMTGMSTAGNDTGSEEKEKAISTSFETPLDHHDASNPVKASLKVKLLEEVTDDDLKKHRVGGRLVTRREIVRSKQY # LFHKLEYADNPSVTPSIDLAKLALVTSKDEEEEVEDESNKADSQSHKAGTDSSQDTDVTLVDDLPPRPTHPLPTYHSTSNSSSSATERPHRTTSPISV # SSSSTSLYTPPDQSHSPPSPTRSPSSVLGKRLRGAGGAGLSREDTELIDDRSIRASSSASPPPSSVASFGSVSRESSGVSEGPPPLVFVSELRQAAAS # NSEDVVMRDASPVREPRGLPKPPQNPPPLPPRRPAPPVHNDSVMMFGELFWPLSHHCRIILSICGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 Scaffold_4 AUGUSTUS gene 1299939 1300460 0.91 + . g256 Scaffold_4 AUGUSTUS transcript 1299939 1300460 0.91 + . g256.t1 Scaffold_4 AUGUSTUS start_codon 1299939 1299941 . + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_4 AUGUSTUS CDS 1299939 1300460 0.91 + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_4 AUGUSTUS stop_codon 1300458 1300460 . + 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MDNCMFQIETALLKFHGEGGEVDEEALDDPGKTSVVKRYVSYFLQSFLCRLTVTSSPRNRLFYGKIRQTFIETLKGEP # TKHEKEDLFSHLPVNVGDEVDLVDRSPSPPYDVAVSPATDGSSKDLQEFSTFDIYDGLGRYFDDTIEYEGQKVPMEVGLVKLPPLLQVQLQVRSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 Scaffold_4 AUGUSTUS gene 1313703 1314407 0.72 + . g257 Scaffold_4 AUGUSTUS transcript 1313703 1314407 0.72 + . g257.t1 Scaffold_4 AUGUSTUS start_codon 1313703 1313705 . + 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_4 AUGUSTUS CDS 1313703 1314407 0.72 + 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_4 AUGUSTUS stop_codon 1314405 1314407 . + 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MVRRSLRIQEKELAPVQSHDLGEVTVPRKRVTRDAEDSEDYAEDSDGGVAPIRRKRKRSKKAANLKSKVESSSKDEGV # PAARTKKQNMPEQFKKVRGKLGLLERVTKDVPMDVIFEVHKIFCAVSCATLILSHVFQIFGHLDPGDLLHLARTSRDLRDILMSKSSEGIWRAARRNV # EGLPPLPNDLNEPQYAHLLFEPYCHVSVYTPTNLIILRILHRYVGIQDAVTMYCGIFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 Scaffold_4 AUGUSTUS gene 1331427 1334988 0.68 - . g258 Scaffold_4 AUGUSTUS transcript 1331427 1334988 0.68 - . g258.t1 Scaffold_4 AUGUSTUS stop_codon 1331427 1331429 . - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_4 AUGUSTUS CDS 1331427 1334525 0.76 - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_4 AUGUSTUS CDS 1334731 1334988 0.68 - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_4 AUGUSTUS start_codon 1334986 1334988 . - 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAVNTVDAKVAV # PLPEPSPSGLQGRWYGTDSTSAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKEL # VALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFR # TRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLT # MSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAI # AAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRP # GKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSL # GSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISM # DFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTER # VNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADR # KRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLVPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNV # AEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 Scaffold_4 AUGUSTUS gene 1335883 1336833 0.46 - . g259 Scaffold_4 AUGUSTUS transcript 1335883 1336833 0.46 - . g259.t1 Scaffold_4 AUGUSTUS stop_codon 1335883 1335885 . - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_4 AUGUSTUS CDS 1335883 1336132 0.94 - 1 transcript_id "g259.t1"; gene_id "g259"; Scaffold_4 AUGUSTUS CDS 1336448 1336833 0.51 - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_4 AUGUSTUS start_codon 1336831 1336833 . - 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL # DTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPWSRRGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAE # DSLGNLKMKETENIRKYNIRFNTLAASTNWDLLLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 Scaffold_4 AUGUSTUS gene 1338040 1339206 0.91 + . g260 Scaffold_4 AUGUSTUS transcript 1338040 1339206 0.91 + . g260.t1 Scaffold_4 AUGUSTUS start_codon 1338040 1338042 . + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_4 AUGUSTUS CDS 1338040 1339206 0.91 + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_4 AUGUSTUS stop_codon 1339204 1339206 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 Scaffold_4 AUGUSTUS gene 1339257 1342972 0.37 + . g261 Scaffold_4 AUGUSTUS transcript 1339257 1342972 0.37 + . g261.t1 Scaffold_4 AUGUSTUS start_codon 1339257 1339259 . + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_4 AUGUSTUS CDS 1339257 1340609 0.37 + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_4 AUGUSTUS CDS 1340696 1342972 0.57 + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_4 AUGUSTUS stop_codon 1342970 1342972 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAHDLYLRPEKCEFEQQQIEY # LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPT # RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYL # SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDN # GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLIT # QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQE # VEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRK # AHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEE # ILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 Scaffold_4 AUGUSTUS gene 1354276 1354632 0.61 - . g262 Scaffold_4 AUGUSTUS transcript 1354276 1354632 0.61 - . g262.t1 Scaffold_4 AUGUSTUS stop_codon 1354276 1354278 . - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_4 AUGUSTUS CDS 1354276 1354632 0.61 - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_4 AUGUSTUS start_codon 1354630 1354632 . - 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MSRFHAEEVVANGVVTFQIKEVLKTFPVGGSVGRVNLVNRDGKNSAFAKINAIEPTGKAQFLYEAMKILKNDYNLVQN # ERELAYWNGIKEKMDAFTATAQKKAKAQAMAQSALALMPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 Scaffold_4 AUGUSTUS gene 1356010 1358602 0.48 - . g263 Scaffold_4 AUGUSTUS transcript 1356010 1358602 0.48 - . g263.t1 Scaffold_4 AUGUSTUS stop_codon 1356010 1356012 . - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_4 AUGUSTUS CDS 1356010 1356336 0.94 - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_4 AUGUSTUS CDS 1356414 1356796 0.9 - 2 transcript_id "g263.t1"; gene_id "g263"; Scaffold_4 AUGUSTUS CDS 1357012 1358602 0.51 - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_4 AUGUSTUS start_codon 1358600 1358602 . - 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MPVRDSEEKETTENAENDGMHCTNTIYFYTNLSADFYSTFWSIQLPFSKPSVFATPNPPMTFAQFQDAVDRVLPVIKE # ATAKERAMMGAGRSASTMGPATLKRKRGQGEETVVTGNVNKKAMEYFFAKFLTSPELLDLEVSPSLHLFLRIVLGRLSLYLDFILSSVPRYETDDPLS # TQLADTHFRRQILFQLLILLDHLLTHTKTEKAKWITTKNRSLHMPIPEWSLDDALNYTGPVDVNATIVTGPSATSGLDAMKGTGTSTSVATTAVTGTK # ITEKNAKNTPAKPSNSKPSSLSAPTALPTASATSTSVPASIPLPSTNTTNITTTPSSNAQHVDKPERMDPIKWTHLTISRTIEELRQTQPPPLSSAGV # SGPASSTAGVTAINGLTGREFASTVQSLLEREKGWIRWKNELCDGTVFEKGVWEPSDELLDSLNSVEGGKDEEGMKLDDENKAAGDAEGKEGRRKKPK # TKTMYEASRGLRAKMRGPFYSTEENQRDWQWDLGTEALTEIWTMGYRGLEDLERGFRWVFQKAEREAKEKEAQAMHEKGDVDMTDVKKECNDVEMKSP # ENGLLPSVKTELLPQPIPVHVSSIHPSLPPKPGSRAVSPLKPATPVPNALPTSAPVVSTITMPKTTAVASTPAPTVLALPQDEQIRKAEENKTRITWL # ALRSARDSAQGHLVHFSKIGAGDVRMLCEEIDKAEREREEKEKAEKDEKEGSMSVDQPDVDKDLETDEKVEKEGELDPPGLGFAGPQVQELDTESDVK # ME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 Scaffold_4 AUGUSTUS gene 1358817 1360472 0.81 - . g264 Scaffold_4 AUGUSTUS transcript 1358817 1360472 0.81 - . g264.t1 Scaffold_4 AUGUSTUS stop_codon 1358817 1358819 . - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_4 AUGUSTUS CDS 1358817 1359261 0.91 - 1 transcript_id "g264.t1"; gene_id "g264"; Scaffold_4 AUGUSTUS CDS 1359883 1360472 0.81 - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_4 AUGUSTUS start_codon 1360470 1360472 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MAVRKRLAAQDAGTLSVRKTDLLEKLQRGKDEDGKYMGKEELTAEALTLLIAGSDTTSNSTCAILYYLARTPSTQARL # HAELDKAVPDIESLPLTVDDVKADKLPYLDACINEGLRIHSTSALGLPRLVPKGGMTVEGVTFPEGTVLSVPSYTIHRDTEVWGDDTEDFRPERWLGL # DGDRKELINKTFNPFSVGPRALATSNVFQNTDALISLVQSALSDASSNTTSNPDNRRMKWEYLIKRDVFQHATLEGKALASSSNEDAEKYYAKLQDWL # DLAWVFTELGATEASYAFSVVQDLLETQTIPSCMKIFDWIERRSRDRVSTIINTTTSSVTATSSSLSSQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 Scaffold_4 AUGUSTUS gene 1364296 1364790 0.41 - . g265 Scaffold_4 AUGUSTUS transcript 1364296 1364790 0.41 - . g265.t1 Scaffold_4 AUGUSTUS stop_codon 1364296 1364298 . - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_4 AUGUSTUS CDS 1364296 1364790 0.41 - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_4 AUGUSTUS start_codon 1364788 1364790 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MVVLAIGATTLAGGLGVSIYSAYLDLRYMWIEHKLARTAELLAKVEAIRAAADRRYEFLEKLTSRSRQMTVEIERLQT # KRMELVRVLDFNQLPTACAVTDDENPAFEGYDVVLQKKETMGKILELVALERHWNAEMEWWHKEAEPEFKRRMAAQVRKVQYFVLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 Scaffold_4 AUGUSTUS gene 1372650 1373466 0.71 + . g266 Scaffold_4 AUGUSTUS transcript 1372650 1373466 0.71 + . g266.t1 Scaffold_4 AUGUSTUS start_codon 1372650 1372652 . + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_4 AUGUSTUS CDS 1372650 1372769 0.89 + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_4 AUGUSTUS CDS 1372828 1373466 0.78 + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_4 AUGUSTUS stop_codon 1373464 1373466 . + 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MAKSKWIFGNQQNQPATVVVNPAPLPIESSADTRQFGLENFGNTWYDQEFTIPCPTCLCLVSYANSVLQALYFCAPFR # DLLLQSPDSPPPAGGSPSENHNPSPLVPVRRKPERKASTSGTISDGASAQAAIPIPPNPASLFSALRSLFLHISTHPSDKGTVAPSAFIEQLRRVNEL # FRSTMHQDAHEFFNYLLNKIVEEIEEDRKVSQHGSGSADDCEFDRICMWKFSIQLSLFFSVQFNNNIRIKSAFYDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 Scaffold_4 AUGUSTUS gene 1378061 1378694 0.66 - . g267 Scaffold_4 AUGUSTUS transcript 1378061 1378694 0.66 - . g267.t1 Scaffold_4 AUGUSTUS stop_codon 1378061 1378063 . - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_4 AUGUSTUS CDS 1378061 1378319 0.66 - 1 transcript_id "g267.t1"; gene_id "g267"; Scaffold_4 AUGUSTUS CDS 1378420 1378694 0.66 - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_4 AUGUSTUS start_codon 1378692 1378694 . - 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MELHTLPNAGVLGVVSLPDDYALITNRNATSIHISDNYEPLIGPDHPFKHDPKARPPPLSIYVCGEELEGMEHFNIDP # VLSHDGYWFYDLDCDMPKIKSLGRYFNTEYQLADYPYGHPPQGDLSVVRQRYLRPEHEHVPFRLNSTAFQHIAETGCSAITWDESTGRVCIATQKNLK # F] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 Scaffold_4 AUGUSTUS gene 1382601 1383002 0.78 - . g268 Scaffold_4 AUGUSTUS transcript 1382601 1383002 0.78 - . g268.t1 Scaffold_4 AUGUSTUS stop_codon 1382601 1382603 . - 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_4 AUGUSTUS CDS 1382601 1383002 0.78 - 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_4 AUGUSTUS start_codon 1383000 1383002 . - 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MRRLSIKKLRRKLVYQGITVEEALAAHEQAEKLYEEKMAAAQEEVIQQQQQEQFIGVDHPHADQVQQDSAEEPPNPKV # TRVTPPEKQDPAVKFRDAKAQAEAKGAWGDGSDGYSPPIDPGDKMRFDACRVSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 Scaffold_4 AUGUSTUS gene 1385730 1386542 0.54 + . g269 Scaffold_4 AUGUSTUS transcript 1385730 1386542 0.54 + . g269.t1 Scaffold_4 AUGUSTUS start_codon 1385730 1385732 . + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_4 AUGUSTUS CDS 1385730 1385863 0.74 + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_4 AUGUSTUS CDS 1385969 1386542 0.68 + 1 transcript_id "g269.t1"; gene_id "g269"; Scaffold_4 AUGUSTUS stop_codon 1386540 1386542 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MMTTRARVQSWDNSTRGLDASTALDFVKSLRVMTDVLGQTTFVTLDGRQVYYGPPSEARAYFEGLGYKALPRQSTADY # LTGCTDINERQFAPGRSAANVPSSPAALEGAFLRSKYSQDNKIALEKYKLTMATDKADQEAFRASVAADKKKGVSKKSPYTLGFTAQVRALVVRQFQQ # RLQDRFQLYTSFTLSTVSHIFQRVRDGHSFFLIKVLAIVLGGAFFALPTTSAGAFTRGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 Scaffold_4 AUGUSTUS gene 1388131 1388769 0.68 + . g270 Scaffold_4 AUGUSTUS transcript 1388131 1388769 0.68 + . g270.t1 Scaffold_4 AUGUSTUS start_codon 1388131 1388133 . + 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_4 AUGUSTUS CDS 1388131 1388769 0.68 + 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_4 AUGUSTUS stop_codon 1388767 1388769 . + 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MRFSAYLRQPAEVSIEEKNAYVEEIIELLELQDLSEAVVYCLGVEARKRLTIGVELASKPELLLFLDEPTSGLDAQSA # WNLVRFLRKLADQGQAILCTIHQPSSLLFESFDRLLLLERGGETVYFGDIGSDSHIIREYFASHGAVCPSNMNPAEYMLEAIGAGVSPRVGDRDWKDV # WLDSPECAKVQEEIEAIKKRGLARPEPDRKAMSTCK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 Scaffold_4 AUGUSTUS gene 1389726 1390034 0.77 - . g271 Scaffold_4 AUGUSTUS transcript 1389726 1390034 0.77 - . g271.t1 Scaffold_4 AUGUSTUS stop_codon 1389726 1389728 . - 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_4 AUGUSTUS CDS 1389726 1390034 0.77 - 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_4 AUGUSTUS start_codon 1390032 1390034 . - 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MKSVIVKVRISMQLTKEREDNKHISPPIVVTDVQWSVELVTILILAILARRGRIAVIEITPERIHKIVGPLATSLARG # WVKNIELVTLTSDDKATDEEMSND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 Scaffold_4 AUGUSTUS gene 1392143 1392289 0.3 + . g272 Scaffold_4 AUGUSTUS transcript 1392143 1392289 0.3 + . g272.t1 Scaffold_4 AUGUSTUS start_codon 1392143 1392145 . + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_4 AUGUSTUS CDS 1392143 1392289 0.3 + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_4 AUGUSTUS stop_codon 1392287 1392289 . + 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MEGSEAIQLAGSNVDEKKNSVDLVTEYDVRVEELVKKEIFTTYPDFKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 Scaffold_4 AUGUSTUS gene 1395101 1395838 0.46 + . g273 Scaffold_4 AUGUSTUS transcript 1395101 1395838 0.46 + . g273.t1 Scaffold_4 AUGUSTUS start_codon 1395101 1395103 . + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_4 AUGUSTUS CDS 1395101 1395838 0.46 + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_4 AUGUSTUS stop_codon 1395836 1395838 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MLLVSIHTVVIVFGLFNLLCAMPVSVSETSYHLNDSFRFSDDLRIQVNNAVGSRSDDESQLSPRRAKPLVDQGFNANL # VPSGPALPPGGAPTPPRTGSPARPPTEQPAGDPATPSTGKVWITFADATTSAHNSNPAFQQEVTDIVKRGLARTAAFSPERHGERIFDFRNSFPGNSL # AQRQVIHCKVEDDWPSGQCGSGCLGSVAFVDDLGPRSFHGRVRALDEDEHESYERYPRVSLPPPPPPSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 Scaffold_4 AUGUSTUS gene 1399894 1400358 0.47 - . g274 Scaffold_4 AUGUSTUS transcript 1399894 1400358 0.47 - . g274.t1 Scaffold_4 AUGUSTUS stop_codon 1399894 1399896 . - 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_4 AUGUSTUS CDS 1399894 1400358 0.47 - 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_4 AUGUSTUS start_codon 1400356 1400358 . - 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MLSQMSDDLAQLFEAQLKYLNASMLFFGCVLFSAMDKHQAVILLVSLQEWIVSKHILSGGYWLSSSGEWVQAGPRVRE # VLTTHPIIQRHLGWIPKEAIKIGILFNGFQKYTQIFVLGYMKPLFPERKTQTVLWSTTKAALVLEQEWRFWHNTPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 Scaffold_4 AUGUSTUS gene 1400854 1403287 0.65 - . g275 Scaffold_4 AUGUSTUS transcript 1400854 1403287 0.65 - . g275.t1 Scaffold_4 AUGUSTUS stop_codon 1400854 1400856 . - 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_4 AUGUSTUS CDS 1400854 1401215 0.84 - 2 transcript_id "g275.t1"; gene_id "g275"; Scaffold_4 AUGUSTUS CDS 1402705 1403287 0.71 - 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_4 AUGUSTUS start_codon 1403285 1403287 . - 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MFERSTSFFQTMPAPKNHFPKASLEHLQSHTVLILLAGFELHETNPQQVQCVACYEANPAGTGGNWMKRSSIKGHLNT # AIHINNAEALSVQKFRAQEEQAQVDAAYTGIANMNIDSFNDPNPATELPLNDKAQGSLPLWAYLDMENTRTLDPETERKNIQHQFQQILIQELFLDDT # SEEDGSETNIIEALSNFGXQPQILVVQVGIARSATQTREQLALQLKAATLGVKSEITEMQRATGTKDKVAQYWIDILLEKSIKMKKEDPNISADELTA # TLEAWLDNQPGDKVNPLLDIAGGFGFKNVLVVELTHFTRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 Scaffold_4 AUGUSTUS gene 1408681 1409145 0.75 - . g276 Scaffold_4 AUGUSTUS transcript 1408681 1409145 0.75 - . g276.t1 Scaffold_4 AUGUSTUS stop_codon 1408681 1408683 . - 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_4 AUGUSTUS CDS 1408681 1409145 0.75 - 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_4 AUGUSTUS start_codon 1409143 1409145 . - 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MALHPEIQKKGQEAVDKALGGTRMPTLSDFGTIPYVDAIINETLRWKPAVTVTIPHGALQDDVYGDYFIPKGSIVIAN # IAAILSDEKAYGARTDEFRPERFMMPDGLLNKSMNSNPAFGYGRRQCTGMGACLSLLRNCTELLMQVYILQLCLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 Scaffold_4 AUGUSTUS gene 1416332 1416863 0.69 + . g277 Scaffold_4 AUGUSTUS transcript 1416332 1416863 0.69 + . g277.t1 Scaffold_4 AUGUSTUS start_codon 1416332 1416334 . + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_4 AUGUSTUS CDS 1416332 1416472 0.69 + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_4 AUGUSTUS CDS 1416549 1416863 0.95 + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_4 AUGUSTUS stop_codon 1416861 1416863 . + 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MVKEQHPQPVKEAISTVLPVWLEAFKVLLNMDPSKDVAEGSNWEGLAALDTIHTSFPRSIAPYLPELVPASLVHLNTL # YTTFDRYYLASTESVPSSSEDETIELPQLITSIMDFVSSVVRAGRVKEWFTGDNAVSLISAIFSYIQMTDDDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 Scaffold_4 AUGUSTUS gene 1417107 1417517 0.4 + . g278 Scaffold_4 AUGUSTUS transcript 1417107 1417517 0.4 + . g278.t1 Scaffold_4 AUGUSTUS start_codon 1417107 1417109 . + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_4 AUGUSTUS CDS 1417107 1417517 0.4 + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_4 AUGUSTUS stop_codon 1417515 1417517 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MLSRKLFLPLTRLAPPEKKIGLFFTVFRLIPPEKLMESRWRPLEAALTAVGSQAETIQECIDDEQESGRNRPIDIESL # LTNVIPTILGQSSELIVAKWSQKITHCDYRIPFPAGKRICIRKPVRQIASGATRGPIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 Scaffold_4 AUGUSTUS gene 1419990 1421456 0.6 - . g279 Scaffold_4 AUGUSTUS transcript 1419990 1421456 0.6 - . g279.t1 Scaffold_4 AUGUSTUS stop_codon 1419990 1419992 . - 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_4 AUGUSTUS CDS 1419990 1421456 0.6 - 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_4 AUGUSTUS start_codon 1421454 1421456 . - 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MSSLSSVVSDLVRASMGSSVAPTVTDEELDKHVRELLIRDAKKRAERYGQQGIRAYLASGLYVLSFPSLSGQALTLAL # FRSDSNAPKANKRFLSSVIRSTDEHNKTILRAQALSAEEIKRERREQEMKERRARAEEAVRAEKLRRSGSSASRRRAGDSEAWDRWDGTTSDRKRKRR # NWETWTGEEDEEERHRSRRRTSYRSSSRSLNNNQESHSHRRSSRRSRSRDDRASSSKIQKRRSPSPRNSHHKSSGQTHSSKRNKEKESYRCDSRSVSP # SSSRDSDREDYSHRPSKHKKDTKDESKPKMRYALSSSDEEDAPRRRSRSLTVQSDLGSAHAYSSSSRYHSPEPPVPSSSSTTLNRESELRKKLQSKYP # AQDTSRSREEERVKEESATTGSSQRNSRSRHSRSPDPKPKRRKASRSSRSSQMSISRSPTPGPEQPGPALPSKMDKYFDESYDPRLDVAPLSAAPKVP # ATALLILPSLKDGILCLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 Scaffold_4 AUGUSTUS gene 1431928 1432988 0.55 + . g280 Scaffold_4 AUGUSTUS transcript 1431928 1432988 0.55 + . g280.t1 Scaffold_4 AUGUSTUS start_codon 1431928 1431930 . + 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_4 AUGUSTUS CDS 1431928 1431958 0.63 + 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_4 AUGUSTUS CDS 1432177 1432988 0.72 + 2 transcript_id "g280.t1"; gene_id "g280"; Scaffold_4 AUGUSTUS stop_codon 1432986 1432988 . + 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MYRCDSSSRHASLSNFKIWPFASCPSFTECPTSPTSRAVPRKLLSDGKWGHTNIAIRGVLISSGGSPDDAASPGYFAS # NLSTDIRAELTTTRRTALHRYTFPSSSAEPRLVVDLTDDGLQSGYDVTLLIDPTTARVTGDAWFEGSFGPGAYHLFTCVDFKGENYEIGSPSEYGSWS # FNTVTQNKTNLSGIYSGSSGALLTFQPATNGTTSILVRVGVSFISSAQACSNAEEEISDWDFERVHSDALAQWNELLGRVQVDPTGVEEEKIQLFYSS # VRKITI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 Scaffold_4 AUGUSTUS gene 1438431 1439352 0.41 + . g281 Scaffold_4 AUGUSTUS transcript 1438431 1439352 0.41 + . g281.t1 Scaffold_4 AUGUSTUS start_codon 1438431 1438433 . + 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_4 AUGUSTUS CDS 1438431 1438747 0.41 + 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_4 AUGUSTUS CDS 1438866 1439352 0.82 + 1 transcript_id "g281.t1"; gene_id "g281"; Scaffold_4 AUGUSTUS stop_codon 1439350 1439352 . + 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MNATARVEVLLAAGVFNDPHILLNSGIGNATELSAMNIPVVNNLPSVGKNLTEQPAISNLWNTTNPVTTVEAEAAYEQ # ALTQWNNTRTGRMVLAISNTVGFTRMNTKISNDLSKNAFDAEANFANAQFILDSVNLVPYSRKSCASLISSTTFKYVVFLGGSITLDPVNPSGPPLID # YNFYSAPQDIQVMRQAVLSALAFVSTPAWQEFLAEPVSPLLAAVVNEYPNVSTTTMDAYIRASTSISFHATGSCSMSPEGAEWGVVDPISM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 Scaffold_4 AUGUSTUS gene 1448592 1449305 0.9 + . g282 Scaffold_4 AUGUSTUS transcript 1448592 1449305 0.9 + . g282.t1 Scaffold_4 AUGUSTUS start_codon 1448592 1448594 . + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_4 AUGUSTUS CDS 1448592 1449305 0.9 + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_4 AUGUSTUS stop_codon 1449303 1449305 . + 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MDEDIDMDAPQISTLREEATPPPPKVNTTRRIKLLISKPSTPSTAPPARQQQPQVQRSILGDDDEEDEEDDQEDQLID # DDDPIRPSDLPPPPRPAVESSSGSPPKKKAPPKRKPRKNDKRPPEEGRLKEKVMQQPGAPNLAPTLLWFEANPSNLNNSESHDAGLPSSEGGQITMLG # PDQPLSLKISGKKKAPAKKASTQKKQQTKTSSAAVASTSASAPPATIKYVFFCDKIDGRIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 Scaffold_4 AUGUSTUS gene 1449432 1450082 0.97 + . g283 Scaffold_4 AUGUSTUS transcript 1449432 1450082 0.97 + . g283.t1 Scaffold_4 AUGUSTUS start_codon 1449432 1449434 . + 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_4 AUGUSTUS CDS 1449432 1450082 0.97 + 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_4 AUGUSTUS stop_codon 1450080 1450082 . + 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MTGTAASSPVAGHFDDVEETPDPEPLAPIPPAVQNSVTEEMNLEGVPIPVYPLPTKPFPVLPPPKVGSGFAPNIILDR # SGTKVRHWRVAKREIRGIGGGRWFAQGWVGEKDSAFASQAEAHPELRKSIGDSPSHVGPLKMSSVSAPVAVRGKGKGKGSSLSTSAAPSRSESQAPEA # GMGGSISVHAPSKMRISQVPIPIGPSSEAGDSDMMGPPDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 Scaffold_4 AUGUSTUS gene 1450791 1451834 0.47 + . g284 Scaffold_4 AUGUSTUS transcript 1450791 1451834 0.47 + . g284.t1 Scaffold_4 AUGUSTUS start_codon 1450791 1450793 . + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_4 AUGUSTUS CDS 1450791 1451834 0.47 + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_4 AUGUSTUS stop_codon 1451832 1451834 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MLQQSEGLKRDLPIWSSGLFPFFEYAATSVKVRRSNNMSLTCTDYLQPTLLNLYDTHYLPLQAGLRPVMKSFILALLP # GLEEETGEFFEKVISLLDRLSGTVSPSFFFQNIWLIMLTTPSARGTALNLLSRRLPQLHGLEDITSIVGSDIGLMIRAFAAALEDENLLVRRSALDLL # LQSMRVDSSAVKRAQAEDRSILMRAAISVVLRRDLSLNRRLYSWLLGPGDKSEQQIEYLKDNSLELLRSTLKEDMLSPSGEYSESRPFKIFISLLDKW # EIGAALSEVLIYDSFKAVKVLANGTSRGQEDISMTANTLYEAVEPHIIWRRLLSVVFQEIVSGDQQFEVGSIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 Scaffold_4 AUGUSTUS gene 1453989 1454399 0.41 + . g285 Scaffold_4 AUGUSTUS transcript 1453989 1454399 0.41 + . g285.t1 Scaffold_4 AUGUSTUS start_codon 1453989 1453991 . + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_4 AUGUSTUS CDS 1453989 1454399 0.41 + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_4 AUGUSTUS stop_codon 1454397 1454399 . + 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MLQAVVAPLNECVGRKLLMSLRDLLKASKREEEFSSDIHSSTSDAEFTMLLNGLERLILLSLTYTSEVNLMEDDASIN # AEKAVEGSGLLGYVSNVFSSDTTYQSSDDQLTVRNSSSSSFLSLYNSVPRFVHSRIMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 Scaffold_4 AUGUSTUS gene 1455408 1455824 0.98 + . g286 Scaffold_4 AUGUSTUS transcript 1455408 1455824 0.98 + . g286.t1 Scaffold_4 AUGUSTUS start_codon 1455408 1455410 . + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_4 AUGUSTUS CDS 1455408 1455824 0.98 + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_4 AUGUSTUS stop_codon 1455822 1455824 . + 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MNASTTSFAPDTPRPGATNEVAIQINEFIATVALPLMRGILMDNDKVSSACANIVYYIVSPALKGKTKPLEVDQIVVT # IIYEMSKIPSAFKTWKSPVTELLNDNKVFNGAPGAAESWKPIVKTVFDTDKTSFPELLSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 Scaffold_4 AUGUSTUS gene 1460852 1461382 0.77 - . g287 Scaffold_4 AUGUSTUS transcript 1460852 1461382 0.77 - . g287.t1 Scaffold_4 AUGUSTUS stop_codon 1460852 1460854 . - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_4 AUGUSTUS CDS 1460852 1461382 0.77 - 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_4 AUGUSTUS start_codon 1461380 1461382 . - 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MPVIKSRLPRPDDPTPRKPPSAPFGKALDLRRVASFNASSDLARKRQKVNGSIANLGSDVRLAHKLTPEGTFKIPPLP # DKNAKLNGSKAKEKDKGKGKATTLDDVFGSESLVEGSSGGAKRKAENKGKRKRENEGGTIDETLQETENKNVRVSIFRQPNYAYFSSAYQTICCSSSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 Scaffold_4 AUGUSTUS gene 1465707 1465877 0.3 + . g288 Scaffold_4 AUGUSTUS transcript 1465707 1465877 0.3 + . g288.t1 Scaffold_4 AUGUSTUS start_codon 1465707 1465709 . + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_4 AUGUSTUS CDS 1465707 1465877 0.3 + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_4 AUGUSTUS stop_codon 1465875 1465877 . + 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MVWQPTMRVCVWAGEQVKIDIKELEDDAMEGVEATNEPGASGSKSNSSVSASGADD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 Scaffold_4 AUGUSTUS gene 1474192 1475214 0.42 + . g289 Scaffold_4 AUGUSTUS transcript 1474192 1475214 0.42 + . g289.t1 Scaffold_4 AUGUSTUS start_codon 1474192 1474194 . + 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_4 AUGUSTUS CDS 1474192 1475214 0.42 + 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_4 AUGUSTUS stop_codon 1475212 1475214 . + 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MQIDFLYNELGICSPSLEDLDSVPSSLYASSSQLHPPSDPFTVSISTPTHPPRHSKSYSPLLLSDDEEQQSDVAYQRI # FAIFVARVEEADAEGRSVLPTSSTPLGLNSVDPTPSLLAWAAALCSSLEDTKRRREAHIQAMYDQLEGLWWRLGVAKEDMDAFVDVNRGSTEECVQAY # EEELERMLELKRERMGAFIGSAREEIQNLWDELMTGEEERGAFGPFVDGTCYEYIPSLGPKSDIPCVDEHTEELLLIHEEEVRKLKEEKRIKAPFLAS # IKKYFDICEEEKELAVAASDQTRLLGRGARDPGRLLREEKMRKRVSKEKPRVSVLISPVFKTYPSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 Scaffold_4 AUGUSTUS gene 1475422 1476012 0.69 + . g290 Scaffold_4 AUGUSTUS transcript 1475422 1476012 0.69 + . g290.t1 Scaffold_4 AUGUSTUS start_codon 1475422 1475424 . + 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_4 AUGUSTUS CDS 1475422 1476012 0.69 + 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_4 AUGUSTUS stop_codon 1476010 1476012 . + 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MPKGTVTPAVRPAPGGANSAPNKRMKYGDDSASRSGQRAPLGAHRGGNTLASSLSQKSRDVSPAKIPGSRSSRLPSSL # HSSTSLPRPIAMPMPKPGTQHHALGHGRVPTSGVFTYSGGNSGNGLFPKGIRSASSTLTGYTADTRHTSGSRAAEKKASRAHRESFRPRPSIDGTDDH # RLGKWAVNGFGGVKEEEEDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 Scaffold_4 AUGUSTUS gene 1481963 1482765 0.93 + . g291 Scaffold_4 AUGUSTUS transcript 1481963 1482765 0.93 + . g291.t1 Scaffold_4 AUGUSTUS start_codon 1481963 1481965 . + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_4 AUGUSTUS CDS 1481963 1482126 0.96 + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_4 AUGUSTUS CDS 1482171 1482765 0.97 + 1 transcript_id "g291.t1"; gene_id "g291"; Scaffold_4 AUGUSTUS stop_codon 1482763 1482765 . + 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MAEFVREQQKEKDAGRMDERDKPTLIERFFAHNATCAPADRLSFEDMTSESMTHLLNFRLAGVDASAVAVAYILWRFA # SQPLSVKQKIQAELDSAMPDAGVIPDWKTLHNLPILDALFKEGLRLHGPIPTFLERLAPKGGPLDLLGYQLPAGTVIGTQSWSMHRNRGIFKDPEEFD # VFRWLDSDQPQDAMLQAWAPYGLGTRICIGQHLARGAIKTVLAALLRNFDVLPFPETNDESMEMMELFVSDHHRVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 Scaffold_4 AUGUSTUS gene 1486730 1487038 0.98 - . g292 Scaffold_4 AUGUSTUS transcript 1486730 1487038 0.98 - . g292.t1 Scaffold_4 AUGUSTUS stop_codon 1486730 1486732 . - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_4 AUGUSTUS CDS 1486730 1487038 0.98 - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_4 AUGUSTUS start_codon 1487036 1487038 . - 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MTGPTKGLGSVGMEVGGMDMEEEVKEAYEVVKRIDVLDVSVEGTEIWVAAENAYNERVSRVENQIIAWLRDRLGTARN # ANEMFRVFSKFNALFVRRKASTYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 Scaffold_4 AUGUSTUS gene 1489492 1490537 0.55 - . g293 Scaffold_4 AUGUSTUS transcript 1489492 1490537 0.55 - . g293.t1 Scaffold_4 AUGUSTUS stop_codon 1489492 1489494 . - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_4 AUGUSTUS CDS 1489492 1489765 0.9 - 1 transcript_id "g293.t1"; gene_id "g293"; Scaffold_4 AUGUSTUS CDS 1489828 1490537 0.61 - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_4 AUGUSTUS start_codon 1490535 1490537 . - 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MDEMINVVHKDRYNNTRFAPSGVRIVVYDKIESLPQLLVEGVPPAAPSINDNAPRDVRLRATAAPFESSLTQFTSATV # QAEATPGQGDSDDVTMDLNTEPIEQVEDVAQQTIPSSIDNTLDNPLVQEPEILEATEDEHQNATIIQQAYRRYSTRKAKERTQLSVSRDKWFDEYLKM # KGVPDGRYRKMMLGPLPHILVFIDLLHIGTQELKNSTKKRLRLPLKSEEADSLDKQLTRTNNVIKKSLKWKKTLEPQSDFHSCRDCLQLRAFVKEIEE # LIQNELPELPIKMSLDTRSEFDLGYKGIAQEPVPRKAVPSKPPKPELNTEDVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 Scaffold_4 AUGUSTUS gene 1501310 1501761 0.4 - . g294 Scaffold_4 AUGUSTUS transcript 1501310 1501761 0.4 - . g294.t1 Scaffold_4 AUGUSTUS stop_codon 1501310 1501312 . - 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_4 AUGUSTUS CDS 1501310 1501554 0.59 - 2 transcript_id "g294.t1"; gene_id "g294"; Scaffold_4 AUGUSTUS CDS 1501728 1501761 0.55 - 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_4 AUGUSTUS start_codon 1501759 1501761 . - 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MTSLTTTKRHVGLHISEYRLDAPGAIGPYSQAIKAGDLLFVSGCIPIDPKTGEIVEGIEEQTAQALKNLIAVVNAGGS # ELGKVVKTTVRVLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 Scaffold_4 AUGUSTUS gene 1502990 1503658 0.51 - . g295 Scaffold_4 AUGUSTUS transcript 1502990 1503658 0.51 - . g295.t1 Scaffold_4 AUGUSTUS stop_codon 1502990 1502992 . - 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_4 AUGUSTUS CDS 1502990 1503658 0.51 - 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_4 AUGUSTUS start_codon 1503656 1503658 . - 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MYKQRLEPLIELEAKLTRLLTAPDEEEPTRLSLSWQHSDVNGFATTSNGRPAPTIMIPQSSLSSHSQSLPVSPTSHPS # PTRSNGNSGSWKSKEVAVHTSMNWRKAFALGGKSKSPKSAHSGEIEGWWEDPDDPVHALNACAPAIQELWKDHYVRQRLQEKGIRLEESADCVPLSSW # PCGATNILYLHSYLNEIPRITAKKYIPTNGTSEPRSHDIHTDMCDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 Scaffold_4 AUGUSTUS gene 1514876 1515517 0.74 - . g296 Scaffold_4 AUGUSTUS transcript 1514876 1515517 0.74 - . g296.t1 Scaffold_4 AUGUSTUS stop_codon 1514876 1514878 . - 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_4 AUGUSTUS CDS 1514876 1515517 0.74 - 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_4 AUGUSTUS start_codon 1515515 1515517 . - 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MRIERQIHHYGSGLNALPLIESFEANPTDYYLLRAGFGGLSGPLSNIDEEGFASASFHSFADTLAWDAYSGDYGPNFS # GHSMGMGTFIINHPDFGWQAFGGNIVATSPAVQVQIKDSVRRRVFIAPLGALLSLDSGAFSTISYNPTAKTVTVTITPVADGTTGAASAPVGRLVIAQ # SAPVAGVGLLKPTSSLATDAGAFVIPFTNGVGTVTLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 Scaffold_4 AUGUSTUS gene 1516546 1517959 0.37 - . g297 Scaffold_4 AUGUSTUS transcript 1516546 1517959 0.37 - . g297.t1 Scaffold_4 AUGUSTUS stop_codon 1516546 1516548 . - 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_4 AUGUSTUS CDS 1516546 1517219 0.83 - 2 transcript_id "g297.t1"; gene_id "g297"; Scaffold_4 AUGUSTUS CDS 1517353 1517959 0.43 - 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_4 AUGUSTUS start_codon 1517957 1517959 . - 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MPSTFQLTCWLLLLAHSTFGQSNTLGLSDGFLSFNTSTFAVQLVKDSQTLYSLTTVDGGFNFIPSDMMADRANNGNYH # LGDITFRARTVGSTAWTTGDTSTSRVKLTASSVSGNTRAAANLAPTLPRGSLLNITRRWVVDDNVLQLLFDVTNSQTSAVEIGSLGAPLEFNNVSRGK # HICIALMEILRQIFTDRTAAQTNTLCILPVGQSPLEGWRFLPESTVLTPFYQSQTFEGLYEWDFHTLAYAEDEWASTTPWNAPTSFVLQPGQTRTYGL # QFRVAPSIREIESTVASTGQPVAVTIPGTILPADQIGKVFLNTNTTVANITVSPAGALTWATNTDALTAGWLGYTITPHTWGRSRLSVTYSDGRLQTI # HYYVTKGATAALDDLGTFLTTSQWYTNTSDPFHRAPSVISYDRSVNAQVTNDPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 Scaffold_4 AUGUSTUS gene 1526351 1527883 0.75 + . g298 Scaffold_4 AUGUSTUS transcript 1526351 1527883 0.75 + . g298.t1 Scaffold_4 AUGUSTUS start_codon 1526351 1526353 . + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_4 AUGUSTUS CDS 1526351 1527883 0.75 + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_4 AUGUSTUS stop_codon 1527881 1527883 . + 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MSGGDVRQIVAAGRIKKKARSRVNSDDEVRRSSLSHVSPEIHNSFFILYVQDESSSYARPTSIGSYDLTHSRRSQTST # SVPTTSTSSLSPDSLSLPHAPLSQPQTPFTTLSSVAMDELYTLERQEALRRAEYEARHAEALRRAELETRQQYQEREWERRERERDRYEEYYDFHGVR # SAHYGGGSHHTRPRDQHHLRHNHPYLDSYSAHSLHSASHPHSMYTNPQPPSHSSSHSSLSSFESSSSFPYIVSPSTSTSTSTSPYPYSGAAGFRLSKS # ATTSPVGTPWEKHGERGYFGMSNERGDPSEDDDQNRELDDKECIVREPQHARDIKSKRRLSGPAWYIAPEGQDRDYPFTSSSVSTLKASASIASLPPD # FRAASHPSQLQSQKRLSGFNRVKSQDNVYAHRESERHSPLSSDSEDGGDVVQMKRRKSYQDVVSAERMIHHEPLSAPHSPKRYRSNVAEFGPSNITHP # SHGNIHGSNAQHGSHLVSGPMAANTNTPAYTPSGSPSLDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 Scaffold_4 AUGUSTUS gene 1528900 1529175 0.63 + . g299 Scaffold_4 AUGUSTUS transcript 1528900 1529175 0.63 + . g299.t1 Scaffold_4 AUGUSTUS start_codon 1528900 1528902 . + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_4 AUGUSTUS CDS 1528900 1529175 0.63 + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_4 AUGUSTUS stop_codon 1529173 1529175 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MDNAQTEPTKEAAMQVDGAELLSETTSKEIDIGTSIGVTSFPSIQPPPSASTGVQAKTINASPIPPRVIQAPPGVTMD # KSTTTTAQTLMAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 Scaffold_4 AUGUSTUS gene 1532076 1533835 0.27 + . g300 Scaffold_4 AUGUSTUS transcript 1532076 1533835 0.27 + . g300.t1 Scaffold_4 AUGUSTUS start_codon 1532076 1532078 . + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_4 AUGUSTUS CDS 1532076 1532149 0.55 + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_4 AUGUSTUS CDS 1532200 1532345 0.72 + 1 transcript_id "g300.t1"; gene_id "g300"; Scaffold_4 AUGUSTUS CDS 1532401 1532421 0.77 + 2 transcript_id "g300.t1"; gene_id "g300"; Scaffold_4 AUGUSTUS CDS 1532699 1533242 0.51 + 2 transcript_id "g300.t1"; gene_id "g300"; Scaffold_4 AUGUSTUS CDS 1533523 1533835 0.73 + 1 transcript_id "g300.t1"; gene_id "g300"; Scaffold_4 AUGUSTUS stop_codon 1533833 1533835 . + 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MGIVPQKNVLFPELSCYQTLRVCVFWKAIKWSKYSDGDEDIDQLLKDCDLGAKIHANANTLSGGQKRKLQLAIGLVGG # SNNEADLLGDHIAILAAPGRLAARGSPVALKHDLGEGYTVQVTFDVQMLPEKNPIASGLGASGEVLQEIRRYAENVSLSIISPRQVSYHLKSKDPVVV # ESVLAMLDENRDAFKIASYDVLGTSIEDIFLDLMHKDEANKAIISGEAEKNTASEVSSELESVQPDSFAAPLKLTSGRAISPLRQADVPDNSTFVDDI # KQNFRNLSLGGVSIDVDSDAALIAWEATAPGLTGPAMLNLASNILYNRALNSSGQSSDTPTLILANYEDFPPVAAGTLFALKWVAFFGAAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 Scaffold_4 AUGUSTUS gene 1536177 1538235 0.18 - . g301 Scaffold_4 AUGUSTUS transcript 1536177 1538235 0.18 - . g301.t1 Scaffold_4 AUGUSTUS stop_codon 1536177 1536179 . - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_4 AUGUSTUS CDS 1536177 1537856 0.32 - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_4 AUGUSTUS CDS 1537925 1537964 0.37 - 1 transcript_id "g301.t1"; gene_id "g301"; Scaffold_4 AUGUSTUS CDS 1538072 1538235 0.82 - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_4 AUGUSTUS start_codon 1538233 1538235 . - 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MPDNRKPVPPNSPRWQPNPDPSTIEIPGLDTSASPQDQIEQIEQLITLKLQVSDSYSVGTEPVREAAKQAAQIRIPTY # EDYETVHEEGSSQQKESEPSEPSPSQAATSSILYDEQDENGHSLASAESSFAPGQAAFSSTPAANRLAHAESSRTSDDSSWSASLESPLVRLDRELRT # FSQDANETESSIVSSTPTPTKPPILREQERSQRSINKGKSREQSEPLLRNLLRQNIHSSVNASAISAEPGPSVSPLRPKGKTPILKDLNPFLPPGSNP # SKWNGLVDLRDASVMTPQRSKRFRDPRSSRKSPTPVKAPDYDSDDDSFDGLPPGMSPPVMISPARPMRSNASIKLGQTPRKDAAARITKDIVADVQGH # LGKSGKLGRGLFPDSSMSTISSPPSMSRYNNSTSSGMVTHESLESLMRQVGLKDPIPGNLPRQDSRQYEYSSANESDSPLQLPTSEPKPDLTQMASNH # LYNTNFGFPAQQFSTNDDEFLMPPPQQYQHDPYYDDDDDDDDDIVNNTAHPSAAFLMASQNKHPMGDDSFDDDDDSMVDGDGDGFGQDALLTGGGDPN # MMIPVHPFARGVSIEDDSFDDSFDNDLMQGNPMSEETLFGVLPVHREQRLGGRALELGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 Scaffold_4 AUGUSTUS gene 1539198 1539746 0.55 + . g302 Scaffold_4 AUGUSTUS transcript 1539198 1539746 0.55 + . g302.t1 Scaffold_4 AUGUSTUS start_codon 1539198 1539200 . + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_4 AUGUSTUS CDS 1539198 1539746 0.55 + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_4 AUGUSTUS stop_codon 1539744 1539746 . + 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MGKDIAVIENGDCLGAEDAKRVREATGAHSVMIARAAECNPSCFSNTPLTDIHETLVPAYIRLSKYLDNNWSLTKFCL # SQFKSSHTKPNGKADEKRVRESIVKSRSFDEVVDIAGGWTGEEDFKEIVRAIEAREGKLHDEAEPATADAELWERLKNSGVYNYYFDFDKPVVSLSCC # RSKIWQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 Scaffold_4 AUGUSTUS gene 1546512 1546802 0.81 - . g303 Scaffold_4 AUGUSTUS transcript 1546512 1546802 0.81 - . g303.t1 Scaffold_4 AUGUSTUS stop_codon 1546512 1546514 . - 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_4 AUGUSTUS CDS 1546512 1546726 0.81 - 2 transcript_id "g303.t1"; gene_id "g303"; Scaffold_4 AUGUSTUS CDS 1546799 1546802 0.81 - 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_4 AUGUSTUS start_codon 1546800 1546802 . - 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MQRDAMGDDEYHPISHKGSNLTQAGGIGYTVIDSIDTMLIMGLEDDYARARKWVDTRLSFDRDAEFNTFEVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 Scaffold_4 AUGUSTUS gene 1548335 1548700 0.81 + . g304 Scaffold_4 AUGUSTUS transcript 1548335 1548700 0.81 + . g304.t1 Scaffold_4 AUGUSTUS start_codon 1548335 1548337 . + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_4 AUGUSTUS CDS 1548335 1548700 0.81 + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_4 AUGUSTUS stop_codon 1548698 1548700 . + 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MRTYSTLIPFVALAFTFAANAVPTSYSSSGNTYNSKASVRELDSDVVEARGFVVDDNSLEERSSALSTEGDHFSTAPW # SVAHFIPEGPTSPMKSNVQSSLERRINQNLAFGLGELPWQVSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 Scaffold_4 AUGUSTUS gene 1549503 1550048 0.95 + . g305 Scaffold_4 AUGUSTUS transcript 1549503 1550048 0.95 + . g305.t1 Scaffold_4 AUGUSTUS start_codon 1549503 1549505 . + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_4 AUGUSTUS CDS 1549503 1550048 0.95 + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_4 AUGUSTUS stop_codon 1550046 1550048 . + 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MAFNSKPVDPNDPDAFFFVTLPPVEKGATLADYPGGWTECCVSGDVKRVIENTPGFPSPPLQPLGGKPYRIADAGDKG # LGVFATRMIRAGELIMDERPLIVTPNSNTEFLRDKAFIRKLQEYSLEQIRQITLHEMDKRVKKSFDRMPLENQKAFMDLFNSHSHDGSGEYIGYAFNT # SLHSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 Scaffold_4 AUGUSTUS gene 1552194 1553260 0.79 - . g306 Scaffold_4 AUGUSTUS transcript 1552194 1553260 0.79 - . g306.t1 Scaffold_4 AUGUSTUS stop_codon 1552194 1552196 . - 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_4 AUGUSTUS CDS 1552194 1552559 0.95 - 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_4 AUGUSTUS CDS 1552724 1553260 0.82 - 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_4 AUGUSTUS start_codon 1553258 1553260 . - 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MSASSSKPRTYNEKYMGRNGFTEKPTTKAQKLEVHQHALDIIRHCGVRLPRQVPILILILRPPSFLFQPVSSNISSVS # SVETIMNTDWTKPAPETSASVQKEIDELRKRHGALLSRLYDLNASAYLDDVEDRYRSRNEVLDEDPREWMKREYKDNPKALDVNYSQAEVDVMIQTSN # AQKLIDLQRKLLSVKKEEEIKLQREHERLQQEMYNRQRREEEARRQAQIEKDRLEKKFPTTVEEFYSKPMDFRNLIARFLDAGPLQDKQLRANNWTQE # EVAPLKKIYNKDVCACLVDLSLVRSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 Scaffold_4 AUGUSTUS gene 1556700 1558583 1 + . g307 Scaffold_4 AUGUSTUS transcript 1556700 1558583 1 + . g307.t1 Scaffold_4 AUGUSTUS start_codon 1556700 1556702 . + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_4 AUGUSTUS CDS 1556700 1558583 1 + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_4 AUGUSTUS stop_codon 1558581 1558583 . + 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MIIQTVSIKGPNNKYLSCRPNDGSLGFDLIDLDPSCKFFMVPWGAGRTCLKGPNGRFVDLHGIRFRCDGIYTGAGFIV # SDTTLQLDSGKYLSNVVENNTITANDTATHLVIKSTSFESFHVSTSLSVPAITYNSDVSVEDRYRPGRNYLALKNYSGTIDIIFSIPYSMDGERNGTV # ELIVNHMRDASGGIIDINLNNQPLFPRYSHTTTRFEAQNLGSLVLSSLTGENTLSISLAEGYLGNYYFSDAALVFKDSKGYVKQENSVYAIGLSSGSS # YNGGSLEDSLRKGNPYLSIEGSTSWSRVTFTVREELLGIGNCVMKIQHRRESGTSIDIFLNGNKIEAGYDTIPTDSFGTSSFYIHSSDLKKSNELVIR # PKNGKYYISDINLDVVSLLPDVTQKNFETYIKDWVLHHRRNIGELNKIPREDLPAWKFVHEAPYWFFIPFLPCSPEEIGVLFDYYNMMFVSVAFEIRD # FNNKARDFHRELLSTDLPRKNALRHAYWTAMLSRRFGLYFALDLSTAHEEAHVDLTIEGPYDHVTDKINNAVGSLLGSRTPRAKDLQGVIDAAWASGE # LAYAKDFRETSGGQTANVYWQKPLDVMAKKYNVKPKFSQTEKDTLEKMRVNVPDVPDIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 Scaffold_4 AUGUSTUS gene 1565826 1566827 0.76 + . g308 Scaffold_4 AUGUSTUS transcript 1565826 1566827 0.76 + . g308.t1 Scaffold_4 AUGUSTUS start_codon 1565826 1565828 . + 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_4 AUGUSTUS CDS 1565826 1566827 0.76 + 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_4 AUGUSTUS stop_codon 1566825 1566827 . + 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MATEEPFKSSLSPESTDFLPPGAFVVAGLIQATEFAQYLEENPEIVVKQLLLSDSSVWDIENNYGFLNTSKYYPRRPV # FTDSVWAAFGGPEDDLDIPDEEADAVAHNTKLSRKRKRSLRDHPAVLDRILNRTHTSLETFSYLLYIENCPRYNRRRPLNPEAAKELRLFNRDFPRLR # DLTVKASGVWKPLARTCNTANAGRKVPDDLEDGQMRRMQGFPQLDTVTHLHIMGNQDTCDCERRSLSSYRDQFENLSHFRLTDQRLLPHEFNPCHVNA # AGFRGMVEVLIRGVSLGEEWLRPLWKKIKGKFLGVSYEEKCRYVSFFIAVPVANYSTSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 Scaffold_4 AUGUSTUS gene 1568087 1569466 0.97 - . g309 Scaffold_4 AUGUSTUS transcript 1568087 1569466 0.97 - . g309.t1 Scaffold_4 AUGUSTUS stop_codon 1568087 1568089 . - 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_4 AUGUSTUS CDS 1568087 1569466 0.97 - 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_4 AUGUSTUS start_codon 1569464 1569466 . - 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MEPVLDDFNDNENENTDTDLEHENTDTDRTDGEETNTTPSQSRSSSLHPISRQNEQENDSVDVFDGYSFKGRHSVLID # DEQEDGEISEEEETDEDEDEDEDIASGLLGDLAPPLLGEATTEIPEEEEEESPEPKTPEARPVSLPVDEEGVPPTATPSREPSNASLSEVPAAIVEAK # PRRSKEVPAEPAPPPSPPADKLKPALPPKTQPPKASRPARRKERSGVHALDRYLSDGPDEAEATSRDEDDDEDWDFIEADGGEDRNGAKGASLFARGV # VDRYRLAVFRKASTPSRSGTMSRSVSGLSKTSDLDATASPEESPSPSIRRGRNQGLTFRKTPRQFLRPRSPPPSSFSSKSAKTLNHSNSATMSSSSSS # GGLFTPAPSVGGSTVPVSSHSLKSKESAASVGAQSYSSDTSATGDTPADQVVEEPEKYKNKKLKKYKENAEKVFSIFSNSPRPSNPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 Scaffold_4 AUGUSTUS gene 1575200 1575881 0.71 + . g310 Scaffold_4 AUGUSTUS transcript 1575200 1575881 0.71 + . g310.t1 Scaffold_4 AUGUSTUS start_codon 1575200 1575202 . + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_4 AUGUSTUS CDS 1575200 1575355 0.96 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_4 AUGUSTUS CDS 1575657 1575881 1 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_4 AUGUSTUS stop_codon 1575879 1575881 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MSSKETADVEKATSGNNPSPTITARAVASKPVVTYDDDEGEESDTYDDFDQESGVTNGIPEVDAEEDEDEDEGEDYHE # GDEDEDEDANGTFRAPASTTTNGKKRSIGDLREHDDDSEGAQTKKVKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 Scaffold_4 AUGUSTUS gene 1583746 1584660 0.49 - . g311 Scaffold_4 AUGUSTUS transcript 1583746 1584660 0.49 - . g311.t1 Scaffold_4 AUGUSTUS stop_codon 1583746 1583748 . - 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_4 AUGUSTUS CDS 1583746 1584098 0.58 - 2 transcript_id "g311.t1"; gene_id "g311"; Scaffold_4 AUGUSTUS CDS 1584162 1584660 0.84 - 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_4 AUGUSTUS start_codon 1584658 1584660 . - 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MSVKVRVFTTWNLLSGIYHTFTGVLKAVANVNDTIAPELIKAGLSVTSQKEIDDFLIKLDGTPNKGKLGANAILGVSI # AVAEAAAAEKGVPLYQHLAELAGVKPPYVLPCPAFNVINGGSHAGNKLAFQEFMLLPTGATSFSEAMKIGTETYHTLKKVISAKYGIDAVNVGDEGGF # APNVSGADESLELLSEAIKKAGYEGKVKIALDVASSEFYKEGKYDLDFKNPTPTRPNGSLASNSLTSISATLRSTLSSLLRTPSTRMIGKRGPTSPRT # AAFKLSVMT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 Scaffold_4 AUGUSTUS gene 1585680 1586141 0.53 - . g312 Scaffold_4 AUGUSTUS transcript 1585680 1586141 0.53 - . g312.t1 Scaffold_4 AUGUSTUS stop_codon 1585680 1585682 . - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_4 AUGUSTUS CDS 1585680 1586141 0.53 - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_4 AUGUSTUS start_codon 1586139 1586141 . - 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MDSVAKIILSDWVRGRIPFFVPPPERPEALNKAEEKAKKIKAKNDTKGKSKVVDETGEAEENRPGVKQNLGSIMQKNK # FLAEDIQPLEEEFAGVSVDDEEKESEDDSGMRQEVLTMEKRRTLPGTMCSKEYIMMKRLRGHKVGKLFVFASIAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 Scaffold_4 AUGUSTUS gene 1586761 1587364 0.8 - . g313 Scaffold_4 AUGUSTUS transcript 1586761 1587364 0.8 - . g313.t1 Scaffold_4 AUGUSTUS stop_codon 1586761 1586763 . - 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_4 AUGUSTUS CDS 1586761 1587167 0.8 - 2 transcript_id "g313.t1"; gene_id "g313"; Scaffold_4 AUGUSTUS CDS 1587274 1587364 0.96 - 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_4 AUGUSTUS start_codon 1587362 1587364 . - 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MTLLILILRRYFELELPEEIYSDEIIALSHPFEDADEAATATGNVIGVCVLLYLRSWSSLTILEPLASSIVETQTHAD # YNEPIYAKGTSRRIYGELYKVIDSSDVILHILDARDPMGTLCESVLEYIKKEKAHKQVVLVINKCDLVPNWVTVSISNWIYVPCSGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 Scaffold_4 AUGUSTUS gene 1588001 1591654 0.39 + . g314 Scaffold_4 AUGUSTUS transcript 1588001 1591654 0.39 + . g314.t1 Scaffold_4 AUGUSTUS start_codon 1588001 1588003 . + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_4 AUGUSTUS CDS 1588001 1591654 0.39 + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_4 AUGUSTUS stop_codon 1591652 1591654 . + 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MISCLNVLPPGAGPWHRGRSSDTDTEREFGSRSRTRSERGHMNGRSHSPNATEDVARSAAALEGSLDSAPPISYWSAK # RHSSCGNPTPAPPWSAKPISWRHTSSLPTKLKTANAALVLCLNIDVDPPDVVKTSPCAVLECWVDPRSMPSIKALEHIGANLKSQFENLSQKIQYKPI # LDPSFEDLRKACQQLRKQAKDDAVLFHYNGHGVPKPTSSGELWCFNRTYTQYLPVSLQEIQNWLGSPGVYIWDCSAAGHLLHNFNEFAKRRDEDIKRK # HGGQFPEGMLPFAQSLQLAACEAHETLPTCPDLPADMFTSCLTSPIDIAIRHHMLTNKIDLNIDGAAHMPGNLKDRRTPLGELNWIFTAITDTIAWTT # FTPEMFARLYRSDLLIASLFRNFLLAERLMKGYNCTPHTSPPLPSTNTHPLWATWDLALDSCIRQLPDLLAANEAQQNYDGPKSPPYQYIPNSFFADQ # LTAFEVWISRGGSALTRRGPLALPSGTEYEVALTAAQTTPLSPNLAASWSSTPHLVPRKPPTQLPIVLQVLLSQPHRLRALILLSQFVDLGPWAVNLV # LTVGIFPYISKLLQAPGPDLRPVLIFIWARILAVDPSIQVDLYNNAQGYKYFSKILTMHPSTSGRDVVQTLPNTSEHLAMCTFILASLARDFSKGQQA # CWEENVFDACFNLLDEADFLLRQWSCLCIAQMWCGSEQGKMLGVTRGTQDKLVNLMSDDSAEVRCAALYALGTFMGSSGSKVETEGTKGGGGSGGMYD # RDERTHFRMEVAVVTGATLVVREDASPMCRKELVVLVSCLVKEWRGYFVVCAWIYWEEERKRRHATVYPYVSANADEVSEQAVREWLDSIPDAGLREE # SRVLLSSFYTIFVVLLDLSVDPYNEVATQAQTVVDYIMALLLESPFTKLDEASLGSPPLAPINYINPNHPDSRPENRDARSRISSGSQQSSPSLSYPA # HPVIAPPSPSASSIRSDAPPVRPSLSRADTMTSTISNTVTSTVKRTSSIANALKNLAGGINFPPMEDTRTASPTPSVYNFHLNGTSHHLNGDALEQME # ASRPPSPTFNVAQYASPYSRPVTPTQSDAVYSPYPSSSSRSPSLQEFTQQVHDFRPSDVMEALMEEDMERLRARKRLKRGMNGYTQQYHNNGYGTVPS # PSNSTFSVDSAGSSVILGLGTGMGIRDVLPLKSTFFDWCSEYFTEPQMRVKSYYHLRFVSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 Scaffold_4 AUGUSTUS gene 1594717 1595100 0.55 + . g315 Scaffold_4 AUGUSTUS transcript 1594717 1595100 0.55 + . g315.t1 Scaffold_4 AUGUSTUS start_codon 1594717 1594719 . + 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_4 AUGUSTUS CDS 1594717 1595100 0.55 + 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_4 AUGUSTUS stop_codon 1595098 1595100 . + 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MSDEADMSGGESSLFSSTSTSSSSSSVASSGSPSASKGSHIMREHGYGSRLIRPEPLEPIMTENGEPMLDPGVTCSTT # FDLYDRAHSVCKAELLTQVGWVALYDGSDSLSDDVRPTPSHESLSPAPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 Scaffold_4 AUGUSTUS gene 1595575 1596233 0.89 - . g316 Scaffold_4 AUGUSTUS transcript 1595575 1596233 0.89 - . g316.t1 Scaffold_4 AUGUSTUS stop_codon 1595575 1595577 . - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_4 AUGUSTUS CDS 1595575 1596124 0.93 - 1 transcript_id "g316.t1"; gene_id "g316"; Scaffold_4 AUGUSTUS CDS 1596211 1596233 0.9 - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_4 AUGUSTUS start_codon 1596231 1596233 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MQHLPYHIPKTAQIIANPHVNIAWWIEGTQEQFRISGVGSIIPSPQDPLYKQFIYSTTSSAISSPNTGMAALSRENFD # WEAKRKEVFKTMSAHMKASWCRPTPGSPLIGGQEEAKTWPERVDEPKDSDESDESEEEKKNRKNWDVALRNFALILVDPTEVDYVELGVFPNRRTLFN # KSTQGLWKEQELVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 Scaffold_4 AUGUSTUS gene 1601086 1601472 0.85 + . g317 Scaffold_4 AUGUSTUS transcript 1601086 1601472 0.85 + . g317.t1 Scaffold_4 AUGUSTUS start_codon 1601086 1601088 . + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_4 AUGUSTUS CDS 1601086 1601472 0.85 + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_4 AUGUSTUS stop_codon 1601470 1601472 . + 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MGKGNKKVSNKNGVGTNVETPKVSNKPKKERAKPIEWGDNPGWIRKAIQYLINNVEFRLKLFSDSTVDAKAEDRKKSQ # GKEGKINMFSTLAAHIFTSNDEPIAQQEWRDEYAKDPHCFATSLQQQFAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 Scaffold_4 AUGUSTUS gene 1601717 1602607 0.84 + . g318 Scaffold_4 AUGUSTUS transcript 1601717 1602607 0.84 + . g318.t1 Scaffold_4 AUGUSTUS start_codon 1601717 1601719 . + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_4 AUGUSTUS CDS 1601717 1602607 0.84 + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_4 AUGUSTUS stop_codon 1602605 1602607 . + 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MWSELPNYNPIGVSNATSGSNHSNNTSELFGQSVAPTRSQLAMTRLPDQDEESNNDDDAADSGLDVPTWDTTTNHMHF # SSSAGSELADDMDQLDQLDDHHRTPPPKPALTKEKKRERKKERDGKEGKKRQFDAADLDEIHLKELDDAAQRRDSRTALRMKELENTTARIAAKREKM # RLDEKKLELEKQSVALQAQTTQQTFMMMNNLLMAFAPQNTIRGHLNAMGGSNIAGPSMPTFNSFTGMNTTGQEFAPTSTSSPLPEIPALQPGDSSQQG # NGFNASLSGNNTDYPDFNFDQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 Scaffold_4 AUGUSTUS gene 1605721 1606786 0.23 + . g319 Scaffold_4 AUGUSTUS transcript 1605721 1606786 0.23 + . g319.t1 Scaffold_4 AUGUSTUS start_codon 1605721 1605723 . + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_4 AUGUSTUS CDS 1605721 1606318 0.38 + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_4 AUGUSTUS CDS 1606371 1606409 0.46 + 2 transcript_id "g319.t1"; gene_id "g319"; Scaffold_4 AUGUSTUS CDS 1606509 1606786 0.46 + 2 transcript_id "g319.t1"; gene_id "g319"; Scaffold_4 AUGUSTUS stop_codon 1606784 1606786 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MPRENSFSDSDGRSLTPDLDEEISGGGISPTSPTYSIPRDQLLAEPSFSSAPKESTETSAHSASSIRKKDATGPSTTS # FPMATRPELGPRDRFRSSVRKVMAMRRSTTLLQNNNIGAEPGVDPRRATADLQYGGIKQDCVIELIDYSSTSISYGRMTNKELVNMLGDKSASARQSW # AKVRWINIGGLSWDVIKAVSLKYDIHPLALEDVFHTLDSAALGSTLTDAPRSSSPLPFEDGEGYEMLEKNDKAWFGSPFGSRKSSTLRQRGGIKKREK # DLEEGSLKKAPSLFSLTQNVSSSCIDMIWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 Scaffold_4 AUGUSTUS gene 1611838 1613659 0.44 - . g320 Scaffold_4 AUGUSTUS transcript 1611838 1613659 0.44 - . g320.t1 Scaffold_4 AUGUSTUS stop_codon 1611838 1611840 . - 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_4 AUGUSTUS CDS 1611838 1612296 0.64 - 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_4 AUGUSTUS CDS 1612541 1612863 0.61 - 2 transcript_id "g320.t1"; gene_id "g320"; Scaffold_4 AUGUSTUS CDS 1613464 1613659 0.63 - 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_4 AUGUSTUS start_codon 1613657 1613659 . - 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MNDNDVQDIRDIVNKGKVDPEGNEVLAAKMKKLADNPNFTNEDQKMLDSMRMWKEREDHERTVLPGIFQRLLPVARQH # SHRIIAINRREYPNSTPYTSAELSIFAQGSNEERSRLLLGEGTHLALLLDGLVQSLSLPPNIVIIGWSLGTIFTLSMLASITSLSPSVQARLRGSGND # NTRRTSPFDATSPEELATLTDLRPGARCDNYLIAPTFMDVERSIVYKALFDSTTRSTWSGVDVWHLVGDKATHTVHMATWYLKDQVELAGTPHPAILF # AENPGASHFVRFAKSQLSCNSFILILQYMWEDPEGAMKKLEALTRPLKCDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 Scaffold_4 AUGUSTUS gene 1615677 1616636 0.77 + . g321 Scaffold_4 AUGUSTUS transcript 1615677 1616636 0.77 + . g321.t1 Scaffold_4 AUGUSTUS start_codon 1615677 1615679 . + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_4 AUGUSTUS CDS 1615677 1616404 0.77 + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_4 AUGUSTUS CDS 1616459 1616636 0.79 + 1 transcript_id "g321.t1"; gene_id "g321"; Scaffold_4 AUGUSTUS stop_codon 1616634 1616636 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MDLNPLFTGAKSFRPNGTGGELKLFEQVGIDLIHGWLVDPESPEAEAISHTEDYDSAVMLIAEADHVTKGRFVVDDSD # IPQAESSKSPVYSDEERVKIENGVYCAAPLCKCSLNCTIATSIRRFLDNTQSQLTYHGLFHLASTTKPGALMALFRNLHLSVLYKRDTPEDTSLYNLV # TDYIFLNEPSIVWERIEDVQGSMSTFVDSLFIKSSPAGGDFAGQTAEEALRAAEMEQGEFYPSDPADLALAQQLQAEEQEGARREREWYAREKERRRL # DEVQKQQEKEDYKQRRGKKEKKECIIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 Scaffold_4 AUGUSTUS gene 1616659 1616979 0.8 - . g322 Scaffold_4 AUGUSTUS transcript 1616659 1616979 0.8 - . g322.t1 Scaffold_4 AUGUSTUS stop_codon 1616659 1616661 . - 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_4 AUGUSTUS CDS 1616659 1616979 0.8 - 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_4 AUGUSTUS start_codon 1616977 1616979 . - 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MYSAFEAPFRHPIVKEASSKLAQSLREAGVTDVFVVGLAMDYCVQSTAIDAVAEGFKTYVISEATKAVDPTEQGWKKT # EKECHKAGVKFIALAGEELAKVRSMQDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 Scaffold_4 AUGUSTUS gene 1627657 1629402 0.19 + . g323 Scaffold_4 AUGUSTUS transcript 1627657 1629402 0.19 + . g323.t1 Scaffold_4 AUGUSTUS start_codon 1627657 1627659 . + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_4 AUGUSTUS CDS 1627657 1627666 0.64 + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_4 AUGUSTUS CDS 1628143 1628513 0.35 + 2 transcript_id "g323.t1"; gene_id "g323"; Scaffold_4 AUGUSTUS CDS 1628570 1628759 0.99 + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_4 AUGUSTUS CDS 1629026 1629402 0.54 + 2 transcript_id "g323.t1"; gene_id "g323"; Scaffold_4 AUGUSTUS stop_codon 1629400 1629402 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MSIDLLGSFVMSSTVSVPATATTAQERPHVVPTGFQHPLDPLTADEVTFFPESECYRYLHLYQIAAITFTVRHYITSN # SELDSIKAVKFITTYLLPPPKKAVLAYLGIPLVPETAPEPPAQIVRRAEFLDVVNGFSYNVILSLHSEGKWVVDTFDKLPNGVQPQISVEELIRCEKI # VKADQNVQDLAKAVDANTEEVLQIDFPPHYKSTANGPVLSVPKTEIPPLSSAEESFKISNRERIPPPKKAFDFLPDLMAKTEEVLGPAGIEAKEKKQF # KPREDIKPLHILQPEGVSFSKNGNELEWQNWKMHIGEHIVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 Scaffold_4 AUGUSTUS gene 1629985 1630761 0.94 + . g324 Scaffold_4 AUGUSTUS transcript 1629985 1630761 0.94 + . g324.t1 Scaffold_4 AUGUSTUS start_codon 1629985 1629987 . + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_4 AUGUSTUS CDS 1629985 1630761 0.94 + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_4 AUGUSTUS stop_codon 1630759 1630761 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MTDGFDSEYIWNYLFYQDGSIEIEARLTGILQVYAQQQGEPNSFGTTVAPGVNAHYHQHMFSFRIDPMVDGIKNSVVE # QDVIPIGGEKSATGEDFNFAGNAFTTTETVLEKEGGREYDFAKERRWRITNSARKHYASGKDVGYSISMKGGITPIMARSDSWALRRAGFTQYPIWVV # KDVEGPKGGRMWPAGKYVPQTRAQPEDSVGSWVAGKLPVKDEDLLVFLTVGTTHIPRPEDWPVYVPYWFPVLHMIDIEISFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 Scaffold_4 AUGUSTUS gene 1631486 1632259 0.64 + . g325 Scaffold_4 AUGUSTUS transcript 1631486 1632259 0.64 + . g325.t1 Scaffold_4 AUGUSTUS start_codon 1631486 1631488 . + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_4 AUGUSTUS CDS 1631486 1632259 0.64 + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_4 AUGUSTUS stop_codon 1632257 1632259 . + 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MCVCLISCSKFYLLTRINQGPWLQLPVELLESLFALNLDPATLTVPEPIPQPFSSSRIPITGTTNLKLRDRGFESLRS # ELDSPGGGRFIDHEHYMLTTTTQLPPPSPLPLLKPGTAPPPPIDPGVLKNVTSIRRLIDEAAELSVRASSGLSAAELSSPGVFGGMSGYALNGSTWAA # AQTLGINPLGGNGGRNVAMSAMRIHRLRALAVQKLAQAYKADEIASSVMVMQGGSVFDDVAEKVLKVGTCCAVVHVSFATY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 Scaffold_4 AUGUSTUS gene 1632560 1634176 0.81 + . g326 Scaffold_4 AUGUSTUS transcript 1632560 1634176 0.81 + . g326.t1 Scaffold_4 AUGUSTUS start_codon 1632560 1632562 . + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_4 AUGUSTUS CDS 1632560 1634176 0.81 + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_4 AUGUSTUS stop_codon 1634174 1634176 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MLRHDHKDFDNPGGKGSMREKGGRGAGASGKKKKGRNTGGGRRRTNGQAPPNGTSAAAEDGDEEASGEGDSAIGDVGD # LPPPLHPSALPDAPDPIEPQLLFLRGSAYLQKAVHLIELTVLDVEGLDENARPKEETFKSKHYFKNNPPHHYAFDTSELRLCYLQDSLYGGVEIGNPG # GPLGSSDGPKLKAYRKALAADGFREQITSYIKKGIRDHERFLSHFDTLEADPSHEKGKGGTGREDLKEQTQYAFTLSESTRPGNYSTSSGPSSPYTGY # STHTPPPVTMFTTYHPLVVESHYTILLALLMLGNFSRILPTFIRTASLVDGLEGYPVFLPPRSMAQAEFVEVLERLAGGWKKGHFEDEYALVLRGRNA # TTPPSSPPVSRAASIYSPASTSGSSSPTTTTTDLYDDVLGTESSATDVGEGGSSTSEPGCSASASTATASSASVDTFASSTISSNVSPRPDAADALDS # LRILLAPVIARQRERAEAAAAEKKKEKTKGKRKGGQDSPMPLNIPLHGPRVEVVLAWLAAVHLPELDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 Scaffold_4 AUGUSTUS gene 1641107 1641490 0.55 + . g327 Scaffold_4 AUGUSTUS transcript 1641107 1641490 0.55 + . g327.t1 Scaffold_4 AUGUSTUS start_codon 1641107 1641109 . + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_4 AUGUSTUS CDS 1641107 1641490 0.55 + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_4 AUGUSTUS stop_codon 1641488 1641490 . + 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MAKPLELECGNDSDSAEILNGQMCLKSASCEFITANDLAEDFLAIVEVEPQVNVRNYSVECQQVPQGSELHVPIMTGS # HNRDIESERKLMKTLNKIFWRILFILSHDEIVERYEGNIESLCSPQPNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 Scaffold_4 AUGUSTUS gene 1641571 1643016 0.86 - . g328 Scaffold_4 AUGUSTUS transcript 1641571 1643016 0.86 - . g328.t1 Scaffold_4 AUGUSTUS stop_codon 1641571 1641573 . - 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_4 AUGUSTUS CDS 1641571 1643016 0.86 - 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_4 AUGUSTUS start_codon 1643014 1643016 . - 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MKALVKRSSADCHNGSLIPNRESQICWLYGGAGVGKSSVAQTVAERFAHEGKLAATFFFWRDDPARNSIRRLIPSLVF # PINQCHSEATHSDKRLVESNIMILDAPLEEQFRELILQPFQGLDDSEESSPLLVILDGLDECIDGRSQERVLLSIARGLVSGGIPLIFLVTSRPEPRI # KNVFETLAHICTRVALEDSDEDIRKYLSDGFAQIYSRRSTTMYQVHQPWPTSKQLDELVYKASGQFIFASTVLQFVDDDYSLPSERLRIVLGLTDPED # VHNIVGVPLFDEPEYASSDRPFGELDKLYQGILSANPNSEQLVRIIGSIVVFHDIMTPTTKMLEELLALQPGAVSATLSGMHSLLKTTPDLTHVPPHL # LPIEFAHKSFSDFLLDPNRADRFFIDRPAHHNYLTRRCLKLMREKSLSPSFAGRMQAWGCARWSGSNLSHMLLVRMVYHCNWAYHCTSAITTPELMSY # GQQTSMLMLIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 Scaffold_4 AUGUSTUS gene 1643601 1644078 0.22 - . g329 Scaffold_4 AUGUSTUS transcript 1643601 1644078 0.22 - . g329.t1 Scaffold_4 AUGUSTUS stop_codon 1643601 1643603 . - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_4 AUGUSTUS CDS 1643601 1643903 0.34 - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_4 AUGUSTUS CDS 1644037 1644078 0.22 - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_4 AUGUSTUS start_codon 1644076 1644078 . - 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MDDLSEEENELDELCRLEDAHSLRGEERCTFHHPLIISSDIFNSVLQADEDESEDSVSAASASGGPPSVLEDDGDGEN # DLDASMEDMDDSMNNEDDEDDEDNDGMDDEEDLDDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 Scaffold_4 AUGUSTUS gene 1645119 1645868 0.47 - . g330 Scaffold_4 AUGUSTUS transcript 1645119 1645868 0.47 - . g330.t1 Scaffold_4 AUGUSTUS stop_codon 1645119 1645121 . - 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_4 AUGUSTUS CDS 1645119 1645868 0.47 - 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_4 AUGUSTUS start_codon 1645866 1645868 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MLYRPLFWTSYWCEDWLASSGYRGGCEYILISSASSKTAFCFAYSVRKRIERGLPKESTSNVRIIGLTSKGNLHFTEK # LGLYHEVYDYDSFLSAKPFHTKDKSKPQPRWIYIDVAGNQALNSRIYTHFASPYSVSKLVAAVSLGMTNLAPGEAKADTIEWTANLENTSENGGGTKP # ISSSPSLGFWPRTEQFFLPEWLAIRRLQLTPTQMFDAQKEAWGALMQDCPSWGEVGVRLWRRTGSEGLRGDGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 Scaffold_4 AUGUSTUS gene 1647385 1648671 0.93 + . g331 Scaffold_4 AUGUSTUS transcript 1647385 1648671 0.93 + . g331.t1 Scaffold_4 AUGUSTUS start_codon 1647385 1647387 . + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_4 AUGUSTUS CDS 1647385 1648671 0.93 + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_4 AUGUSTUS stop_codon 1648669 1648671 . + 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MLVKQIAPKSWDRLRFYTSRVHIFDQRILLEEEESSIHTSVYARLGQMQPIFPALKEFHPAASISTSNSLMFFLSRTI # STASLPAFLPHAQTTGDEDEGLDFGPSLSILAWKSPGIQTLYLESDAPYSGFAASIACFHDLRNLRIVQMSRYDSDFLNGIASLQNLSYLNLTLPENV # SFDVSGITSGFSSVKTLRIAGPPGEIHKILKLMSTTTLDELRLTCNLHSVWEENRTGMPDLTRCLDRFSSLTVLEMSSISEIDLNLFDAQFLWLLFSP # ILRLPQLQKLGYELPLFLTDQRAAEMAAAWPRIETLSLTSETWGEGIPPIESLRHFAEHCPRLKSLEFPVRVNFVVVDLKPPPPPPPTLSMHALRNFR # CILYDEVKSPAVVALHLYQIFPGLKWADGPGAGWSEVQSTLNAFHFLNKQNRQISE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 Scaffold_4 AUGUSTUS gene 1659804 1661096 1 + . g332 Scaffold_4 AUGUSTUS transcript 1659804 1661096 1 + . g332.t1 Scaffold_4 AUGUSTUS start_codon 1659804 1659806 . + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_4 AUGUSTUS CDS 1659804 1661096 1 + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_4 AUGUSTUS stop_codon 1661094 1661096 . + 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MYSASKQSFNTCVCAPSASLPPLPKLLVLSSLEICEPLHNIQQSYAPPPPTLPSKLVLPIRKHRQLIHDDSVPDSGYA # SAEEEDCDYEVDDIVVAGSCDDDDLEILRADPLERAFVIKWLTAFIARSDAWASADDLEEIEADRRAEAVETASRLLSVLLGVDQEEEEDCSVTRFFQ # FPTQGGTFVEVELNDAPLSNEDHTCVGLQSWASSVVLSERICADPARFSLSSVTNASGSPLRILELGAGTGLLSIIARKLLSSPHASASIFATDYHPE # VLLNLCANIATNFPSSAPPPISVHQLDWERPEYSAPMNEPFDLILGADVIYHPDHAQWIKACVERLLLRPTLSNSSTGTGGVFWLMMALRVSGRHEGM # FHTVEDIFPDASSSLTAGDQADDWQLAILEKSELGKLKGVGRADERGYLLFKIGWVLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 Scaffold_4 AUGUSTUS gene 1661591 1662351 1 - . g333 Scaffold_4 AUGUSTUS transcript 1661591 1662351 1 - . g333.t1 Scaffold_4 AUGUSTUS stop_codon 1661591 1661593 . - 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_4 AUGUSTUS CDS 1661591 1661790 1 - 2 transcript_id "g333.t1"; gene_id "g333"; Scaffold_4 AUGUSTUS CDS 1661847 1662351 1 - 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_4 AUGUSTUS start_codon 1662349 1662351 . - 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MAFSSAIKSLTQAAFPKRQATPALATQVTITLDAVDSEWEVDPTSDAALSLSSSFPSFASFKDQRAFEHERQCAKRTE # EYARSQKAKASKGLSKWRPASPVHQRRTTNARKVRPVGFGGSEDEVNTPNVLERVRSAGTRKELSPVQNSEVKLADLIKPGSVRKARKNKEADFELIP # AVRPVIVLDELAFMHDAPAPRDLEQEWQHVYHSDGDESDASLSISTPTYANVVLGGLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 Scaffold_4 AUGUSTUS gene 1674082 1675568 0.55 + . g334 Scaffold_4 AUGUSTUS transcript 1674082 1675568 0.55 + . g334.t1 Scaffold_4 AUGUSTUS start_codon 1674082 1674084 . + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_4 AUGUSTUS CDS 1674082 1674479 0.55 + 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_4 AUGUSTUS CDS 1674563 1675568 0.74 + 1 transcript_id "g334.t1"; gene_id "g334"; Scaffold_4 AUGUSTUS stop_codon 1675566 1675568 . + 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MPLRGLFSKRNKSRTDVGQYAPASPTATESTVNSPTADYIKPDSLLPSSPNGRSTLHPDSAFTSPSKSTKSSVYPSIA # ASPPSSSSKLRLPFGRKRAAKSSSSNNGRDEDSDITSSSPHPPFTGRLSTSAASDASSTRSLPNEYPVPVPPNETVVESQTSAPKRPLFPWSSKSQPS # STKAKAKSKSSPLKAEDISTVLADSSFNLKSFRHLGDPVPLPELLPRPVRSHSTIPDSANSSSTSLVPPGPLTGSRSRNASLSSINDPSASQQRISVA # AFREAQARRSLAGSPVPSPRSPSPGPNLSVHNRSPPLNQANDVRQRRTSLVALGSMRYSSDEDDSSENEEEEDSDTSKRMRGRPGKKNTVKSKAKSEA # GHNSSSYKTVSSAFPGLNSNLNSSLRPDAAAKIAAPRSRSDIYGRGVYGNQPIVPASTSTGAVASETGGGSKCLFISTSFSRSDVVRSTAKVKPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 Scaffold_4 AUGUSTUS gene 1676564 1677605 0.31 + . g335 Scaffold_4 AUGUSTUS transcript 1676564 1677605 0.31 + . g335.t1 Scaffold_4 AUGUSTUS start_codon 1676564 1676566 . + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_4 AUGUSTUS CDS 1676564 1677184 0.68 + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_4 AUGUSTUS CDS 1677246 1677605 0.31 + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_4 AUGUSTUS stop_codon 1677603 1677605 . + 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MADLADLLGAGIKLVSVNGEDQSDEDMPFGRHDTEEKEDADSIVRLAYDPPPSPNRITPVVVKTRPPASSFSVTSRPL # HARGASINILTTSTSGTVMDTATGNITTATTTTTTTTQNPARGPPLAGVARPRSSTLVPVSPSKTNSSTWSSTSRKAKSPSSNTLHVPGSSIASSSSS # SSSSTSNSGKSTNRNASSSHDSGLSHNRGQQLPPPMASSFPAPSKPFASQSPASSTGDSSSGRGAPITPRDGSDIGDGMGNALSKEEQWGSGVSGLSF # ATKHGRKRSIAFDEDAGNEGKGKNKSKETPEDEEARRKDRRRSEARAAIEVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 Scaffold_4 AUGUSTUS gene 1677764 1678537 0.21 + . g336 Scaffold_4 AUGUSTUS transcript 1677764 1678537 0.21 + . g336.t1 Scaffold_4 AUGUSTUS start_codon 1677764 1677766 . + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_4 AUGUSTUS CDS 1677764 1678537 0.21 + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_4 AUGUSTUS stop_codon 1678535 1678537 . + 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MMNGPMPGMPGMPGMLTPQMTGNPMWGWTPMPSMPQIAPGQMLSPAQFMVPPPTDPTFFAAHQQAMMYAKQAYQMAVA # QQAMAAAAEEWERGSTVGGFSSSQSMYGMPPSTSSIMGSPYGMGGGNGWSTGSTLFPSSASRSPMYGSGAMSEYGGGTRSGGWNSSRSVYGESFGPSS # PSPRNAGAANRGRLSSYTRDSGHYPPMPPMPPQGNNKNIAHRQAANPRARTVSQPANPVRTRNAGSPAGKAPPSSWRLNDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 Scaffold_4 AUGUSTUS gene 1682131 1682595 0.95 + . g337 Scaffold_4 AUGUSTUS transcript 1682131 1682595 0.95 + . g337.t1 Scaffold_4 AUGUSTUS start_codon 1682131 1682133 . + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_4 AUGUSTUS CDS 1682131 1682595 0.95 + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_4 AUGUSTUS stop_codon 1682593 1682595 . + 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MSLSSQQRRATTPPDYEPFNFPLAHTIALVTAYSESVEGLRTTLDSLATTDYPNSHKFILVIADGMVKGAGNDMTTPD # ICLTMMTDLIIPSHEVEAHSYVAIADGHKRHNMAKVYAGFYKYDDATTERSKQQRVPIVLVAKCGNPSRRTTQSRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 Scaffold_4 AUGUSTUS gene 1683651 1684271 0.52 + . g338 Scaffold_4 AUGUSTUS transcript 1683651 1684271 0.52 + . g338.t1 Scaffold_4 AUGUSTUS start_codon 1683651 1683653 . + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_4 AUGUSTUS CDS 1683651 1684271 0.52 + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_4 AUGUSTUS stop_codon 1684269 1684271 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MVSGDKGGNHGDKEGEFDSTHIVMKKWAEFERERRWKSGTQSRDSNSYEKKYAFTATHSGFDVLTCYRADSNRYSLVT # DSDTFHPPSNNGFDSSTIETASYASPRQRHDSNALLMLPAPLSVNRQPQPQPMASSSSSSVVGPRSSEDHQYNDNTSSSNLRLVPSFQSQSDQQHYTD # YDAPPSGIAPPSRYSSPVARPMESPQPGTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 Scaffold_4 AUGUSTUS gene 1688897 1689928 0.7 + . g339 Scaffold_4 AUGUSTUS transcript 1688897 1689928 0.7 + . g339.t1 Scaffold_4 AUGUSTUS start_codon 1688897 1688899 . + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_4 AUGUSTUS CDS 1688897 1689928 0.7 + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_4 AUGUSTUS stop_codon 1689926 1689928 . + 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MGYQSRGCSGVETRYQNLETLAGGLIYPTSQVAFRPNAKPLISTPDIKLPSLSIPLAWDFLLFAAIEYHAIQHWVVEV # RRKEHIFSTYGMPFHSVVNVDSEEDALVVVAAQMVRRPHGQSSLRARAREIMDPQTEHFFLDLDAIDLDVPICSIDFHAYAPERSKVSASLRELAHSY # YAVAQHIRRHVPRNNCDMTGHIARINFGQTLWVALLGGAVLDNGRMTFINLPETRANWKVSADHAYLTRVESVLAQLESVANTPAFESTVTGAGGISR # GTAMPFLVAGLIGQMIICYFLSVGTSAGVWTSVILANSLYAGKLHDWHSIYFGKSDSSSQPGSNCVFRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 Scaffold_4 AUGUSTUS gene 1690690 1692048 0.35 - . g340 Scaffold_4 AUGUSTUS transcript 1690690 1692048 0.35 - . g340.t1 Scaffold_4 AUGUSTUS stop_codon 1690690 1690692 . - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_4 AUGUSTUS CDS 1690690 1692048 0.35 - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_4 AUGUSTUS start_codon 1692046 1692048 . - 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MELILNHMREATGGIVDISLNNRLLFPRYSNTTTKFEAQNLGSLHLSSLTGENTLSISLSLGEQGNYYFSDAALVFKD # NNGYVKQENSVYAVGLSSGSSYNGGSLEDSLRKGNPYLSIEGGASWSKIIFTVREELLGIGNCIMKIQHRRESGTTIDVFLNGNQIEAGYDDIPIGSF # GTSSFYVHSSDLEKSNELVIKPNNGKYYISDVNLDVVSLLPDITQKNFETYIKDWVLHHRKNIGQLNKIPREDLAAWKFVHEAPYWFFIPFLPCSPEE # ISVLFDYYNMMFVSVAFEIRDFNNKARDFHKELISTDLPRKNALRHAYWTAMLSRQFGLYFALDLSTAHEEAHVDLTIEGPYDHVTDKINNAVGSLLG # SRTSRSQDLQVVIDAAWASGELAYAKDFRETSAGQTANVSWQKPLDMMAKKYNVKPKFSQTEKDTLEKMRVNVPNVPVIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 Scaffold_4 AUGUSTUS gene 1694697 1695650 1 + . g341 Scaffold_4 AUGUSTUS transcript 1694697 1695650 1 + . g341.t1 Scaffold_4 AUGUSTUS start_codon 1694697 1694699 . + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_4 AUGUSTUS CDS 1694697 1695650 1 + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_4 AUGUSTUS stop_codon 1695648 1695650 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERI # EKFDELKQKIISIDDMWWRREEMRRNWSNRYQRNAGQGPSSQRWQPQTTQAPITKAPTPAVPTQDRKDGTGTTFKGAGRPMDIDAARRNKECFHCGKQ # GHIAKFCPEKAPKPQFVRGMWSRMTQEDQEAMAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 Scaffold_4 AUGUSTUS gene 1695892 1697622 0.56 + . g342 Scaffold_4 AUGUSTUS transcript 1695892 1697622 0.56 + . g342.t1 Scaffold_4 AUGUSTUS start_codon 1695892 1695894 . + 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_4 AUGUSTUS CDS 1695892 1697622 0.56 + 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_4 AUGUSTUS stop_codon 1697620 1697622 . + 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MPESRVREASEETVLAIRNLSHATATEAVTNLKSRKRFVRGTRGRELKLRTTIENIDNGVQIETEALLDSGATGSCIN # KDFVEQHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAERIDMAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHY # ESPEDDGTEEKLVDGERIFWFDWDGYLSDQGHIKVQTATTDAATPYLAEYADVFSKKDFDQMPERRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDE # FLEENLRSGRIRPSRSPMASPFFVKKKDGTLRPVQDYRKLNDMTVKNRYPLPLIQELIDKLKNSKIFTKMDVRWGFNNIRIKEGDEWKAAFRTNRGLF # EPTVMFFGLTNSPATFQAFMNHILRELIDQGHVIVYMDDILIFTDNIEEHRIIVRKVLDILKANKLYLKPEKCTFEAREVEYLGIIVGNGQIRMDPKK # VEAVRTWQPPQKKRELQSFLGFCNFFRRFIRDFSKIAKPLTRLTGNATWEWTSLEQDAFNQLKDRIIEDVTLIIPRETGKFRIEADSSITQMVLSYRK # TSMESGDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 Scaffold_4 AUGUSTUS gene 1698395 1699602 0.29 + . g343 Scaffold_4 AUGUSTUS transcript 1698395 1699602 0.29 + . g343.t1 Scaffold_4 AUGUSTUS start_codon 1698395 1698397 . + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_4 AUGUSTUS CDS 1698395 1699018 0.29 + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_4 AUGUSTUS CDS 1699108 1699602 0.45 + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_4 AUGUSTUS stop_codon 1699600 1699602 . + 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MIGELPESGGYNAISVFVDHFTKRLRLFATHTTITSEGMARVYRDKVFPIHGMPRKIVHDRGPQYHARFMKELYKLLG # IESNYTTAYHPQTNGQTERINQEIEHYIRLFVNHHQSDWHEWLPMMEFAYNDRVHSATKVSPFYADNGRHPYKGTTPKMTSQNPTAQEFADSMKRIRE # EVGSALKKAAEDMKRQYDKHRNEAIEYKAGDKIGSSSYKLDIPRTWKRVHNVFNETHLSPYHEPQFPTQPRNTEPPPEVVGEEEEYEVEEVVDARKYR # NGIQYKVKWRGYGPHEMTWEPAANMTNAKEAVQDFHKKYPNKPRPRTLKRIEIPIAQFPTELFRQIPTPDIEPVPSTMPSEALVNRLARHGIRALKGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 Scaffold_4 AUGUSTUS gene 1702884 1703288 0.88 + . g344 Scaffold_4 AUGUSTUS transcript 1702884 1703288 0.88 + . g344.t1 Scaffold_4 AUGUSTUS start_codon 1702884 1702886 . + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_4 AUGUSTUS CDS 1702884 1703288 0.88 + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_4 AUGUSTUS stop_codon 1703286 1703288 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MSSSSPPSYTSEDQTFQHNVQDVQASSVQRRKSSKEKAREVSGDPDIKSETSSISRRRSRRHSSHSVDAPRLSQEIIE # RIARQSVRSSRHINADLLKQIAKQGGLPKDLDQDGLPKFKVITGSEATRVYEKTLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 Scaffold_4 AUGUSTUS gene 1703589 1703885 0.7 - . g345 Scaffold_4 AUGUSTUS transcript 1703589 1703885 0.7 - . g345.t1 Scaffold_4 AUGUSTUS stop_codon 1703589 1703591 . - 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_4 AUGUSTUS CDS 1703589 1703885 0.7 - 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_4 AUGUSTUS start_codon 1703883 1703885 . - 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MSGSAEDVPKADALGVGGSVSKVDTFGVEGSAEMRPLYNRDRQHKNPQRVLFDRLTDDNLLTFLPYSSNDLARLLNSP # SRISVRRPVPNSQHPFRPEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 Scaffold_4 AUGUSTUS gene 1707332 1708336 0.67 + . g346 Scaffold_4 AUGUSTUS transcript 1707332 1708336 0.67 + . g346.t1 Scaffold_4 AUGUSTUS start_codon 1707332 1707334 . + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_4 AUGUSTUS CDS 1707332 1708336 0.67 + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_4 AUGUSTUS stop_codon 1708334 1708336 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MAARRAKGNYEFLVRSAVNQAHAHTTVLSIEPFETQGFSSTTYSVQLGDQTSIVVQVRPSDRPLLLSNLDTARSTFGS # LVPSGSFLMSTDDGPNRQLLFYSMSRVPGRSFDSYMRFLGSHATDSMPSIARSLGTILAKAFIPEAELAGLISSQGGEKAQGLNLLEEQLQRAIQAQT # DVKSFSDLKPLFASLLHSLRTDAELKHLPLTISNGDISPTNIIIQNDTVSGIVDWEYIDIRPLGYDTEAIFWLMCILDPPTNSFSLRPNSQEIEQSFW # TAFSTTLPAHLRSQHTAIELALHIAFAIKACPAGHFNPLWATSLPEMSKYRIPLQYWAQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 Scaffold_4 AUGUSTUS gene 1715983 1716641 0.39 - . g347 Scaffold_4 AUGUSTUS transcript 1715983 1716641 0.39 - . g347.t1 Scaffold_4 AUGUSTUS stop_codon 1715983 1715985 . - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_4 AUGUSTUS CDS 1715983 1716444 0.61 - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_4 AUGUSTUS CDS 1716505 1716553 0.57 - 1 transcript_id "g347.t1"; gene_id "g347"; Scaffold_4 AUGUSTUS CDS 1716616 1716641 0.39 - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_4 AUGUSTUS start_codon 1716639 1716641 . - 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MKNTSGRRPPEVSISLGKKVSEAGKILVLNLSAPYIPRSYNAQIQEIAPYCDIIISNEAEAEAWAASNDHPDPTNMPA # VAKAIALLPKANATPPRIVIITHGAHSTTLVSADTPDSPKTYPVHPLKEEEIVDTNAAGDAFSGGFLGAYVSEKSIDVCIKLAIDLLRCALGRWVLIA # FM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 Scaffold_4 AUGUSTUS gene 1722799 1723822 0.51 + . g348 Scaffold_4 AUGUSTUS transcript 1722799 1723822 0.51 + . g348.t1 Scaffold_4 AUGUSTUS start_codon 1722799 1722801 . + 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_4 AUGUSTUS CDS 1722799 1723327 0.51 + 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_4 AUGUSTUS CDS 1723425 1723822 1 + 2 transcript_id "g348.t1"; gene_id "g348"; Scaffold_4 AUGUSTUS stop_codon 1723820 1723822 . + 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MANSPLSSNSSIWPPSPAVGASEYRKGSTKLELDMTGYPIPDPSSIPPSPMTNILLESISLSASVPDDKLHLQGAFIV # RNINYQKDVAVRFTVDDWSTVSEIKANWAANFPSPFLTQRSSSRDTDSWDRFTFCINLSDYTLASLPSKVIYFVGRYTVPGETLGQLRRTELAGEVPA # SFAAVLSPNAVVSSPTVSPPAISLTEATASSPTSLTNSISTAPSSASPVPIANPPSPARTEAIAQATAQRLRRFSLSNYVAPGAPTSSSAPSQTEEKE # MIDTLHHRQCQTHDPTFLPGHNLSRRPHLEAIYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 Scaffold_4 AUGUSTUS gene 1730927 1734043 0.23 + . g349 Scaffold_4 AUGUSTUS transcript 1730927 1734043 0.23 + . g349.t1 Scaffold_4 AUGUSTUS start_codon 1730927 1730929 . + 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_4 AUGUSTUS CDS 1730927 1733119 0.3 + 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_4 AUGUSTUS CDS 1733225 1734043 0.7 + 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_4 AUGUSTUS stop_codon 1734041 1734043 . + 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MPYSQPVSPPRSSSPSRSHHSRSYQNQNNNPSTHSLGRPGHRRSYSSQAHYGSGSSLQTSYSSVIDTPPSSGRNSARF # TNEQSISGNGNNNGIRGAWGGLGSLPRRHSSASTPTLSSVNTSKFRIGDRRGSSSSEDDDGNDDHSDRNLPPLKLKVQVLPSFSEGIPFPKSSADSPV # RMGPMAIPNPASVAMTRSSVPTRTSSSPELVETAPNTTSSAAINRALSPAVILLSNGKPLRSSLKGSRISSLLSSPMGSAANSPSVSPVNSVRNSPVH # STASSAVTSPVTSPTIPGTAAPSFASFTNFVGNGPSANVLSVPPSFSGHVRAQSAPSPPMTPGQGIEAALESTWTGPLSPMTEPPPSPGLSELMSPDA # LLSPRSVHFPSLPSDLERVRVFRKEARPSSLLVTRKERDQITNNLNHGLETLSNGGEGAEGSGNDVKSGGEETETETETDREYGYGYNAGYWGGGRGL # WDAAAPLSRSNGFSSVKAASTESATAPGAYPFPRLPRLGRMRSAGGVAGNNEDDGGESSSSSSSSGGRIHHIRNTGTGPRFARREEEVEKGTAKKVTK # IELDVPSPIPRPESVQDALSGSTNVFLEEVHLDSSSSSSASSQGTISTDSVLSLEGTFLVRNVAFEKHVSVRFTTDDWSTVNEVRGKWVGSCGKSRII # SLAAAASNPSTAGLAVPRTLGDLIAFANYPLEEENSSEWDRFAFKINLPPAVGPGRIVEFVARFALDYPLVFTCYLDADDSYLLVSKPAPVLLKVLPP # SPAPAPVPAPNTEKERISELSPISSDVPISNLDVAADSTPISLAIDTTSVPTDSPNSLAAASYEIGSQNALGALHITPLPPANKAGVEEFANSAPNES # EQQNSGSQETIKEVKERAPKPIGLGSLSGLGGLFWPWRNAASSDSQTSSFSKSSHSGSGSVDLPDSLPPTLLDSVSEASSLRQSSPGTNRSVSGGRES # KFSSVCHSEGVISITTCGSSSSTFYERRAYLWVFVVRATNTSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 Scaffold_4 AUGUSTUS gene 1734228 1734536 0.25 + . g350 Scaffold_4 AUGUSTUS transcript 1734228 1734536 0.25 + . g350.t1 Scaffold_4 AUGUSTUS start_codon 1734228 1734230 . + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_4 AUGUSTUS CDS 1734228 1734536 0.25 + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_4 AUGUSTUS stop_codon 1734534 1734536 . + 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MGGSLESKLDLTPVPNGVRAAWLSNDDTIGEDQTGFFDNTGHGSGVGISSPSVGVDKPLDADPLYRAFVQQWCFAGTG # SGSPAVSESSPHTPNRNRNRLQVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 Scaffold_4 AUGUSTUS gene 1744316 1745084 0.4 - . g351 Scaffold_4 AUGUSTUS transcript 1744316 1745084 0.4 - . g351.t1 Scaffold_4 AUGUSTUS stop_codon 1744316 1744318 . - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_4 AUGUSTUS CDS 1744316 1744591 0.65 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_4 AUGUSTUS CDS 1744704 1745084 0.43 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_4 AUGUSTUS start_codon 1745082 1745084 . - 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MSENIPVAYNIPPAYKALYAPILPTFRVRLARQLPHETNLIKTAILHGMLKPEDAPTRLDSLIDALMDESQVPKDTND # EYLQYLLGRSKKKIDKEKQKIDKGKGLLRRWVEEDQGIRDSDIWEDLLQITPELRAKAPWLPSKSSQILPTALALPKQWKDVEKDEEPGKRWVAQYIL # GPLNEALEPVWNDMELVLEDILLFWTSQLMHHFLVQTGSSTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 Scaffold_4 AUGUSTUS gene 1750351 1750671 0.55 - . g352 Scaffold_4 AUGUSTUS transcript 1750351 1750671 0.55 - . g352.t1 Scaffold_4 AUGUSTUS stop_codon 1750351 1750353 . - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_4 AUGUSTUS CDS 1750351 1750671 0.55 - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_4 AUGUSTUS start_codon 1750669 1750671 . - 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MNDPELDAIVERQLYEQRAAWDAANRQSKGQHHPYVPQVPAPAALPSAEKAIAREPRGTMQLPTSSHLSASQLNASKA # IPEPMHVQPGSGPTMSEKTHLDIEERRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 Scaffold_4 AUGUSTUS gene 1754548 1755492 1 + . g353 Scaffold_4 AUGUSTUS transcript 1754548 1755492 1 + . g353.t1 Scaffold_4 AUGUSTUS start_codon 1754548 1754550 . + 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_4 AUGUSTUS CDS 1754548 1755492 1 + 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_4 AUGUSTUS stop_codon 1755490 1755492 . + 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MRNLRRKAREVIDTAASPDGTSNNSGSPAESSSSQSGSDHSPSARSPPCAVSFTSTADLKEAQGIPLSTYELDRLGGR # THLISSCKSSKPSTPVEKPASPPSSSDTGSDAHPSPESQASLPTSISWAHGESLASSSQQHLQQPAPVQNLHPTIVQDIRNIEMDVDMNFGGFELHFL # DPPTANRTETEQPFGLSLGQQQGGQDMSQLGNASLRYPTALAGSQNQDIATSSSSHYSGMSGMAFDYMSMGGEGTSLHMGDLSTMGGGANVFGNSMVS # PSFSTGTFSTLGHPPANAQLLPGTPVLDASWQSFVEQLGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 Scaffold_4 AUGUSTUS gene 1758051 1759176 0.88 - . g354 Scaffold_4 AUGUSTUS transcript 1758051 1759176 0.88 - . g354.t1 Scaffold_4 AUGUSTUS stop_codon 1758051 1758053 . - 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_4 AUGUSTUS CDS 1758051 1759110 0.97 - 1 transcript_id "g354.t1"; gene_id "g354"; Scaffold_4 AUGUSTUS CDS 1759169 1759176 0.88 - 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_4 AUGUSTUS start_codon 1759174 1759176 . - 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MNFEVMLCDFESGVETVSFIHLANSSPSDPKPPSTNNEAMSGGVEIETDSEMDVWSGGGLNPAVTIRNFELMHSSSQY # NQYPGDTRVKLDLTRLVSFYDPELAPSLIRMRNSYNDSRWLYDLATIAPADVSTLHQKLRAALEVQDNLTRVTSGVDWQTLFRVVINRFGSRLQNLRY # VVIGSAHHSGSTILDDEDRVLKAFAQINVMLTPYIPYDLKPNVAADLRVAERVDHISLAWASPAYELCSTIHTSYIAKSLSGRMTPSERLLLGAVQDT # TKEICRVLVKMWATGVEVGLDAKYWVRRPGRQEKRDHHDDRFSALARQWSVEIEHLMDWLDWHVWVSCSPACSDEVSCGPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 Scaffold_4 AUGUSTUS gene 1761401 1761769 0.71 + . g355 Scaffold_4 AUGUSTUS transcript 1761401 1761769 0.71 + . g355.t1 Scaffold_4 AUGUSTUS start_codon 1761401 1761403 . + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_4 AUGUSTUS CDS 1761401 1761769 0.71 + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_4 AUGUSTUS stop_codon 1761767 1761769 . + 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MPSSPPFPMTSPSGKDYVEFGKLTQTRTLEWACARRRLAAKSGDSLAEDDEEDITIAFQKPVLSRSDSNVSTLSAVSD # TREENRERRKQEVAHDVDPAKNVYPGIEEDMLKAALALCGLGRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 Scaffold_4 AUGUSTUS gene 1765999 1767302 0.47 - . g356 Scaffold_4 AUGUSTUS transcript 1765999 1767302 0.47 - . g356.t1 Scaffold_4 AUGUSTUS stop_codon 1765999 1766001 . - 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_4 AUGUSTUS CDS 1765999 1767019 0.74 - 1 transcript_id "g356.t1"; gene_id "g356"; Scaffold_4 AUGUSTUS CDS 1767073 1767302 0.53 - 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_4 AUGUSTUS start_codon 1767300 1767302 . - 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MQYKQTAVNRVVPLEEQEQACDPRFVSGHEVGGMEGQDADVKPSQEEEADADSDMSPRDFTEIKRHSHRERSLAGRSS # QHDRRLDSYHRGSQGGQDLYSEEEGDGEAESDEYDYDDPSDGEYVFRDRSRAAPPRQLGYTASFSTANDKMGLDNMQGAATGDITASGRRRAATESAG # SSGVNSYSSFSSSNYASGSSAYDWNNHPNLPYGVNTNATSSVGMRTRAGTTVGYPTLANRYSPYPHGSNYDEYPMHNGSSRSRRTSYSSEASSAGPLL # SPNSSPTSGIPLSPSISSSSSMSADTAMGTPHVGSPNYSGPGGRRKSNSLPVPIPIPNLTKKSRGRRVPTASTLDNSTRKSVDLNYSSSGGRGGKGVR # VHTCKVPGCGKCFARGEHLKRHVRSIHTYDKRELLIEARQISTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 Scaffold_4 AUGUSTUS gene 1767841 1768179 0.84 - . g357 Scaffold_4 AUGUSTUS transcript 1767841 1768179 0.84 - . g357.t1 Scaffold_4 AUGUSTUS stop_codon 1767841 1767843 . - 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_4 AUGUSTUS CDS 1767841 1768179 0.84 - 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_4 AUGUSTUS start_codon 1768177 1768179 . - 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MHSTTIVAEGSGSVYDYAQQQPDLFSGTDVWNSTGSKKSSLSSQLPLSIYIPQNAVAGQSTNRHVQGPHSILSPDDEE # WARSQNATLSTTPSISSPLANAVDCRQSIPTISP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 Scaffold_4 AUGUSTUS gene 1773759 1775419 0.36 + . g358 Scaffold_4 AUGUSTUS transcript 1773759 1775419 0.36 + . g358.t1 Scaffold_4 AUGUSTUS start_codon 1773759 1773761 . + 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_4 AUGUSTUS CDS 1773759 1774081 0.36 + 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_4 AUGUSTUS CDS 1774162 1775419 0.65 + 1 transcript_id "g358.t1"; gene_id "g358"; Scaffold_4 AUGUSTUS stop_codon 1775417 1775419 . + 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MAPNFFSKLVRNPSGHSRDRSDPSSRTRSPSPIPALPTSRSRAFSSTFSTGNSAASSTSTSPSPSEFGKLPVQLHSQV # PSIKKELLHGHDNASDSSSLFNHKFTIVPPRTTGIGFGAKFEFLCSHESGIFHGPTVIIKSKLTKSRPTTPSSSTHSLPEAFPVASVLNSPIPPVPSL # PAESQPQRQENSEQTTGGLLPSPELQVQKMSSNRSLNGNLNVSTNRASPPSHSRAGNTSAPFYHEVDDMTPIVESPTSEYPSPSDEVPASTALVSKSQ # LNSTSGLLSSPRRDADAASIRSTNTNASPPNSSSSKKKEASKPWRRQPTSKPTGLASAIAASGLAMANPAFSAQQQLQFSPPALQPISRTGTSASNRK # SSLGDGAPYMLRTGSTSAGASSSTQFSPPRSHRSSKSRRSSIGSGSAGKRRRHRPSLSMQSDNGANSNADNNTEYIQDPANLDYYSGLESDDSNDSDI # NSSDEDDLVSAIDVHDMPVTGFAVASSRRNADFHEMFRNIPEGDYLIEGELLVFNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 Scaffold_4 AUGUSTUS gene 1776234 1777334 0.73 + . g359 Scaffold_4 AUGUSTUS transcript 1776234 1777334 0.73 + . g359.t1 Scaffold_4 AUGUSTUS start_codon 1776234 1776236 . + 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_4 AUGUSTUS CDS 1776234 1777334 0.73 + 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_4 AUGUSTUS stop_codon 1777332 1777334 . + 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MSYIKPLTGSVGPKQTKCEIRDEVQYCDFSPSNANAYSSTLTTTRTPDVPSGGAFSVKTRTCITYASAISSRVVVTTQ # VEWTGRSFIKGLIERGAIDGQKTYHLDLEKAMRAYIQEHQTEFVPEGVKLDVVVAPPTTAASSNGSDSVIDANADSASAAGGKPSSRGLQWAWETIEG # TWGVAKQSTKGALEILGDMIPPPSTLSSTSILYLIIFSLVVSNIWTWMRVPKTGTVDHRSVGGKPSEMLMKVEGEERERILKEEREDRERWIHGVVTA # LWSELAAGKVPNLQSQQQQTRNPMSPTNPMSSTPLQSFDDALSDVFALYKTLDQAEMKVNAIRDALGTLQAQLGATKNEEESKDKKNLNSLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 Scaffold_4 AUGUSTUS gene 1779354 1781643 0.24 - . g360 Scaffold_4 AUGUSTUS transcript 1779354 1781643 0.24 - . g360.t1 Scaffold_4 AUGUSTUS stop_codon 1779354 1779356 . - 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_4 AUGUSTUS CDS 1779354 1780260 1 - 1 transcript_id "g360.t1"; gene_id "g360"; Scaffold_4 AUGUSTUS CDS 1781093 1781215 0.44 - 1 transcript_id "g360.t1"; gene_id "g360"; Scaffold_4 AUGUSTUS CDS 1781300 1781507 0.63 - 2 transcript_id "g360.t1"; gene_id "g360"; Scaffold_4 AUGUSTUS CDS 1781559 1781643 0.57 - 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_4 AUGUSTUS start_codon 1781641 1781643 . - 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MDYILGIIDQTSPNQITEGGLSFCFKSVYNEYNQAEGAGYFAELETVYHNSSIVIPLTYNDPGEGDNFINGTVSIIWL # FTILCLIPHFVIKGAVDLYGFDSYPQGFDCATPETWNPVTTNYHSYHESANPSQPLYIPGAATTNFKLNVTTASGDLQIPLVASTITLSGRESKVLLT # DYGLGSNSSLLYSTAQVFFSGAIGTKHVVFLYGPSAQEHEFALTLSGTPTLNSSAITVTSGSSVGLTGSETVFSIASGFSGLVPVFESDSLLVLFADS # ATATTFFSPIVPAVSGDFPNYWGLGTNDSVLVGGPYLVRSANISTDGTTLALRGDLNITSGASDTTLTIVAPASVTSITWNGDDVSVSLSANSSSSIL # VGTIPASSDVQNISIPVLSGWKFNDSLPEILSGFDDSAWAVANHTTTNIPVPMKYGDGKITYGCDYGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 Scaffold_4 AUGUSTUS gene 1782846 1783697 1 + . g361 Scaffold_4 AUGUSTUS transcript 1782846 1783697 1 + . g361.t1 Scaffold_4 AUGUSTUS start_codon 1782846 1782848 . + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_4 AUGUSTUS CDS 1782846 1783697 1 + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_4 AUGUSTUS stop_codon 1783695 1783697 . + 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MTTDWHAECVKKYNALPRKRLAPSGLVPNVWHFDLRYIPLSPPSHMLFVFQKESQFVHQQSLPVGTKKSIKNAFGLSY # FPETAKEAALEICLGLMHSFNTTFNQEMTPGPMMDPYAPWKFTTDDRALAQAVQEQFKSLGVKEDRCKVGFVDITQEAHERFDGLYKSLVAVLGLPDI # VRAALVTPSAIGFSGLPPADPEAWLMNPGSLHGTPEEVEFQKIIGYSQEFMNNEPLPVNSGNGLNRSSNLMETLERIKTVTTSTSLEEVQRRADAGDS # QHAIDAALR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 Scaffold_4 AUGUSTUS gene 1789492 1790112 0.48 - . g362 Scaffold_4 AUGUSTUS transcript 1789492 1790112 0.48 - . g362.t1 Scaffold_4 AUGUSTUS stop_codon 1789492 1789494 . - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_4 AUGUSTUS CDS 1789492 1790112 0.48 - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_4 AUGUSTUS start_codon 1790110 1790112 . - 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MATSSLRSTSTSSALRSTDGLEETNGSNGGNATVSSMGRSSPTTPLSRLGSEGHDDVDVTVRNLDPTLHALPTIPSVP # ANSVSKTSTTVISADAVHSSSNSRSTPANHSTTAPASPPDSKPIPDFQSNQSMSTGSVELNEPKMMLRPVEAKRIGGCDLCHRNEWTSMQLVKTCLPT # VYPGVHTSFVVSLQYSLTITIYLFLPWPCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 Scaffold_4 AUGUSTUS gene 1790175 1790920 0.33 - . g363 Scaffold_4 AUGUSTUS transcript 1790175 1790920 0.33 - . g363.t1 Scaffold_4 AUGUSTUS stop_codon 1790175 1790177 . - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_4 AUGUSTUS CDS 1790175 1790545 0.52 - 2 transcript_id "g363.t1"; gene_id "g363"; Scaffold_4 AUGUSTUS CDS 1790644 1790920 0.5 - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_4 AUGUSTUS start_codon 1790918 1790920 . - 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MTASGGPVTLISNGKGKAKLKSKGSAEFASVGSKSRSKNSKGKKKKRRRSSSSSPDEEDEERKSETESAETVSSDDED # EVDEASAVSNLLSLRSMSSTATLVGSVSGWGYPLSSSSSSYTTTNGNSITGSKPYFSPFHTSFLDATSNKSYSSMLPHNGLANAMPQFSLSKAYSSGA # TPYESSAAATASGTDADRIHDMHNGYHRHLMGLGMYRTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 Scaffold_4 AUGUSTUS gene 1798841 1799317 0.87 + . g364 Scaffold_4 AUGUSTUS transcript 1798841 1799317 0.87 + . g364.t1 Scaffold_4 AUGUSTUS start_codon 1798841 1798843 . + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_4 AUGUSTUS CDS 1798841 1799317 0.87 + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_4 AUGUSTUS stop_codon 1799315 1799317 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MIALSDTDWGSNAIDRKSISGFGIFLFGGLVAWSASKQKSIALSLNKTEYMGLTHVLKELLWIWVFTSLISLPILNPF # PLISDNRSSIDIANSRSVSNHSKHIDIRYHFIHSHIEDDTISTIWCSSLDMIADIFTKSLPDLHYKHSLSLGLVPLPAVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 Scaffold_4 AUGUSTUS gene 1807585 1808814 0.2 - . g365 Scaffold_4 AUGUSTUS transcript 1807585 1808814 0.2 - . g365.t1 Scaffold_4 AUGUSTUS stop_codon 1807585 1807587 . - 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_4 AUGUSTUS CDS 1807585 1808644 0.57 - 1 transcript_id "g365.t1"; gene_id "g365"; Scaffold_4 AUGUSTUS CDS 1808807 1808814 0.26 - 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_4 AUGUSTUS start_codon 1808812 1808814 . - 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MISQDDVLPRVSLAPAPASARSTSQTVSRPRASVPSLYHAAPSDYVPSHPATSTTPITHSLLPLQSTLSLSHDSISKA # RAAEGSSNPQYVSGRELRTVGQPQKPSALPKLDCRSRPDGEFAVQVDGNRTKRAIAKDAYELIRPNAIAAENAERANASARRSQDEDNKRSREIRYPL # RKRKRSLFRPTFNRFPSLGRQGNGTTTGREIRSKLNIGNATATSNLDSDSDVSHPGSDPVSEKGEKEEGKEEKKETVSKQDQDGFPLSESELDGEELT # DDEYYESWCSPTSSTFGFINTDNPSSNSVAGPSSLRPPSRSSDASHVRFPDDASDSPGTKLKTWERDFLRMRCWALVLAGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 Scaffold_4 AUGUSTUS gene 1810411 1810803 0.98 - . g366 Scaffold_4 AUGUSTUS transcript 1810411 1810803 0.98 - . g366.t1 Scaffold_4 AUGUSTUS stop_codon 1810411 1810413 . - 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_4 AUGUSTUS CDS 1810411 1810803 0.98 - 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_4 AUGUSTUS start_codon 1810801 1810803 . - 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MIKLTLLAGLAASLSAVHAQDILGLSYNSTSPYGQSKGIFTLIAGSYGYAMSQAGGSTPTLSATYDSTTQTLTQVCPY # PGLIAAMIPVSGSSPAAYAIEWVNSTVTLPEGSTTTSLYAANEGLDTTVSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 Scaffold_4 AUGUSTUS gene 1856568 1857305 0.8 + . g367 Scaffold_4 AUGUSTUS transcript 1856568 1857305 0.8 + . g367.t1 Scaffold_4 AUGUSTUS start_codon 1856568 1856570 . + 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_4 AUGUSTUS CDS 1856568 1857305 0.8 + 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_4 AUGUSTUS stop_codon 1857303 1857305 . + 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MICSLGAVGRLSSFYLDCFTHKGILALSIAAIPSAASADNTLSNIESNTFIILNTAAGGLSIVTSITGTSLIIIKIIG # AQRLTAGVFPNRRNRYNGAIEIIAESAVLYSITLLSLIVCVATKDTNTFYALNIHAQVAVSCAFFFEFHHNKILMPLALKGIAPLLIILRAAAGYSRP # DSVWSSSAGVRTGVESHRVPSGIRFRIPESHVTLDFAGEPGQGSGQTGTGEASIELIQAEDKQHHGTAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 Scaffold_4 AUGUSTUS gene 1868393 1868956 0.66 + . g368 Scaffold_4 AUGUSTUS transcript 1868393 1868956 0.66 + . g368.t1 Scaffold_4 AUGUSTUS start_codon 1868393 1868395 . + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_4 AUGUSTUS CDS 1868393 1868956 0.66 + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_4 AUGUSTUS stop_codon 1868954 1868956 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MSHDYILPHSRLHELYGIPVIFYDQIGIGKSTHLPNKPKEFWTSELFMDELENLLQSLGVSSDFDLLGCSWGGMLGVE # WAAKRHPKGLKRLLLIGTPASMELWVESQNKLLQGLDKDVHEALTKHEQAGTTHDPEYEAGMGLFYKKHANRLETWPEELLKSVASTAEDPTVYHTMF # VSISSILQEAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 Scaffold_4 AUGUSTUS gene 1870065 1870790 0.81 + . g369 Scaffold_4 AUGUSTUS transcript 1870065 1870790 0.81 + . g369.t1 Scaffold_4 AUGUSTUS start_codon 1870065 1870067 . + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_4 AUGUSTUS CDS 1870065 1870790 0.81 + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_4 AUGUSTUS stop_codon 1870788 1870790 . + 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MRDRFVAATINLNTVDATGLGIDLAKSAANIWKDLTEKFERKDEQLIYLADHALRTEKFDPDSCTMEDHEKKMKNLKK # KLTDVGGTLTDAQFRIIILASVPTDWKPETRNVPGKGSDEAFIHLHTVYLERKSESNEIEQSNKVRALIAKEMAAMSAQSQPTIAATTGTRHERLICS # NPPCPSKIGHTLKKCWAKGGGVRVKLPWWYKKHNQEPPTTVNSTSPIDTSSLSARISFYLHPNTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 Scaffold_4 AUGUSTUS gene 1872390 1874311 0.08 + . g370 Scaffold_4 AUGUSTUS transcript 1872390 1874311 0.08 + . g370.t1 Scaffold_4 AUGUSTUS start_codon 1872390 1872392 . + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_4 AUGUSTUS CDS 1872390 1872893 0.3 + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_4 AUGUSTUS CDS 1873195 1873413 0.28 + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_4 AUGUSTUS CDS 1873484 1874311 0.99 + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_4 AUGUSTUS stop_codon 1874309 1874311 . + 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MAEHQDPAAAVPPFPIHRDDAPEILPADENEPSNSPPPVIPDLPDLPLPSPPAYPQPLRRSARLKIPSTRYLESKEFE # SREQEANNQGKDWATETAFARICADPWSFATSTKVDNIPSGYKQAMKDPDLWREPMEVEYKMLMEKQVWTLVELPPGANLMGGKWVFAINGSHDWQAT # LSSGFKEDGYTSSRADPCIRSRRRGGEYVITSTYGDDVCGGASSEPERQEAIRELGKRWESNEVGGYFTRMLEHFGLQDVQRRKTPLPVGVQLEQSPE # PLPHDEQVFMADKPFRELLGSLMWGSTCTRADIAFATAYLARFQSNPGRAHWEGLIWLSGYIRWSVHYCIVYRKPEVGEVSSGKGIQPAGFSDSDLAN # CLDTRRSTSGYVFFMAGAPVAWSSKRQGSVATSTVAAEYIALARASEQATWLASFLVEVDLAQDGPVIISADNTGSVSLTENSKKLGLVKHIDTKHHH # IREKVDEGKIAINLIRSGENVADILTKALSGPMVHKFVKMLGYCTE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 Scaffold_4 AUGUSTUS gene 1885870 1886349 0.97 + . g371 Scaffold_4 AUGUSTUS transcript 1885870 1886349 0.97 + . g371.t1 Scaffold_4 AUGUSTUS start_codon 1885870 1885872 . + 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_4 AUGUSTUS CDS 1885870 1886349 0.97 + 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_4 AUGUSTUS stop_codon 1886347 1886349 . + 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARCFLAAFELWANSIPALSTDCKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTHFETTDASADAKQLLKRLYQNRTTVGTYASTFQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 Scaffold_4 AUGUSTUS gene 1890176 1890691 0.47 - . g372 Scaffold_4 AUGUSTUS transcript 1890176 1890691 0.47 - . g372.t1 Scaffold_4 AUGUSTUS stop_codon 1890176 1890178 . - 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_4 AUGUSTUS CDS 1890176 1890691 0.47 - 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_4 AUGUSTUS start_codon 1890689 1890691 . - 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MVVAGQCLMSIPEQSFGDEPSSNVRTPEEHQPAVQEPPPVDPGMGPPQQRYTSMGYTQPASSPMGGFAYSPTWGTRGP # SPGPVPQLDMESASNAGGRVSSQVATIERKQGRTRTLLQYDNREKLPERRVSPTASEQSRVSSRRLPTPPIQSLNLLLPDEEVHSPVSLRVQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 Scaffold_4 AUGUSTUS gene 1894134 1894532 0.4 - . g373 Scaffold_4 AUGUSTUS transcript 1894134 1894532 0.4 - . g373.t1 Scaffold_4 AUGUSTUS stop_codon 1894134 1894136 . - 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_4 AUGUSTUS CDS 1894134 1894532 0.4 - 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_4 AUGUSTUS start_codon 1894530 1894532 . - 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALK # RVVLLNSWIVQQTERSLRTAGSSTSNLMVVRRHALLSKGSHKLKVLIMTKSSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 Scaffold_4 AUGUSTUS gene 1895231 1895593 0.94 + . g374 Scaffold_4 AUGUSTUS transcript 1895231 1895593 0.94 + . g374.t1 Scaffold_4 AUGUSTUS start_codon 1895231 1895233 . + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_4 AUGUSTUS CDS 1895231 1895593 0.94 + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_4 AUGUSTUS stop_codon 1895591 1895593 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEECSSSKSSMNKPKVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWANSPSATFQCGKSPFRRKLGYVLEGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 Scaffold_4 AUGUSTUS gene 1905215 1907946 0.29 + . g375 Scaffold_4 AUGUSTUS transcript 1905215 1907946 0.29 + . g375.t1 Scaffold_4 AUGUSTUS start_codon 1905215 1905217 . + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_4 AUGUSTUS CDS 1905215 1905506 1 + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_4 AUGUSTUS CDS 1905589 1905973 0.76 + 2 transcript_id "g375.t1"; gene_id "g375"; Scaffold_4 AUGUSTUS CDS 1906042 1906438 0.92 + 1 transcript_id "g375.t1"; gene_id "g375"; Scaffold_4 AUGUSTUS CDS 1906522 1906849 0.41 + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_4 AUGUSTUS CDS 1907696 1907946 0.7 + 2 transcript_id "g375.t1"; gene_id "g375"; Scaffold_4 AUGUSTUS stop_codon 1907944 1907946 . + 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFTPFSKSISAIGQPRRHNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPHCGQPPVVAPAGAESPRDLPPHFDLDAGDHDDQDPPVDPDNPGANNDKTIQAVYHVVSLVTPVDLVDLVVPVPQSLLTSPTSNVLCWNSSRD # SRAPLRPLVLFSPLSALSDSSESKSKVKEPEVFDGSDPENSRRSSSISPCGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAED # SLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEFFVLTIVIGNARKLESVRLPSGSSAPFTPKPKP # FSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAARLKKPPKQPLRLLKRNRKTKVT # ACTADCSSTTPTVPPLHHSIPEEYAEFADVFNEIAADSLPEHRPYDLKIDLEEGTSPPLGQIYPLSEKELVACHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 Scaffold_4 AUGUSTUS gene 1909737 1910447 0.29 + . g376 Scaffold_4 AUGUSTUS transcript 1909737 1910447 0.29 + . g376.t1 Scaffold_4 AUGUSTUS start_codon 1909737 1909739 . + 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_4 AUGUSTUS CDS 1909737 1910447 0.29 + 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_4 AUGUSTUS stop_codon 1910445 1910447 . + 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MDIEALHQAIILTLPKDPSSIVGLELAKDPSNERWSLGSDGLLRLDDRLYVPNHSDLCLQVLRYFHDHPVSGHFSQNR # TLEAVCHQYTWPKVRDFVRDYVTSCTTCGRNKPRRHRPYGLLKPLPVLVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFDTITSVRPK # VDMKSDLARDFVVNLNKLHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAEHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 Scaffold_4 AUGUSTUS gene 1912487 1912960 1 - . g377 Scaffold_4 AUGUSTUS transcript 1912487 1912960 1 - . g377.t1 Scaffold_4 AUGUSTUS stop_codon 1912487 1912489 . - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_4 AUGUSTUS CDS 1912487 1912960 1 - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_4 AUGUSTUS start_codon 1912958 1912960 . - 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MTTSRTTTTTQPTASTSSRPANPPSPGAPIDEDEDEIIREALARVERVKVWKAAEEAAARKAAEEAEKKKKAAARRQA # AQDARDRAVQAREQEDEVVEQRRKLAEAATARSQGGTSMGDVSASPRRPVVEIPKLKSKGKGKAKAQVRPFLLPINFLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 Scaffold_4 AUGUSTUS gene 1916537 1917610 0.74 + . g378 Scaffold_4 AUGUSTUS transcript 1916537 1917610 0.74 + . g378.t1 Scaffold_4 AUGUSTUS start_codon 1916537 1916539 . + 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_4 AUGUSTUS CDS 1916537 1917054 0.79 + 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_4 AUGUSTUS CDS 1917109 1917610 0.82 + 1 transcript_id "g378.t1"; gene_id "g378"; Scaffold_4 AUGUSTUS stop_codon 1917608 1917610 . + 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MNQRSPIWYHYFDTRDNTESKTTYRGFLLSLVQQMGLSSESIHPALNTLYKSKPFGQLTKQELENILETMMKDRNDMT # IAVDALDECQKADIVKVLNWLAAFSNQLRIVVTSRSKPKLVVQNLLEIQLGGPKSRIDEDIASYIELKIHDQPQFKGDIIGKIKDTLNNGAQECEFRW # VNCQMMQLQQCRKKRDVEEALKTLPATLQDTYDQALRKLEGLPEREKEDVQHVLLWLLYAFEPLTQRKANEIWKVDLLEQKFDPDEMELQVEKDIPST # FVTVGQDNIIQLAHASVKEYLISYQKFKEINDSLSFNEHLAHDIMTQTTIIYLSNIRRIHLIGRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 Scaffold_4 AUGUSTUS gene 1917763 1919243 0.54 + . g379 Scaffold_4 AUGUSTUS transcript 1917763 1919243 0.54 + . g379.t1 Scaffold_4 AUGUSTUS start_codon 1917763 1917765 . + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_4 AUGUSTUS CDS 1917763 1918594 0.54 + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_4 AUGUSTUS CDS 1918687 1919243 0.84 + 2 transcript_id "g379.t1"; gene_id "g379"; Scaffold_4 AUGUSTUS stop_codon 1919241 1919243 . + 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MTDSTVGPLYYGALNGLYGAVSHLIQSAHNLEKYVNASGIALQAASFKGHTSTVKLLLENDVDVNTEGGHYGNALYVA # SYNGHEFIVELLLQNNADANAQGGYYGNALQVASLNGHNSTAKLLLENDADVNAQGGLFGNALQAASSKGNESIMKLLLENNADVNAQGGLFGNALQA # ASLKGNESIVKLLLGSNADVNAQGGSYGNALQAASCMDHESIVKLLLENNADVNAQGGYYGNALQAASYTGHNVIVRLLLENDADVNAQGGPYGNALQ # AASSSCEGHESLVQLLLENNANVNAQGGGYGYALLTASSNGYESIVKLLLENDADVNSQGGEYGIALQAASYMGHVNIVKLLLEHNADVNAQGRYGGN # ALQASSFTGDESIVQLLLENNADVNAQGGDYGNALQAASYKGHESIVKLLLENNANVNAQGGYYGNAVQAASYHGHKPIVKLLLENGALH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 Scaffold_4 AUGUSTUS gene 1920906 1921433 0.91 + . g380 Scaffold_4 AUGUSTUS transcript 1920906 1921433 0.91 + . g380.t1 Scaffold_4 AUGUSTUS start_codon 1920906 1920908 . + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_4 AUGUSTUS CDS 1920906 1921433 0.91 + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_4 AUGUSTUS stop_codon 1921431 1921433 . + 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MSTSRTLTTTTTASSNAGPSRSHQAPPPVCSDPAHHEDDNLGDDLGDKDDEEEILRRAQEQVCRVRARKVAAAAKRKA # KEDAARAAAARKKAVQEAQERALRAQQQEEEIAEQRRLLATAATTRSQRGTSHSEVSASPRRPVVEIPKRRNKGKGKAKAQVHPLLLHYNQRVNDLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 Scaffold_4 AUGUSTUS gene 1924295 1924768 0.6 - . g381 Scaffold_4 AUGUSTUS transcript 1924295 1924768 0.6 - . g381.t1 Scaffold_4 AUGUSTUS stop_codon 1924295 1924297 . - 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_4 AUGUSTUS CDS 1924295 1924768 0.6 - 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_4 AUGUSTUS start_codon 1924766 1924768 . - 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MELHYTSQYHLEADGQTKHVNQTLEQDIRIYCSYQQDDWSHLLPITEFVYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLARDFVVNLDKLHIFLQEEILLAQSRYKEQADRKRILDPEFPIGSEVLFLLSTFDLLVLLKNSVMPCPESHSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 Scaffold_4 AUGUSTUS gene 1927656 1929121 0.76 - . g382 Scaffold_4 AUGUSTUS transcript 1927656 1929121 0.76 - . g382.t1 Scaffold_4 AUGUSTUS stop_codon 1927656 1927658 . - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_4 AUGUSTUS CDS 1927656 1928430 0.76 - 1 transcript_id "g382.t1"; gene_id "g382"; Scaffold_4 AUGUSTUS CDS 1928520 1929121 0.76 - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_4 AUGUSTUS start_codon 1929119 1929121 . - 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPIPSHSPPYGKQPQRRAASESPRDPPPHFDLD # TGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPS # DSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDSTRSAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTN # WDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKP # FSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 Scaffold_4 AUGUSTUS gene 1938481 1938879 0.62 + . g383 Scaffold_4 AUGUSTUS transcript 1938481 1938879 0.62 + . g383.t1 Scaffold_4 AUGUSTUS start_codon 1938481 1938483 . + 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_4 AUGUSTUS CDS 1938481 1938879 0.62 + 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_4 AUGUSTUS stop_codon 1938877 1938879 . + 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MVLTASPYNNNNPSSVSLSYNPLATTPTTTSTPGGFATATATAPSTASSSTGFAVTPTTSTSTSTSNLPDFGSSTMTT # TTMGLTFGSADGSRITSSVGVPSSTGLGLPDPWMLGAEDMGRSRRGEDVGNPWG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 Scaffold_4 AUGUSTUS gene 1941147 1941922 0.46 - . g384 Scaffold_4 AUGUSTUS transcript 1941147 1941922 0.46 - . g384.t1 Scaffold_4 AUGUSTUS stop_codon 1941147 1941149 . - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_4 AUGUSTUS CDS 1941147 1941838 0.46 - 2 transcript_id "g384.t1"; gene_id "g384"; Scaffold_4 AUGUSTUS CDS 1941919 1941922 0.46 - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_4 AUGUSTUS start_codon 1941920 1941922 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MTSLNGHDAIVKLLLEHDANLNAQGGEHGNALYIASLKGHESIVKLLLENDADVDAQGGEHGNALYIASLKGHESIVK # LLLENDADVNAQGGEHGNALQAASYHQYESTVQLLLENDADVDAQGGEHGNALYIASLKGHESIVKLLLEHDADVDAQGGEHGNALYIASLKGHESIV # KLLLENDADVNAQGGEHGNALQAASYCGHESIVQLLLENDADVDAQGGNMGMLSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 Scaffold_4 AUGUSTUS gene 1942007 1943292 0.13 - . g385 Scaffold_4 AUGUSTUS transcript 1942007 1943292 0.13 - . g385.t1 Scaffold_4 AUGUSTUS stop_codon 1942007 1942009 . - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_4 AUGUSTUS CDS 1942007 1942880 0.31 - 1 transcript_id "g385.t1"; gene_id "g385"; Scaffold_4 AUGUSTUS CDS 1942985 1943292 0.13 - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_4 AUGUSTUS start_codon 1943290 1943292 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MIKDRNDMTIAVDALDECQDADAYKVLNWLTAFSKQLWIVVTSRSKPELVVQNLLQIQLGGPKSSINEDIESYIELKI # HDQPRFKGDIIGEIKETLNKGAQGMRKRDVKEALKTLPATLTETYDQALGRLTEEGKEDVQHILLWLLYAFEPLTKRTVSEIWKIDLSEQKFDPDEME # LQVEKDIPSTFVTVGQDDIIQLAHASVKEYLVSYRESKEINDSLSINEHLAHDIMTQTTIIYLMQYKEASFDWRGLVAYAVKYWLLHASKVEEFKMKG # QSQNLICAMLKDNVQFSRWEQMYINHIDFTERYTVGPLYHGALNGLYRGVIHLIQSVHNVKQCIDAEGGYFGNALQGASYYGYESVVKLLLENDADVN # AQGDNLGMLSRQPHVMGMSPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 Scaffold_4 AUGUSTUS gene 1949202 1949978 1 - . g386 Scaffold_4 AUGUSTUS transcript 1949202 1949978 1 - . g386.t1 Scaffold_4 AUGUSTUS stop_codon 1949202 1949204 . - 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_4 AUGUSTUS CDS 1949202 1949978 1 - 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_4 AUGUSTUS start_codon 1949976 1949978 . - 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MLTPPPPATSHKVATIVGAVIGLIVFLSIILALFVLRRRRHRRRAPIDAETFLRERHALYRPTSLPPTLTGTFDEELH # HGQESTSGCSTTAWSEGDPEKKPLYGYPNDYLGHATHILPTLSRKPDTVSTPIPRARSLNNYISSRTEKLGNDPTATSESFPSLALPIPQNSLAPNRT # LLYIQSPHSPSPPYLFLPQSDQGYSIEQSLAQLRGRMKLLLKQLDSESLESDRDCTDRIGDEAEMIQIKLEMDRLQRILDSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 Scaffold_4 AUGUSTUS gene 1950332 1950592 0.95 + . g387 Scaffold_4 AUGUSTUS transcript 1950332 1950592 0.95 + . g387.t1 Scaffold_4 AUGUSTUS start_codon 1950332 1950334 . + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_4 AUGUSTUS CDS 1950332 1950592 0.95 + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_4 AUGUSTUS stop_codon 1950590 1950592 . + 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MNNEIQDKCTYTVACTGICIIPDSSGECGTAINSKPNPLDAENFPLTVNMALMAQNGGSCGSRIQFNIREEEEKAEEL # LFPADGVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 Scaffold_4 AUGUSTUS gene 1966712 1967674 0.96 + . g388 Scaffold_4 AUGUSTUS transcript 1966712 1967674 0.96 + . g388.t1 Scaffold_4 AUGUSTUS start_codon 1966712 1966714 . + 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_4 AUGUSTUS CDS 1966712 1967674 0.96 + 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_4 AUGUSTUS stop_codon 1967672 1967674 . + 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MDPICIPGGFGFSVCSEGFTLFDHGLGSLSSSIPAASRFATPQSNTGSIYMNVDRECSNPVPLLRPILTKEGNEGARS # FRNKTDSSHEIVNVQNTNDADDLDKPQPDVSPRNLQTMPTHGQDEQWELDWVDAELSLGFCHSDTTGHEDNIILQQDEDEEQAEESFVTALESLLSDD # CLPIDKFKDVSQARSSLMCSPVSGTVFLKVDASTPTIAPNTTITATILDSRHPVHVNPDLSALSSITNLKSAGSIVTESKCPSSSPKICSKSTCSPEV # QENPNSSFESTGGTFSSFLHPRNSDCTHENLDSKRSISPNLSLKPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 Scaffold_4 AUGUSTUS gene 1974190 1974506 0.94 + . g389 Scaffold_4 AUGUSTUS transcript 1974190 1974506 0.94 + . g389.t1 Scaffold_4 AUGUSTUS start_codon 1974190 1974192 . + 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_4 AUGUSTUS CDS 1974190 1974311 0.94 + 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_4 AUGUSTUS CDS 1974377 1974506 0.98 + 1 transcript_id "g389.t1"; gene_id "g389"; Scaffold_4 AUGUSTUS stop_codon 1974504 1974506 . + 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MVASNKPIIMEEFGITDDQVDVYGSWYSAIVSSNVAGDLIWQAGSVLSNGESDPNGAVFPGSDVYVLDTQHAAALRAR # DGDPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 Scaffold_4 AUGUSTUS gene 1979859 1981025 0.9 + . g390 Scaffold_4 AUGUSTUS transcript 1979859 1981025 0.9 + . g390.t1 Scaffold_4 AUGUSTUS start_codon 1979859 1979861 . + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_4 AUGUSTUS CDS 1979859 1981025 0.9 + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_4 AUGUSTUS stop_codon 1981023 1981025 . + 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 Scaffold_4 AUGUSTUS gene 1981076 1983511 0.63 + . g391 Scaffold_4 AUGUSTUS transcript 1981076 1983511 0.63 + . g391.t1 Scaffold_4 AUGUSTUS start_codon 1981076 1981078 . + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_4 AUGUSTUS CDS 1981076 1983511 0.63 + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_4 AUGUSTUS stop_codon 1983509 1983511 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTD # TRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFD # IITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREA # QVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGPSIRTSKRRPTH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 Scaffold_4 AUGUSTUS gene 2017597 2018202 0.18 - . g392 Scaffold_4 AUGUSTUS transcript 2017597 2018202 0.18 - . g392.t1 Scaffold_4 AUGUSTUS stop_codon 2017597 2017599 . - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_4 AUGUSTUS CDS 2017597 2017908 0.56 - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_4 AUGUSTUS CDS 2018029 2018202 0.25 - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_4 AUGUSTUS start_codon 2018200 2018202 . - 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MEFSSIIKPMSIATNGSGIAALLRSIRSFLSSNVTTTSVVPIKAFVGSDNLSDDAEMVAYAFWTHYRSYIFEPKAKID # ALRRREKAVGLWESAVAHQARTIQLEIEIGVEQRVAQIMNRYATLAQERANGLEDLAAEMIESDSDDEALWEQGLIRPAVSGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 Scaffold_4 AUGUSTUS gene 2021980 2023670 0.35 + . g393 Scaffold_4 AUGUSTUS transcript 2021980 2023670 0.35 + . g393.t1 Scaffold_4 AUGUSTUS start_codon 2021980 2021982 . + 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_4 AUGUSTUS CDS 2021980 2022270 0.73 + 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_4 AUGUSTUS CDS 2022417 2023670 0.47 + 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_4 AUGUSTUS stop_codon 2023668 2023670 . + 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MDIPMVGSFVDVRGSGSDCLPWIPVFLEARMPLMLYWGTLKDWSVPDVLNGIIPIPAGIVISTLASEQTPYVPPSNTS # KKTFIKWESLNLDVDCACPDRPPGRKGARVYYWDLVEGIRVRTAVGRSNYEDIWERYGSRQRRYDSVADEWEVCTNLDPDDVPDYHDLDFEDDDDDYF # ISVQSHMNEQTGHHMGVVSSEAYLTRLHSSNDDSSVASIEFPDSIEDVARHRLGFLPQRVPDNRNIVLKSQAWKNVLGLLGSGRHPPNPKPDDYVKLQ # LSTFTAGLLNAVDLRHAPQAYDLAVKDSTLRPVITFELDVLSSPNGQFFLIQAKDASDSDPFLIALRSAATVMEISRRKWGPGTEDIIKHLINQGMSF # NTLMPSYPPRHLRSIPCRRPAMLGFRPVGFVPTLQDYRSYEAARNDFLRSARGRAALLAGGIIARLALGVVNENDIYDGPTEHALQEGERALCVWEEG # GSRAFWDDQLTLEEMDLICGSYEVATGISLRIIFFWMHLKYLHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 Scaffold_4 AUGUSTUS gene 2026519 2028778 0.66 + . g394 Scaffold_4 AUGUSTUS transcript 2026519 2028778 0.66 + . g394.t1 Scaffold_4 AUGUSTUS start_codon 2026519 2026521 . + 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_4 AUGUSTUS CDS 2026519 2027170 0.66 + 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_4 AUGUSTUS CDS 2027274 2028778 0.94 + 2 transcript_id "g394.t1"; gene_id "g394"; Scaffold_4 AUGUSTUS stop_codon 2028776 2028778 . + 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MQPCRCRECLAQNPEGLLVSYDVLSTHRHRERLRGAFPSSVRGETAETGEPDTLGVEPAGHTPSESQASSKGKGRAGF # DVETNVDQDMNFSPQAIISEIDVRMETLYHSEICLTFINEPSPHLPFVFPNPETLPQVNSGHFALDTTRLPNRRLLDAEARFCGLLDTIQTMPLGERS # TGEADVEDELFLALNKIHRIKERQWRSQAYPEGRGGSTFDNTALIMYIKFQTPVRQMRVLLALFRCIVRGLSKERNTQSQLPSQIPKDIHTIVDHYDL # DPTLHICVACPKCYGLFRFTNEVLSAAETTYRTTEALPLCTEKSHPDSPPCGGSIWRTRRIGSRTFVTPIRKQVFQDLKEWIGRILAIPGIEEIMSQH # HQRPAPVGDEPVRDFVDSAAFRQFKGADGKPFMIPQVGPSGSPDLRLALSLGFDAFNPFQSKERHAIVSSTALYMVLLSLPEHLRYRQEYIFLVTVIP # GKPSKHQINHTLRRLVKQLLSFWEGVFYVQTAQYSLGRRVFIALMPAVCDTEGATQLAGFASHTHTWFCRRCLLPLNEIHNLEPETWVMRDCGKHREI # ALEWKDASEARREAIYTEHGIRHSELLELPYWDPILFTIIDDVHFAYLGLLKTHLEKIWFIDSERNGGDGLHPSTKDQIRLSRAGLRKLLEEIRRNQS # SLEKLLMKETKAVLWSLCFELKLRTGVRVKRELVNQILQWVSYIRLTIITYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 Scaffold_4 AUGUSTUS gene 2038936 2039403 0.24 + . g395 Scaffold_4 AUGUSTUS transcript 2038936 2039403 0.24 + . g395.t1 Scaffold_4 AUGUSTUS start_codon 2038936 2038938 . + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_4 AUGUSTUS CDS 2038936 2039403 0.24 + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_4 AUGUSTUS stop_codon 2039401 2039403 . + 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MSLPVLMNGFPLLPRILVTAEVEVFTVINPSNGPGLAHSQPPADYQVYIPSLVDAGAKQNTLHLLGYVDTANGQRNSV # EVLMDIETYAGWDEEYRPEGVYFDNSPTGAAYLALFNEYGNSVRELFGETGTVSSYCSGFPRGWTDLADCDYICRLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 Scaffold_4 AUGUSTUS gene 2054387 2055610 0.54 - . g396 Scaffold_4 AUGUSTUS transcript 2054387 2055610 0.54 - . g396.t1 Scaffold_4 AUGUSTUS stop_codon 2054387 2054389 . - 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_4 AUGUSTUS CDS 2054387 2055610 0.54 - 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_4 AUGUSTUS start_codon 2055608 2055610 . - 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MSSSDFSHHSRPNLYDRQTQGGTDDSEDGSGSDTDTESNVGDSKSGNGLEHTDTEIISDVSASGAGYSGSQSSLMSVP # SQLIRDTMDEVLAKSNDGQNDEEGEEGTGKLRGSLELSGHEDYEARCTNIDEDRDTDSDTETERGIGRGCAYTSFSTVSSISPTSSTSDLSSLSQSSS # SSELDDPPPAPPAISSVAGPTTTTHPKQPPAPPPPQTGLPDIPVLWSERDAAAELPKNHNPQGMNEKFQASRTNYISDFSSVLHHDSKYKYGVGDVHP # RKIHDVVEETQGCASSLISSSASAHVPRIDHSDPLNVADSSSRTHTMLDSESISSKDLASSPLVDAPNTIIKSNDQLEEIRTAKINDNENETSPLDPS # TSAGQSSALSSDDRTSTPTPAILMTSPLKRNVVEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 Scaffold_4 AUGUSTUS gene 2064089 2064977 0.32 + . g397 Scaffold_4 AUGUSTUS transcript 2064089 2064977 0.32 + . g397.t1 Scaffold_4 AUGUSTUS start_codon 2064089 2064091 . + 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_4 AUGUSTUS CDS 2064089 2064277 0.32 + 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_4 AUGUSTUS CDS 2064399 2064977 0.8 + 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_4 AUGUSTUS stop_codon 2064975 2064977 . + 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MAMVSIIQEHQLADVVDLVAGGHLMLISSEEEYASLKEDYLAASRAGLNVGDVEWLPEEDVDRLYLLANSSTPHFTLS # LHTHTPVTSVTPLSSSRIWSVNTPRGSVKCSHVLHATNGYASHLLPQFGGPSGIIPTRGQIVVMRAATPVNDSWKASWGGLDHYWFPRPVNGSISDHG # PEDEKENPVVILGGGRHIGGPAFEQYETDDSVVNTALGEELRAFLPETFPHMFNKGEDAEMEWVRVAILLFGIAWTDLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 Scaffold_4 AUGUSTUS gene 2086601 2087137 0.99 + . g398 Scaffold_4 AUGUSTUS transcript 2086601 2087137 0.99 + . g398.t1 Scaffold_4 AUGUSTUS start_codon 2086601 2086603 . + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_4 AUGUSTUS CDS 2086601 2087137 0.99 + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_4 AUGUSTUS stop_codon 2087135 2087137 . + 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MQTTSGNDLSLRHLPDLSNTSFSFDIPSGSNDLLLDNDDDFFGVADDSFATPAPSRTIDQRLATPRTSARIAEIRTHI # SETTVLSNSSLRNFARPPVPAENPKKASTKPVVAQNLAAATRNQVLSTPQRMQRLRAEIKDLAETRYISLGAFTTSSDSVEQEAPKPNSRVSEFPHSA # NS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 Scaffold_4 AUGUSTUS gene 2102050 2102772 1 - . g399 Scaffold_4 AUGUSTUS transcript 2102050 2102772 1 - . g399.t1 Scaffold_4 AUGUSTUS stop_codon 2102050 2102052 . - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_4 AUGUSTUS CDS 2102050 2102772 1 - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_4 AUGUSTUS start_codon 2102770 2102772 . - 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MDTTTSTSSSLSVSISSVDVPLKSTSSFDPLSPSTFETSLPFNTEDIEMEEGGTYQGTGEPMKQVVVETGAEGADDQR # FGGVGDVSEGTSAIVLCYPMCSSTLVFAAGPDSDEGSEYQDEFPEAADEENQMDENDLAPTSTPVLAIQAHSLLAKFNVVVEPVFRLTICTECNKPVP # FNHMRQHQSQTHYKGLNLPSELRLPSSTIILSLLAVLGADRPGRSHTRQYLVSKALKLSMVIGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 Scaffold_4 AUGUSTUS gene 2109448 2109939 0.85 + . g400 Scaffold_4 AUGUSTUS transcript 2109448 2109939 0.85 + . g400.t1 Scaffold_4 AUGUSTUS start_codon 2109448 2109450 . + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_4 AUGUSTUS CDS 2109448 2109939 0.85 + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_4 AUGUSTUS stop_codon 2109937 2109939 . + 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MDTQQQAFDTLQEAFISAPILALWTLDRPTPIEVDASGFATGSALMQKQDDGQWHPVTFRSASMQPAERNYEIYDQEM # LAIIEALKDWRNFLEGLPQPFNIITDHCNLEFWRTAQDLTRRQARWALYLSRFDFHMIPRPGRINTQADALSHMAAHQVLDNEDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 Scaffold_4 AUGUSTUS gene 2114851 2115531 0.88 + . g401 Scaffold_4 AUGUSTUS transcript 2114851 2115531 0.88 + . g401.t1 Scaffold_4 AUGUSTUS start_codon 2114851 2114853 . + 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_4 AUGUSTUS CDS 2114851 2115531 0.88 + 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_4 AUGUSTUS stop_codon 2115529 2115531 . + 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MGSFYGDAQWQGPFLVLCFNDTYLWFGQADSSSWGTQGQQGNGFGLPPAKKRKVDPNEASSALPSPSPTTSSSAVAIA # APLTPPTSSPVDLSDNGDRDVAVTSVVTPALTLATTPAVTLPVVIDTDWVFFDHPTTILIFQYLHEQMPAVARTFPYEQVMLKTVARDHQRLWRCSTV # LLSNKKYEFKKVFTLGLKAEDGSCCFWCWTPQHPEFYHEDEPCDGFSRVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 Scaffold_4 AUGUSTUS gene 2124389 2124748 0.6 + . g402 Scaffold_4 AUGUSTUS transcript 2124389 2124748 0.6 + . g402.t1 Scaffold_4 AUGUSTUS start_codon 2124389 2124391 . + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_4 AUGUSTUS CDS 2124389 2124748 0.6 + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_4 AUGUSTUS stop_codon 2124746 2124748 . + 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MQASQSPTNSANTPPLLDNQESVKLLSNVIKTNISACSSIGGEAYTSQIARIFTDMLGLYKTISGMISEVIAKEGKHL # TLISAKICTKFIAFTLSSRCPHSQNSANPSTARTEKKIYSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 Scaffold_4 AUGUSTUS gene 2153104 2153644 0.82 - . g403 Scaffold_4 AUGUSTUS transcript 2153104 2153644 0.82 - . g403.t1 Scaffold_4 AUGUSTUS stop_codon 2153104 2153106 . - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_4 AUGUSTUS CDS 2153104 2153299 0.82 - 1 transcript_id "g403.t1"; gene_id "g403"; Scaffold_4 AUGUSTUS CDS 2153388 2153644 0.82 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_4 AUGUSTUS start_codon 2153642 2153644 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MIAGFKLLAKTYPEDGERLGRRKVIGIDASATPAETRSQVLRIAKATAEKIGLGADEIEEDDVILDERYHAGTYGIPD # KQTIEAIRYGARMDAFITDPVYEGKSLAGMIDMVKKGEIRALDGENSTNILYAHLGGQLALNAYWDMEERAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 Scaffold_4 AUGUSTUS gene 2164260 2164826 0.89 - . g404 Scaffold_4 AUGUSTUS transcript 2164260 2164826 0.89 - . g404.t1 Scaffold_4 AUGUSTUS stop_codon 2164260 2164262 . - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_4 AUGUSTUS CDS 2164260 2164513 0.91 - 2 transcript_id "g404.t1"; gene_id "g404"; Scaffold_4 AUGUSTUS CDS 2164583 2164826 0.92 - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_4 AUGUSTUS start_codon 2164824 2164826 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MHYSQLLRVLLSAALALHATTVTASPIRAPDVEGGIGASALGKRATIELYHVTTAASAASIHSGGVKLQVKPTIGDDF # NPKGKGGFYVSDNKAAGILDWCKKRQVDANNVKTNCADLITFKFDESALTSLKVHKFGPATLSSTTINTWMEVSQVLANSSLYSDEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 Scaffold_4 AUGUSTUS gene 2173894 2174514 0.6 + . g405 Scaffold_4 AUGUSTUS transcript 2173894 2174514 0.6 + . g405.t1 Scaffold_4 AUGUSTUS start_codon 2173894 2173896 . + 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_4 AUGUSTUS CDS 2173894 2174514 0.6 + 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_4 AUGUSTUS stop_codon 2174512 2174514 . + 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MFSPFDKIPAPARSGVRTVAPRASSFQIASCTLLDDPFATQSIPTPRKYNSNNKPPIHNPFSDPFVTPTTSSPQQLQQ # PKQLPFKLTNRKPKKGCELAQNPLRPNVQAADRIHAWNTHTQYRRDFEEASSLPAKVIELGDMIMAKGTVKPTKEVYAAGLLRFNQFGDLMGISESDR # MPASDRLIIGFIGHYAGKVSGKSFQIGYLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 Scaffold_4 AUGUSTUS gene 2181286 2182469 0.44 - . g406 Scaffold_4 AUGUSTUS transcript 2181286 2182469 0.44 - . g406.t1 Scaffold_4 AUGUSTUS stop_codon 2181286 2181288 . - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_4 AUGUSTUS CDS 2181286 2182160 0.6 - 2 transcript_id "g406.t1"; gene_id "g406"; Scaffold_4 AUGUSTUS CDS 2182331 2182469 0.63 - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_4 AUGUSTUS start_codon 2182467 2182469 . - 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MPPLTVIHSLSRYTPLALSLVLAFLAALWVSQSCWLSVSGICHSASFSHSPGSSESQTTPVPNGESASSLSAPAAGPP # ANNNNISPARSPPSVSFFNSHQLPHPALGPPHSSSSSGLHLPHQLSPVVSGSSASTNPIGVPPADPAPAVIGPGTCPGDGRCDGTGGSKTCSGCPTFN # NNVNNAFTMCARVEEGDRKRSPATSQQQHSQHHTTGVATSLHHPMPPQQISQHTGSATAAGASPSMMGGVTPGGDGSGSVDPNNHNGGGGGPTGSGNT # NNFGGGDGSGGGPGTPGGGNGNNNSRKVRAAVGALCCANCGTSATPLWRRDDVGNNICNACGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 Scaffold_4 AUGUSTUS gene 2182957 2183445 0.66 - . g407 Scaffold_4 AUGUSTUS transcript 2182957 2183445 0.66 - . g407.t1 Scaffold_4 AUGUSTUS stop_codon 2182957 2182959 . - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_4 AUGUSTUS CDS 2182957 2183445 0.66 - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_4 AUGUSTUS start_codon 2183443 2183445 . - 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MEPPIPASFNAIHAASLATISKYTQYAAGPASTVRATEHPARQLSDLSANLSSSTANSTSAESPDSSDSNSVTSPSIQ # TQQLVVELARLHKNSDSVLDPQLDSRSDSASPTLTNQSQSDKLSPVVRQPCENCHTLDTPLWRRDSEGHPVCNACGEYTFPDPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 Scaffold_4 AUGUSTUS gene 2197324 2197812 0.72 - . g408 Scaffold_4 AUGUSTUS transcript 2197324 2197812 0.72 - . g408.t1 Scaffold_4 AUGUSTUS stop_codon 2197324 2197326 . - 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_4 AUGUSTUS CDS 2197324 2197812 0.72 - 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_4 AUGUSTUS start_codon 2197810 2197812 . - 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MDILLRGISTEYTVSVGGVVNSESLARQAVVIAEAYQIDRMYSDRFKGYSGDLSPPTADPFIELFFTPGSVSLAVAAH # TILPLSRGSIHINTADPSADPIADMQYLTSEVDIRAAVAAARRISLIAVTPPFSDLITEDALHQSGVPLVNATEEEVRKWVLDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 Scaffold_4 AUGUSTUS gene 2200810 2201856 0.76 - . g409 Scaffold_4 AUGUSTUS transcript 2200810 2201856 0.76 - . g409.t1 Scaffold_4 AUGUSTUS stop_codon 2200810 2200812 . - 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_4 AUGUSTUS CDS 2200810 2201856 0.76 - 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_4 AUGUSTUS start_codon 2201854 2201856 . - 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQE # IERYIRMYVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYTPEFSIPIGSWKEYPSITDRLDALRHAREDAEAALRMSKQRIADTIAEHPNQ # PSFEVGQPVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDS # RIHGRWKKLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 Scaffold_4 AUGUSTUS gene 2205210 2205752 0.87 - . g410 Scaffold_4 AUGUSTUS transcript 2205210 2205752 0.87 - . g410.t1 Scaffold_4 AUGUSTUS stop_codon 2205210 2205212 . - 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_4 AUGUSTUS CDS 2205210 2205752 0.87 - 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_4 AUGUSTUS start_codon 2205750 2205752 . - 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT # SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKHVLRPQMPRPMPSSSLNGSTRIGPRWEPLPSNSTQTALATQTKTCETGSTIT # LQIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 Scaffold_4 AUGUSTUS gene 2220294 2221608 0.64 + . g411 Scaffold_4 AUGUSTUS transcript 2220294 2221608 0.64 + . g411.t1 Scaffold_4 AUGUSTUS start_codon 2220294 2220296 . + 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_4 AUGUSTUS CDS 2220294 2220355 0.68 + 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_4 AUGUSTUS CDS 2220657 2221608 0.83 + 1 transcript_id "g411.t1"; gene_id "g411"; Scaffold_4 AUGUSTUS stop_codon 2221606 2221608 . + 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MIFKFQIKRAPSGTIVTCRFKYHDTSYELIAKRAGLTPDATLINGKGRYVGGVSILKVLPAQLQRLPLLSQPNIPLEV # INVEYGKRYRFRVISMSCGVDHGFSIDGHDLTIIEVDGVNTQPLTVNHIQLYAAQRYSVVLHANQKPDVYRIRALATSGVGAQNFTNGVNSGILRYQN # AAGNSDREPTSSQQSHMVSLNENDLRPLECPGAPGKPYPGGADLVLNLTMGFGVAPGASAPSFFMNNVSYVSPKVPVLLQILSGAQSAQDLLPAGSVY # TLPRNKVIEINLLGGSAIGGPHPFHLHGVCIQILVSHLPPLSYLYFSMPSMLSRPQVAQTTTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 Scaffold_4 AUGUSTUS gene 2224870 2225964 0.86 + . g412 Scaffold_4 AUGUSTUS transcript 2224870 2225964 0.86 + . g412.t1 Scaffold_4 AUGUSTUS start_codon 2224870 2224872 . + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_4 AUGUSTUS CDS 2224870 2225502 0.87 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_4 AUGUSTUS CDS 2225656 2225964 0.98 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_4 AUGUSTUS stop_codon 2225962 2225964 . + 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MSKETKALAATSPQKIEASTITRRAPDDQDVAINIKFAGICHSDIHTVRSEWKEVEYPLVVGHEIAGIVSAVGKNVTK # FKVGDRVGVGCMVNSCRECDNCKDGEEQYCADMVGTYNAKDPKDGTITQGGYSQYVVVDQAFVLNIPENLPLDKAAPLLCAGITVFSPLNHWKAGPGK # RVGVIGLGGLGHVGVKIAKLVSCIIGVHDPQKLIFVSAKIPLDKYLSSLRRDGSLVQVGAPSDPLQITPFSLLPQRIGIHGTLIGGIAETQKMLDFCA # KKQIFPEIEVVSASYINEAYDRVVKSQVKFRFVIDVSTM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 Scaffold_4 AUGUSTUS gene 2227068 2227379 0.8 - . g413 Scaffold_4 AUGUSTUS transcript 2227068 2227379 0.8 - . g413.t1 Scaffold_4 AUGUSTUS stop_codon 2227068 2227070 . - 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_4 AUGUSTUS CDS 2227068 2227379 0.8 - 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_4 AUGUSTUS start_codon 2227377 2227379 . - 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MATQQSLVLESKQGNFIISERPIPHLEPGELLVKVQAAGLNPVDWKIQAAGFLVESYPAVLGSDVAGDVEQVGEGVEG # WAKGDRVLVLLGRGNPVLFISNIIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 Scaffold_4 AUGUSTUS gene 2229778 2231571 0.69 + . g414 Scaffold_4 AUGUSTUS transcript 2229778 2231571 0.69 + . g414.t1 Scaffold_4 AUGUSTUS start_codon 2229778 2229780 . + 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_4 AUGUSTUS CDS 2229778 2231571 0.69 + 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_4 AUGUSTUS stop_codon 2231569 2231571 . + 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MDEPSEVSMDITRSPFHSIIGTNCSLSQVERASLKEFLVAPQLEKSRLEAELSRVQAHLKSTEEYIHAHQMLLSPIRK # LPPETLAEIFMHCVLAADAVRSLQEAPLLLTIICRDWRRVAIDTPLLWKSLHFYLPPHLNQDALSLRLAGISLWLERSGSLPLSISFHGRTAYSSPLV # GEFDEHQTKKNMESCIRTLMRFADRIATLSLSLPLSDFALFDELSPPKFPALIYLRLRDANLHEGSYGHLSETPAIAFLPSLLGRMPVLSTLKVHEFH # LRRNAALSFGLGSLTNIDLSTGGITTFGVLLTTNEGLALLAQTPLVQSVKITIHLGNSNNNPNDTSSPARTEVHLNQLVEMRLVFIRVSRLVELSSDM # QTHMTLFFDSIQCPLLESFSVSWQGLLITQLPFRALPLNRLDSLDLDISMDSTTLLECLSLVTNIKSLRFNATSGRGGPGNAMITCSFEESHLLGLTQ # SSKDVVPLCPRLQKLQLIMKTTDGGLNMNTTALINLIQSRRNTLTYCDLFFRNRPPFSPEQLINLRKLKDDGLSLRLHCAKPLLPPNLDPPTMGLPDL # PYMHRRPLLHQMYTVPDVMEGLYGTEVII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 Scaffold_4 AUGUSTUS gene 2240674 2241333 0.88 + . g415 Scaffold_4 AUGUSTUS transcript 2240674 2241333 0.88 + . g415.t1 Scaffold_4 AUGUSTUS start_codon 2240674 2240676 . + 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_4 AUGUSTUS CDS 2240674 2241333 0.88 + 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_4 AUGUSTUS stop_codon 2241331 2241333 . + 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MVKYYKTGHAAVSAFAEHPAVKTIQYTDHYARTRSMIKYSLVLSSEGTVVPLPITVPSPPNHGHPNHHPHHPTVADIP # QDLHEIFTHRLPDEIYFYLSRGLLGPQALVWLTSGQIVENPPLDNGETTEYKRFVKEVITDGQTGPRATALALISSVAHSFWSSRKVHGYFWFESQAL # HNQKPVQHNSAQTAQLAERVSGWNVTYSVVEEELRRQNVSSPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 Scaffold_4 AUGUSTUS gene 2248300 2248893 0.99 - . g416 Scaffold_4 AUGUSTUS transcript 2248300 2248893 0.99 - . g416.t1 Scaffold_4 AUGUSTUS stop_codon 2248300 2248302 . - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_4 AUGUSTUS CDS 2248300 2248893 0.99 - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_4 AUGUSTUS start_codon 2248891 2248893 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MEAEIRKLTKRRDGGDDDSDDERKKKKPKTSYLEAELGKYASSRGIKTKGSKGKGRAKDERDVLNVLNAFRGKLQMAL # PAAPEDDSEGKIGADGTENNLLKHEEAKETQPPPANFPVGEDPGIEIDNDRGFLGHSLHFPKDDGEESRKAERDYEVIDPRQRGARAKEEEKARKAKA # KYRDGGRGSRGRGSSGGGYQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 Scaffold_4 AUGUSTUS gene 2255054 2256034 0.94 + . g417 Scaffold_4 AUGUSTUS transcript 2255054 2256034 0.94 + . g417.t1 Scaffold_4 AUGUSTUS start_codon 2255054 2255056 . + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_4 AUGUSTUS CDS 2255054 2256034 0.94 + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_4 AUGUSTUS stop_codon 2256032 2256034 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MALFETFSNTSTESLLGTQYLSVSRRGSAPASPMSSTFFDSDLLARSISPVPSNYALYTRSRPTSTDSSFFDFQSFVP # VTSNQPQVSAAANNSTGLMDQLAGALRRVEENNQISPLIDDKASFMSKQTTRSRVIRRSDVVVEAITDGEQGLLDVVPVTEDQAENKKNRRFLPKFLR # RAMSTSGALNAQILDRKTAFSKPGHSPLTPSSRANTVPTSVSKGKGKAHSMFRFRGHQGEKPVQAPPPLVLPDEIVQRRRQVRRSGSFAGFSTSPFAP # SSPIVFRHHGLFSNTCAEPVGADGDEDELDALTLEATALSAQIGQRWMYAED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 Scaffold_4 AUGUSTUS gene 2261763 2263739 0.57 - . g418 Scaffold_4 AUGUSTUS transcript 2261763 2263739 0.57 - . g418.t1 Scaffold_4 AUGUSTUS stop_codon 2261763 2261765 . - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_4 AUGUSTUS CDS 2261763 2263739 0.57 - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_4 AUGUSTUS start_codon 2263737 2263739 . - 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MYSTAKPFLALQKYRPQSVTDIQLLQRFPKRNCWISKYIKRRTGHDRSPKQVGSRLQQLRDSCRDERSKWIFPRWDGR # MPEYFSVLQLLSRKQYDDNDDNDSVTSCSTSLDSFGSTPPSESTGSPHSSSPISVPSPGTDTEVYTNDVSALEAKRHTLVRIELTSPLSHFICSPISF # DTISSDREIGPTIVCVDLKLASLVTTLFSWKNPMISLHSARVLDVTEHHCLFKVFLDGMMVHLDRTEIGLQSTLAQTRNGTTRQMYLYETKFLPKYWT # ECFSSVGQYQLTESIVIDSIDVPSLDLACCEVHQCLIKRRLISDNDTDFLSLKEHHEDEVVHTVRYTFVDLRSTPPSTPSDEPVELWKPPLEETSYES # PLNGSVTHASDALGLDAPAVHPKAESSRDGRAHFPVKEESHTPPSEFSPLSQDLSNGMPEPPVQSTQCLYELADHTQPTTYEFDFSITSSSANDMPAL # VYPSAYTATTFTPQCNHPLTISSTEWLQQGQWTAQGYRPQHPETMSSPHNKRYAYFWEQPISYAHISSYLGQADPLSYNSTASETQETQEPYAYAQPD # YMMTPVGSAHSDYANDLYQRQDDRKMREGPCVVYENVSHSPCSDSSSELAYAPETLMTKSTYSHLPPPPYVCAPNNENGYQMCSSTQVWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 Scaffold_4 AUGUSTUS gene 2264721 2265002 0.4 + . g419 Scaffold_4 AUGUSTUS transcript 2264721 2265002 0.4 + . g419.t1 Scaffold_4 AUGUSTUS start_codon 2264721 2264723 . + 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_4 AUGUSTUS CDS 2264721 2265002 0.4 + 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_4 AUGUSTUS stop_codon 2265000 2265002 . + 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MDPLAGMDDSSTDDDNASQTTEDDPQIPEHAPAPPPPPLAVPPPQPQPGSAPAPREKPHYESRHILNGHTMSISAVKF # SPDGTLLASCGLFRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 Scaffold_4 AUGUSTUS gene 2266647 2266943 0.98 - . g420 Scaffold_4 AUGUSTUS transcript 2266647 2266943 0.98 - . g420.t1 Scaffold_4 AUGUSTUS stop_codon 2266647 2266649 . - 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_4 AUGUSTUS CDS 2266647 2266943 0.98 - 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_4 AUGUSTUS start_codon 2266941 2266943 . - 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MRHSASKSSLRSSPSSSSLRPSSPSQGLTVKVPSSKDFQEPASAVGYSPMVQAANAALLARPAFTIDDSKDDDDDAED # ELEAGDNDDQVMDEVGLSSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 Scaffold_4 AUGUSTUS gene 2270149 2270394 0.52 - . g421 Scaffold_4 AUGUSTUS transcript 2270149 2270394 0.52 - . g421.t1 Scaffold_4 AUGUSTUS stop_codon 2270149 2270151 . - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_4 AUGUSTUS CDS 2270149 2270394 0.52 - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_4 AUGUSTUS start_codon 2270392 2270394 . - 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MSTISTALRDFKEPTKEQITQNFFSLASLPAAIGKDAREADDEVEKMDINAVLSLGVEGEEDSYVGCTALVVLDIALI # TTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 Scaffold_4 AUGUSTUS gene 2276465 2278403 0.16 + . g422 Scaffold_4 AUGUSTUS transcript 2276465 2278403 0.16 + . g422.t1 Scaffold_4 AUGUSTUS start_codon 2276465 2276467 . + 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_4 AUGUSTUS CDS 2276465 2277025 0.81 + 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_4 AUGUSTUS CDS 2277076 2277515 0.28 + 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_4 AUGUSTUS CDS 2277932 2278403 0.76 + 1 transcript_id "g422.t1"; gene_id "g422"; Scaffold_4 AUGUSTUS stop_codon 2278401 2278403 . + 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MRPQEILGMVEEAAGTRMFEERKEAARKKMSKKDKRMQEVTSILNEEITPKLNKLREEKRSFLEFQKSEKELEQLNRV # LTAWEFQTLTQDVENAKGEIEQAKENAKMSKKEAEKQIKEVERAEQDMHKVQKQRDAEMKKGGKLSQLEEEKAATEKEMVKLSTQEELMRGTIRDEEA # KIGTSEEAVKKAEDSLKLKKAEADRLETSYNAIKSEHNASQAKLTSDEELLQTLLTGLSSKSATHPGSGGGYMGQIADARARIAQGAAEEEQARMNLE # MSNNELQSLETQFKRVEKDAGDGKKRIETTRRALADAQKRLAACGWTAETEQEGESRGAHEPQKVKAATQISQGKARPALDLLKYDPRLDNAVSHVFG # GTFICDDTESAQRVTFDKSIGQRSVTLQGDVYDPSGTLSGGSAPSSSGILIKVQELLDIEDSLATVEAHFNEFERTWNGDSTKRKREAYKNISKEVQI # KEHELKLAEEQNEESNAERV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 Scaffold_4 AUGUSTUS gene 2280666 2282112 0.56 + . g423 Scaffold_4 AUGUSTUS transcript 2280666 2282112 0.56 + . g423.t1 Scaffold_4 AUGUSTUS start_codon 2280666 2280668 . + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_4 AUGUSTUS CDS 2280666 2280994 0.57 + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_4 AUGUSTUS CDS 2281737 2282112 0.61 + 1 transcript_id "g423.t1"; gene_id "g423"; Scaffold_4 AUGUSTUS stop_codon 2282110 2282112 . + 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MSESSVATAPIADTTIAPPTAEETVSEVVAEGASAEPPTTIAAVEDELEAKDEQSAEKEAKETKAPSRRSTRISSKSQ # PETKETPKLKRAPSTKKRAVEDGSEGSKATRSLSIGEYLHGSIIYTLPFWSSPSSERRLTVVLSSSFSSSPKIALEFIQSYVPISSGTPVETGNGEAN # SNEHAGVTTSNGTGSSTKETVSMEESIEKADVESAAPATNGSEDKDVVMEAAAPIVEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 Scaffold_4 AUGUSTUS gene 2283168 2284335 0.39 - . g424 Scaffold_4 AUGUSTUS transcript 2283168 2284335 0.39 - . g424.t1 Scaffold_4 AUGUSTUS stop_codon 2283168 2283170 . - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_4 AUGUSTUS CDS 2283168 2284022 0.58 - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_4 AUGUSTUS CDS 2284135 2284335 0.41 - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_4 AUGUSTUS start_codon 2284333 2284335 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MQLIISILFNLHRNRVHVPVPVPNRIPIVREQAVVDEQLQHPPAKRRRTLAGSIVSTAVNAALVGTARTIGETSPSPP # PPPYSPPSPDVNVIPPTPRTARKSRRPHEAHSTRRRPARKVLHNIASFGPSTSGSQSALFPPTQPEFDFSSSSVKSSPRRNREERRTHSPAFNNVSSD # HVEDLQDAIDPDTDDQMDQIDSLGSKLSFLIEQGKRALGREIVVMSEVEEDAVDDGSGAWIEEDQEGEGEFGKRGRGRLSRSGSVSRRRAAGSASSAT # VNLGRRTGAGMNVNPPPYGTGLGVPSALPSSSPSTPPASLPTFESSWESPELKETMERARAIVRQRKSMNFRTDIES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 Scaffold_4 AUGUSTUS gene 2291819 2292547 0.53 - . g425 Scaffold_4 AUGUSTUS transcript 2291819 2292547 0.53 - . g425.t1 Scaffold_4 AUGUSTUS stop_codon 2291819 2291821 . - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_4 AUGUSTUS CDS 2291819 2292547 0.53 - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_4 AUGUSTUS start_codon 2292545 2292547 . - 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MDTPNHLGSDILKSANPIISVIGAGAMGSQIAHRLFQAGAGPILTNLDGRSPETCKRAIECGMKDTSYADIVSRTTYI # LSVVPPKDAFAIAEIIADTVKISNAEETTSSQARTKLVFIDCNAVNPSSAKQMAKLFVNTSATFIDGAIVGGPPSEVYNPGLYICANPNDEAVLDEVE # VTLKKYGLQPFSLKGEGTGIGDASAVKMANSVRSTQSTLVSDFLANVFIIGNRQGCYCIVHFHDSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 Scaffold_4 AUGUSTUS gene 2296560 2297706 0.26 - . g426 Scaffold_4 AUGUSTUS transcript 2296560 2297706 0.26 - . g426.t1 Scaffold_4 AUGUSTUS stop_codon 2296560 2296562 . - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_4 AUGUSTUS CDS 2296560 2297629 0.69 - 2 transcript_id "g426.t1"; gene_id "g426"; Scaffold_4 AUGUSTUS CDS 2297682 2297706 0.26 - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_4 AUGUSTUS start_codon 2297704 2297706 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MEETKKKKSKKNSKEKSKTKAKAPAPPPVAPSFNDYRKKVTADQENDFMLNLFGELDALPTNAPSLTKSRKRKTSPDY # DTSGNSSPAPYRKRPSYTDASSDGPDDFYGAPSSDDFLSSPRKRVKTEPEGLLPATERLAQIDVKTDEDDFPGDESFDDIDMDAFMAVEDDVDMKPVA # SVPVETPGMEHLDEKKPASWLAVYDSLAVSSEDPLGPLATNTSSIKSSDVSALEPDGSLRFFWVDYLEHQGELFFIGKLKDKKSGAWVSCCVAVKNLE # RNLFILPREKRAEQGEDDEWYDTDEVPELTDVYKDFDAIRSKRDIKKFKGKFVERQYAFGDPNIPRKKTTWMKVAYHFTGKTIWFLPLQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 Scaffold_4 AUGUSTUS gene 2298358 2298660 0.44 - . g427 Scaffold_4 AUGUSTUS transcript 2298358 2298660 0.44 - . g427.t1 Scaffold_4 AUGUSTUS stop_codon 2298358 2298360 . - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_4 AUGUSTUS CDS 2298358 2298660 0.44 - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_4 AUGUSTUS start_codon 2298658 2298660 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MMCRIGSPYGPEPSPKDMRFSRDKIWVDRSWRCGVWNERRLLLSEDRCLWILPIMFWYIELARTRDFTLPNPGTEGAS # EAVGEDVEGTMATVNPSLGFEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 Scaffold_4 AUGUSTUS gene 2299753 2300184 0.44 - . g428 Scaffold_4 AUGUSTUS transcript 2299753 2300184 0.44 - . g428.t1 Scaffold_4 AUGUSTUS stop_codon 2299753 2299755 . - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_4 AUGUSTUS CDS 2299753 2300184 0.44 - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_4 AUGUSTUS start_codon 2300182 2300184 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MHQQGSKPVFTIQQRTPIGQTCFNSNIIHHILRIDPIETCTLENRYNARRNAPGKDLGVKLGQDEVDVKILDLVCETA # KLVFEIKEETSKDVGGFYHGDFTSRYLDQGGIPALERVEVTFAQPGALGRKHETRIRSSMSNTIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 Scaffold_4 AUGUSTUS gene 2301504 2302232 0.96 + . g429 Scaffold_4 AUGUSTUS transcript 2301504 2302232 0.96 + . g429.t1 Scaffold_4 AUGUSTUS start_codon 2301504 2301506 . + 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_4 AUGUSTUS CDS 2301504 2302232 0.96 + 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_4 AUGUSTUS stop_codon 2302230 2302232 . + 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MLARDLQRHIVQRAHFSTTTNNEVKKRLRSLLRESAQPVAVVTSLLHYNDTSPNDYHGATLSSFSSIALDPYPLVAFS # LRIPSRMATSLRSAHPDPPSDMVVNILSATQAPTAVLFSRPDLHPNPFQEVEFTLNREGIPVLEGCLGALSCKLATNPILLDDPGFSGRDFENDSRSG # SGDAESENEISPPSITSELFIARVTNIERLALDEADTNDPQTMPLLYHRRNYLTCSSKYLLDYQKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 Scaffold_4 AUGUSTUS gene 2308311 2309991 0.21 + . g430 Scaffold_4 AUGUSTUS transcript 2308311 2309991 0.21 + . g430.t1 Scaffold_4 AUGUSTUS start_codon 2308311 2308313 . + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_4 AUGUSTUS CDS 2308311 2308628 0.43 + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_4 AUGUSTUS CDS 2309233 2309991 0.27 + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_4 AUGUSTUS stop_codon 2309989 2309991 . + 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MFGYGAWKDGKHIVGGRNMRMEKEIYGEADDPSKQHTGINFEKYDDIPVEATGADVPEPVTSFTSPPLDPVLLENITY # ARYTTPTPVQKYSIPIVANGRDLMACAQSTSENITQKFEYVEDNDKRVFYWTSLTLTPTKALVFTLIFVETKRMADMLSDFLIHNQWHATSIHGDRTQ # REREMALQTFRNGQTPIMVATAVAARGLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVSTAFYNKGNKNIVKEMVELLREANQEIPGWLEVSA # HEASFGGSFRGRGRGRGRSGGRDYRAGGGSSYGGGGGGYGNHTSHSTSGGGYGGRAGGPPSYGSGGGYGGGYGGSSGGGGGGWW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 Scaffold_4 AUGUSTUS gene 2311507 2312568 0.85 + . g431 Scaffold_4 AUGUSTUS transcript 2311507 2312568 0.85 + . g431.t1 Scaffold_4 AUGUSTUS start_codon 2311507 2311509 . + 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_4 AUGUSTUS CDS 2311507 2312568 0.85 + 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_4 AUGUSTUS stop_codon 2312566 2312568 . + 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MCRNVSSPIFDVPEFPTLRRVKPLPKRRRTSSTHFSVLDSSTTNNIDSGSRNTPRMLVAETNGVPHSLHMPGLPPIPL # SLPGPDATAEELLAHADALQSYYFPILDAAAANINAVADGFANAVEPGYIHPGSDILSDLEPGNLASSPGVGLAGLGIHNLSLRDRDEHSDRGDGDYI # DQPGNAKKRKVPANTSHLQGARDATSGEEDAEDPDGPLMIGIPTGTLEAGANDSNTGQGDGGGEGAGEGGKSSMSTFRRLLGRRKTRLSAVTLAGLQH # KETLKVRKRQLAAVLGALSLGDTLALDQALSSNSAYPFSSSSSAPDDALVPLPVGGKPSLKIRLSKRAGREWREVSRQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 Scaffold_4 AUGUSTUS gene 2312783 2313742 0.99 + . g432 Scaffold_4 AUGUSTUS transcript 2312783 2313742 0.99 + . g432.t1 Scaffold_4 AUGUSTUS start_codon 2312783 2312785 . + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_4 AUGUSTUS CDS 2312783 2313742 0.99 + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_4 AUGUSTUS stop_codon 2313740 2313742 . + 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MLPLAADRLSATKKEVATLRRRFEDELARQASNAASLAAATRAVASPLSSRSSRQKRSGKARTDKKLRNQPPEFLDPA # LDGQTYGAGGMQNNPDNIPSFNAKSSRNGKKKKRSALANASNPHHLRNYVPSRLPYTAGGCPSNANGMNQANGNDLGPFPIRFLSAEIPPRRSNRSKR # SQAQEQQQLSTSLTNPADEWLCVFCEYELFFGDEGEYRKALRRRKTVLKRRRRARERAAAAASGQSKLSTAKKSQQPAPVAATHDSEEEGDDEDNYED # DAGYEPMGTGGQTVGNGVNGMLPKQTKWRGDNREKGAGEAKSSYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 Scaffold_4 AUGUSTUS gene 2314692 2316818 0.52 + . g433 Scaffold_4 AUGUSTUS transcript 2314692 2316818 0.52 + . g433.t1 Scaffold_4 AUGUSTUS start_codon 2314692 2314694 . + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_4 AUGUSTUS CDS 2314692 2315405 0.68 + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_4 AUGUSTUS CDS 2315491 2315854 0.66 + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_4 AUGUSTUS CDS 2315953 2315978 0.73 + 2 transcript_id "g433.t1"; gene_id "g433"; Scaffold_4 AUGUSTUS CDS 2316498 2316818 0.97 + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_4 AUGUSTUS stop_codon 2316816 2316818 . + 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MAADSRYLYHPTHQGLAPQYNYQYQNPPPPTNYEPSPVQHPPPLRNPRTSQPPPHSPHAQYHPQPPLPPPSQSAAYTS # AHPSYGSQGHYITHGQPAPPQSAPAQHTPPPPPQPQQQWSNESWTNQYSHYPSHVPQHHHQQQQQLSPPLTSTVAPENTYNSAPGRLEDSPALSSNDG # SIRGYDDRTASMHSHHQPSPPQSSFNGPPTIKYRPREEESPSSYTNSQPASPNLFTGLDYDQLMKQIKFVESPLRETLSTFRSPHRNTLEQMMQAATY # AAQVLNSAAGIITPTATTTISPPPSVTYHQSHTMPPSQGYGINRLSSPTSRDRIENNTQSPHTHTFANENSPPLSASTPGSLKRVPYGAAMEGISPPL # GGSNLGLSTVPQALNQQHPVPSSSLAQPPSGQQQHSFSPSQPLSQPPSQPQPGVVGGMTSSNPPPAQQDGQTCLGCGATSTPEWRRDLWVSSKPFRFL # SLHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 Scaffold_4 AUGUSTUS gene 2325313 2326824 1 - . g434 Scaffold_4 AUGUSTUS transcript 2325313 2326824 1 - . g434.t1 Scaffold_4 AUGUSTUS stop_codon 2325313 2325315 . - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_4 AUGUSTUS CDS 2325313 2326824 1 - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_4 AUGUSTUS start_codon 2326822 2326824 . - 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MQYVTGNRGNGAQTPVILNTQPHHSPSPQPHVTAYPNPQASASVDSQLKRTPTPAQRFSPSPHVSHMQPHPVAPQNHH # PHVNLPQHGTPRVQPQPLPSAARASPRPPSTHPQQPLPPPSHPQPAHSVQVPQQPLQPHLPQQPIQQSFQPSAPGANFLQQPPPSRNGQTKVPNSAQA # QTQAYNSAYPPHANHTNQIQHSAAQMMMQQQRIGLAAAHQAQSQTQAHSPQGQQQVAGLSAPIQPMQQGAIPRASPMIPNAIATRSPIPSSLTTPNGI # HSSNPNQNQNQNSGGSASPHTSHLSPPAAAGATNSPRPRSRATGPPAVGVNSPRIANQAQPRPVQPIQTPKMQHSQLHPNLQAQQQLHANFQAQQQQR # RTTPSQATSNVVQAAQQQQQSQQHGAAQYPMYAYGVPAQAAGYPAGQLPQQYFAAMSAMRIPHQQSMHVPGVQAIPAMKGLQSVQMTQQQMRAMQQHF # VQQQQQYAMAQAQQAQQQAQQAQQQAQHKAPGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 Scaffold_4 AUGUSTUS gene 2331913 2334788 0.14 + . g435 Scaffold_4 AUGUSTUS transcript 2331913 2334788 0.14 + . g435.t1 Scaffold_4 AUGUSTUS start_codon 2331913 2331915 . + 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_4 AUGUSTUS CDS 2331913 2331917 0.24 + 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_4 AUGUSTUS CDS 2332058 2332426 0.14 + 1 transcript_id "g435.t1"; gene_id "g435"; Scaffold_4 AUGUSTUS CDS 2333981 2334788 0.88 + 1 transcript_id "g435.t1"; gene_id "g435"; Scaffold_4 AUGUSTUS stop_codon 2334786 2334788 . + 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MLLVTTKMQMPMMLQELMLVPVLLLQVSSEAHRVLSSSKLIGTTVAGTIGTNTTTAGTTSTGATGATTNSTTAGTTTS # DTGVGATTNSTAAGTTAANSTAGCTTAAGTDTNSTAVGTTTTARLRIRLSQFLTAHNCVWSTVDSGRGISTRAIAKNFATTFFTFYALSILFIIGMSL # TVQSWPGIALILWAYLIRITIGAPIPVTSEVSYSRYNLSLKTDFFYLSINQGLGKIGSLSSIAPMAFAFAVEASGDFMDFVLESESGLGLESLENSRE # DILDAFDVQMNINDAERILALGEPEPFYLDFDLDCDSDTDAFEDEDYVVIDFDDYIDVDGDEVYDGDEDYVDIREDESYVATDSGDNDLLGLGDEDNI # VADLDWDKVRTETLKFNQVNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 Scaffold_4 AUGUSTUS gene 2335782 2336945 0.54 - . g436 Scaffold_4 AUGUSTUS transcript 2335782 2336945 0.54 - . g436.t1 Scaffold_4 AUGUSTUS stop_codon 2335782 2335784 . - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_4 AUGUSTUS CDS 2335782 2336945 0.54 - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_4 AUGUSTUS start_codon 2336943 2336945 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MSAPLDELALRNLHRESQSSNASSDQLSPRTSEMQLQQQSQFQPSRKEIIAAQREASRANQRAMLSTQTNSVRGVDIL # LPGNVRLRSSRYDTDDRLRYSYVLPDGVAYDISDIVEEEWKDGTGHKRDLLEGVVGRGGVNEKLDRVLNKIKVGKGQGNLLLQKRVQSPSLRSDSVSS # RYSYDDSVTVDAHAQVRSRSATPVSAARPGTTTPTNIPSNRRNPSVASVLSDGSGYITANSHGITSPIERERSTPTPTSALISAPPLTPLTSPSTSAP # VPTLPHQQRKTPTPTTKRPPPIHTKEDFGVSHMLSVIEFRAMKPKTLNKPGGRNDSDVDSVNDMLFGRPIDLDSLHPKIRELYADSFKRMAEMDEVNY # CPFYMFCSVPCLTCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 Scaffold_4 AUGUSTUS gene 2337175 2338757 0.28 - . g437 Scaffold_4 AUGUSTUS transcript 2337175 2338757 0.28 - . g437.t1 Scaffold_4 AUGUSTUS stop_codon 2337175 2337177 . - 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_4 AUGUSTUS CDS 2337175 2338014 0.54 - 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_4 AUGUSTUS CDS 2338113 2338757 0.29 - 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_4 AUGUSTUS start_codon 2338755 2338757 . - 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MAPPVSSASYAKSVSAGGSGSKLRKERDTEGDDGKKKKSSVFGGIFGRKKDKDKKDKNGSVSSFDVSDSGRPSQTSDE # SSGRVSGTDTLASSPTTQTAMQQQQQQQVAALRNSMDPRRLNNQPPQTPPGKSTIPPEVSQQLRQRDQQQQLLYQQYLNRSPSSPPELQPSYGLQSVS # ALNSYSSSSSGLGPPTQRTRPGSLILNQGITDGHIPELSALQRFRLPAAEDSNDYYLTVKQVEGSSAILHDTEKPLVVFESLVEAAMEVPKVKRSSMG # SISSISSNLSMHPAIKKLPMNDFSDDSVVKFYLNRRGDPDGDSDVGHNGAEEDTTLIAADTSTISELEVGASPRHLTVSTQGNVSVERFSSPSFRFAM # QVIIYPEDLPDDMVFDPLTEAIVFKHTLRDRQQSSQSQSSGILMNLRRKVFVFPKNVTVAEVIEIGLERFGILEGVVDGGDEVEDKLAKRRSSSRVRY # GLSVDMGGQGVLSFPSIKVFFPHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 Scaffold_4 AUGUSTUS gene 2338900 2340015 0.29 - . g438 Scaffold_4 AUGUSTUS transcript 2338900 2340015 0.29 - . g438.t1 Scaffold_4 AUGUSTUS stop_codon 2338900 2338902 . - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_4 AUGUSTUS CDS 2338900 2339631 0.58 - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_4 AUGUSTUS CDS 2339734 2340015 0.42 - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_4 AUGUSTUS start_codon 2340013 2340015 . - 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MELDAHADAANFVGTDDEEHSVLEDDSEGEEREDYIDEVDDGSSSLSIPNESIDFDLVYSLHSFAATVEGQANVVKGD # SLFLMDDSNSYWWLVRRAYSDIDQQLNINSQLASATQAELQDGLALSQDRLRNNLNSRQGHNQSPSPNMHMQSQPTKSVKLIASLRVHKYLPAVWHSE # DEDEDVDVEWDDESYEGEDAALAAEEEQEELRLAEERKKLGTIGIPMTMEPDDGMRWDDSAVEGMRARQMAPRSVAEPPSNIRPIPSDALQHQQQLPQ # QQQVQQRQQALASSSPKFLWRRLNHRFYVHLVPARDLLSLKTVLLHPTPLIVGIPSSSRIPFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 Scaffold_4 AUGUSTUS gene 2340884 2341246 0.8 - . g439 Scaffold_4 AUGUSTUS transcript 2340884 2341246 0.8 - . g439.t1 Scaffold_4 AUGUSTUS stop_codon 2340884 2340886 . - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_4 AUGUSTUS CDS 2340884 2341246 0.8 - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_4 AUGUSTUS start_codon 2341244 2341246 . - 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MHKHKEALGRYTMAASIAVQRPPWESNQLMREELSTVLSNRSASYFESEDYISALADAETVIAIRRNWSKGHFRKARS # LVGLGKLDEAVEALQVGLAFEPNNAVRRRVLFTFPLELNVIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 Scaffold_4 AUGUSTUS gene 2343970 2344500 0.54 + . g440 Scaffold_4 AUGUSTUS transcript 2343970 2344500 0.54 + . g440.t1 Scaffold_4 AUGUSTUS start_codon 2343970 2343972 . + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_4 AUGUSTUS CDS 2343970 2344500 0.54 + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_4 AUGUSTUS stop_codon 2344498 2344500 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MAAIRLRQGNSRKFQVWLRFRVAFQALTIFAILGGLYKYGQANLEENQRIMEQINQQRGEKHLAMERAELEQRIADAT # KAHEEQQLLKKEIEKNTKVTPAPGGILSMVSWGKRPAVSEPPEQAETAQLPSLLPPLSPISSGSKSSPSSNAGGSWWNVFGWGSSNTKSDSDSPKKDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 Scaffold_4 AUGUSTUS gene 2360341 2360682 0.71 - . g441 Scaffold_4 AUGUSTUS transcript 2360341 2360682 0.71 - . g441.t1 Scaffold_4 AUGUSTUS stop_codon 2360341 2360343 . - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_4 AUGUSTUS CDS 2360341 2360682 0.71 - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_4 AUGUSTUS start_codon 2360680 2360682 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MGAQVKFYPTDITVVNDIEKAVDETVGWTKQTGAALGGVINCAGVAAGAKIIDAQNEPHSLDLWDFVLAVNLTGTFNL # TRLALKHMVHNEPEEGPDAERGVIVLVSSSAAVCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 Scaffold_4 AUGUSTUS gene 2365855 2366735 0.56 + . g442 Scaffold_4 AUGUSTUS transcript 2365855 2366735 0.56 + . g442.t1 Scaffold_4 AUGUSTUS start_codon 2365855 2365857 . + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_4 AUGUSTUS CDS 2365855 2365905 0.69 + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_4 AUGUSTUS CDS 2366062 2366222 0.59 + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_4 AUGUSTUS CDS 2366432 2366735 0.64 + 1 transcript_id "g442.t1"; gene_id "g442"; Scaffold_4 AUGUSTUS stop_codon 2366733 2366735 . + 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MKASKEDRLDEDEVISQRSMNKWTIGYILNRLSLQSALSRLVFLLSKHQDIQEKLRQEVTEARRNNNGEDFTLQDAVV # PLSKPIISVDRTEIREISVPRGTNVVISMYNANKNEELWGPGKLPLLCTYLERALSNFTPLRADANEWKPERWLSPLPEAVIQVHAPGIYSHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 Scaffold_4 AUGUSTUS gene 2374633 2374998 0.95 - . g443 Scaffold_4 AUGUSTUS transcript 2374633 2374998 0.95 - . g443.t1 Scaffold_4 AUGUSTUS stop_codon 2374633 2374635 . - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_4 AUGUSTUS CDS 2374633 2374998 0.95 - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_4 AUGUSTUS start_codon 2374996 2374998 . - 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MRKSCDIFIFINIPKALAAGITFFLSDNGVVLTEGNDKGFLEPAFFLSVQNAKREALAGWEGESVVTSLSTLTANTLD # ALDPSNSDPVLAVPLAVPATSTLVPSEVIDGIEHKLGDVEIRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 Scaffold_4 AUGUSTUS gene 2378937 2381240 0.31 + . g444 Scaffold_4 AUGUSTUS transcript 2378937 2381240 0.31 + . g444.t1 Scaffold_4 AUGUSTUS start_codon 2378937 2378939 . + 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_4 AUGUSTUS CDS 2378937 2381240 0.31 + 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_4 AUGUSTUS stop_codon 2381238 2381240 . + 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MGSSSLNAPSPLGLPVYSRSGFDLLSVLARVAARPDPKIALGPVDFSSSFVVIDVRRYDNPIIYCSRSFCRLTGYEEH # EVIGKNCRFLQSPNGVQPKGEYRRFTSNEAVSYLKKHLVADKECQTSIINYRKSGDAFINLVTVIPIKGGDISSPHEDDKVIYHVGFQVDLTEQPNAI # LEKLKDGSYIANFAANNPLTINPPSISFQGGGSLGSGAMHSLMSRDRRMQSISAPMMTSEFKAMIEDPLFMSNHPISMGANADSLPSSSVISSNIGSI # NGDNSDLVNVGSPGNHPLSLLLLEYAPDFIHVVSLKGTFLYVGPSVRRVLGYEPEELVGKALSDICHPADVQPLTRELKESSATGSTAPGSGTSPPGE # DALTSRQSHPVKPRAVNLLFRARTKSDQYVWVECRGRLHVEPGKGRKAIMLSGRAKEMSMLLWSAIASAGGISHPQTVAKSLSGEDGKTRLVTVDVST # EFWGTITRTGSLLIVSKGVKDILGWDETELMGKQVWSYLLDEEARRNVGKELANIGCAMGTMDAPGSLPRKIFCRMTRQDGSAAEVELILYPSAIDSS # ILHSSQAISPAPIIYQIRLYDRATSSTGIRSSEAAIMHPLRENVFKILEISRESSWQYELQQMRYMNERLREEIMSLEGDEIEHSHAHSTSSTLSQPS # APASHGLVHVNPSVGTMSSSMNTMLPSTGYDRHAHQGIGSASFNAPHIMYPTSGQYTAHTQYPQHVQHAQHTQPQAWPPPTSNVSSTTAISMPMPFIV # SSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 Scaffold_4 AUGUSTUS gene 2382109 2382408 0.69 - . g445 Scaffold_4 AUGUSTUS transcript 2382109 2382408 0.69 - . g445.t1 Scaffold_4 AUGUSTUS stop_codon 2382109 2382111 . - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_4 AUGUSTUS CDS 2382109 2382408 0.69 - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_4 AUGUSTUS start_codon 2382406 2382408 . - 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MNEPEHAAPARNPIASSGAINFTSISGDQNTSWVNDQSRRWNYGNIYNDDEGPRLGNNRRTNGGGPSTRRDQREEHGN # QRGSDRVEDDEYDDEYGSEDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 Scaffold_4 AUGUSTUS gene 2390586 2391236 1 - . g446 Scaffold_4 AUGUSTUS transcript 2390586 2391236 1 - . g446.t1 Scaffold_4 AUGUSTUS stop_codon 2390586 2390588 . - 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_4 AUGUSTUS CDS 2390586 2391236 1 - 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_4 AUGUSTUS start_codon 2391234 2391236 . - 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MFWDHDAKWAIQAVGASHIDFRFSIHQPTVGYRHFQEGISSLKQVTGRTHQDIQRYLIPVISGAISAKFVMALCALLD # FRYSGQAQRFSQASSLQVQTALKEFHENKSVILELKARVNPKGKPIDHWEIPKLEFMQSVEPSICASGPIMQWTADITEHAHITLVKDPARSGNNHDF # EIQICQSLDRLDRVRRFDLMTAMKDASVDFRLEDVEGDEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 Scaffold_4 AUGUSTUS gene 2398519 2399110 0.54 + . g447 Scaffold_4 AUGUSTUS transcript 2398519 2399110 0.54 + . g447.t1 Scaffold_4 AUGUSTUS start_codon 2398519 2398521 . + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_4 AUGUSTUS CDS 2398519 2398580 0.6 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_4 AUGUSTUS CDS 2398672 2399110 0.9 + 1 transcript_id "g447.t1"; gene_id "g447"; Scaffold_4 AUGUSTUS stop_codon 2399108 2399110 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MSDRRKEDPFKIDEVMNAAENRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVAL # NKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRMELSGHVSCASRQIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 Scaffold_4 AUGUSTUS gene 2399155 2399475 0.47 + . g448 Scaffold_4 AUGUSTUS transcript 2399155 2399475 0.47 + . g448.t1 Scaffold_4 AUGUSTUS start_codon 2399155 2399157 . + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_4 AUGUSTUS CDS 2399155 2399475 0.47 + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_4 AUGUSTUS stop_codon 2399473 2399475 . + 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 Scaffold_4 AUGUSTUS gene 2399505 2400401 0.67 + . g449 Scaffold_4 AUGUSTUS transcript 2399505 2400401 0.67 + . g449.t1 Scaffold_4 AUGUSTUS start_codon 2399505 2399507 . + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_4 AUGUSTUS CDS 2399505 2400401 0.67 + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_4 AUGUSTUS stop_codon 2400399 2400401 . + 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQAWHMKTIVIIQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 Scaffold_4 AUGUSTUS gene 2400563 2401670 0.45 + . g450 Scaffold_4 AUGUSTUS transcript 2400563 2401670 0.45 + . g450.t1 Scaffold_4 AUGUSTUS start_codon 2400563 2400565 . + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_4 AUGUSTUS CDS 2400563 2400935 0.96 + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_4 AUGUSTUS CDS 2401010 2401250 0.48 + 2 transcript_id "g450.t1"; gene_id "g450"; Scaffold_4 AUGUSTUS CDS 2401343 2401670 1 + 1 transcript_id "g450.t1"; gene_id "g450"; Scaffold_4 AUGUSTUS stop_codon 2401668 2401670 . + 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVR # YESRQRKKGKAQDSKDKKENVQADVVTEPPKTNLKNVLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 Scaffold_4 AUGUSTUS gene 2402490 2403701 0.66 + . g451 Scaffold_4 AUGUSTUS transcript 2402490 2403701 0.66 + . g451.t1 Scaffold_4 AUGUSTUS start_codon 2402490 2402492 . + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_4 AUGUSTUS CDS 2402490 2403701 0.66 + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_4 AUGUSTUS stop_codon 2403699 2403701 . + 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY # AGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELK # DGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKG # MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYL # YETAQEADDIELDVQEALDEERSYEIRRTTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 Scaffold_4 AUGUSTUS gene 2404163 2405275 0.53 + . g452 Scaffold_4 AUGUSTUS transcript 2404163 2405275 0.53 + . g452.t1 Scaffold_4 AUGUSTUS start_codon 2404163 2404165 . + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_4 AUGUSTUS CDS 2404163 2405275 0.53 + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_4 AUGUSTUS stop_codon 2405273 2405275 . + 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR # RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 Scaffold_4 AUGUSTUS gene 2408055 2408399 0.48 - . g453 Scaffold_4 AUGUSTUS transcript 2408055 2408399 0.48 - . g453.t1 Scaffold_4 AUGUSTUS stop_codon 2408055 2408057 . - 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_4 AUGUSTUS CDS 2408055 2408399 0.48 - 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_4 AUGUSTUS start_codon 2408397 2408399 . - 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 Scaffold_4 AUGUSTUS gene 2411270 2411614 0.57 - . g454 Scaffold_4 AUGUSTUS transcript 2411270 2411614 0.57 - . g454.t1 Scaffold_4 AUGUSTUS stop_codon 2411270 2411272 . - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_4 AUGUSTUS CDS 2411270 2411614 0.57 - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_4 AUGUSTUS start_codon 2411612 2411614 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 Scaffold_4 AUGUSTUS gene 2412526 2413228 0.37 - . g455 Scaffold_4 AUGUSTUS transcript 2412526 2413228 0.37 - . g455.t1 Scaffold_4 AUGUSTUS stop_codon 2412526 2412528 . - 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_4 AUGUSTUS CDS 2412526 2412962 0.83 - 2 transcript_id "g455.t1"; gene_id "g455"; Scaffold_4 AUGUSTUS CDS 2413021 2413228 0.44 - 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_4 AUGUSTUS start_codon 2413226 2413228 . - 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS # KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE # DEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 Scaffold_4 AUGUSTUS gene 2435991 2436569 0.56 - . g456 Scaffold_4 AUGUSTUS transcript 2435991 2436569 0.56 - . g456.t1 Scaffold_4 AUGUSTUS stop_codon 2435991 2435993 . - 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_4 AUGUSTUS CDS 2435991 2436569 0.56 - 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_4 AUGUSTUS start_codon 2436567 2436569 . - 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MAMITPQTPAHLKTATPPPDITIPIKNTPSKLLRFLEYAETNVGVEHATQHLLRLQEEGYGPDILDQVDDKDLKILGI # KHGDVLRLKRAAPLWLNGPDAKCKVPSAASRASASASLSSSGSSVNLFPNRRRFEKRWNDGSGASSAFGQSMRLLEDDEMPDPTITWWYFSELTKSML # RVPEGYVPVLEGQSVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 Scaffold_4 AUGUSTUS gene 2442102 2443461 0.61 - . g457 Scaffold_4 AUGUSTUS transcript 2442102 2443461 0.61 - . g457.t1 Scaffold_4 AUGUSTUS stop_codon 2442102 2442104 . - 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_4 AUGUSTUS CDS 2442102 2442937 0.72 - 2 transcript_id "g457.t1"; gene_id "g457"; Scaffold_4 AUGUSTUS CDS 2442987 2443461 0.62 - 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_4 AUGUSTUS start_codon 2443459 2443461 . - 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MKKTISESISSGSAQPGPMPHIPSPPPLSVEMEENENWLRSIVSEKDIHLETLYDSETHLEFINHPSPNLSFVSPDPE # TLLHVNSGDFSLKTTSTRNMRFLETEARLCGLLKQIQALPPAVRSIGELDVENELYTALDKIHRFKGRQWKLQAYPNGIGVFEPPLARHFTAHKPNPD # IAPIFIAALIIYIKFQTPVRQMRVILALLRCIIRALKRNLVDSHLSSQIPMDVHTIVNCYDIDPTLHAFVACPTCYALYPLTDEALKNAESVFQADQP # LPVCDERSHPDSAPCGTTLWRTRRIDHRTFVTPIQKQIFQDLKEWIGRIVATPGIEDAMDQHQQSSPPADGDPERDFVDSTTFRQFKGADGEPYAIPQ # VGPSGSPDLRLVTSLGFDAFNPFHSKTAHAIVQSTALYMVILSLPDTSDITREHVSAHCHDWKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 Scaffold_4 AUGUSTUS gene 2446327 2446720 0.72 - . g458 Scaffold_4 AUGUSTUS transcript 2446327 2446720 0.72 - . g458.t1 Scaffold_4 AUGUSTUS stop_codon 2446327 2446329 . - 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_4 AUGUSTUS CDS 2446327 2446475 0.76 - 2 transcript_id "g458.t1"; gene_id "g458"; Scaffold_4 AUGUSTUS CDS 2446564 2446720 0.77 - 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_4 AUGUSTUS start_codon 2446718 2446720 . - 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MNDVYDGPTGHALHEGEQALCVWEAGQACAFWDDQLTGEEMDLICGSYEVATDGDKVLVALFRFLEILWSQLWILVER # CRRLVPKPFGPNPKIYGAIDPDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 Scaffold_4 AUGUSTUS gene 2447594 2448760 0.92 + . g459 Scaffold_4 AUGUSTUS transcript 2447594 2448760 0.92 + . g459.t1 Scaffold_4 AUGUSTUS start_codon 2447594 2447596 . + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_4 AUGUSTUS CDS 2447594 2448760 0.92 + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_4 AUGUSTUS stop_codon 2448758 2448760 . + 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 Scaffold_4 AUGUSTUS gene 2452987 2453727 0.49 - . g460 Scaffold_4 AUGUSTUS transcript 2452987 2453727 0.49 - . g460.t1 Scaffold_4 AUGUSTUS stop_codon 2452987 2452989 . - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_4 AUGUSTUS CDS 2452987 2453727 0.49 - 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_4 AUGUSTUS start_codon 2453725 2453727 . - 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MIRTISLPCVLILNEETHHNDGTVSSQAYLTRLQSPNNLPHSLIEFNEAIEDVAYHRFGFLKQPFAENRDIVLKSQVW # KKVLGLFGCGRHHAALEVDIHIKLQLCRFISALSDAADLRHAPEVYDLSFRSLMQPLIPFEVNTLTSYNGRYYLIQAKDAKDNEEYVIAFRSAATVME # LARREWGPRTEDIIKCLIEEGISFNTLMASHTPRRSLYMPFHRPAMLGFRPVGFVPTLQDYRCHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 Scaffold_4 AUGUSTUS gene 2457436 2457810 0.5 - . g461 Scaffold_4 AUGUSTUS transcript 2457436 2457810 0.5 - . g461.t1 Scaffold_4 AUGUSTUS stop_codon 2457436 2457438 . - 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_4 AUGUSTUS CDS 2457436 2457810 0.5 - 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_4 AUGUSTUS start_codon 2457808 2457810 . - 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MREFNVRLSSERIKVEHAFGKLKGRFLSLKEMGWHKNLQEMYKVIEALLILHNMCIDYGDIPEHILDFDPSDNTIPVE # VAAGDIHFGLVDVTQEANIPQYETDQWIKEEGRRKRDLIFNDLFPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 Scaffold_4 AUGUSTUS gene 2458539 2458889 0.45 - . g462 Scaffold_4 AUGUSTUS transcript 2458539 2458889 0.45 - . g462.t1 Scaffold_4 AUGUSTUS stop_codon 2458539 2458541 . - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_4 AUGUSTUS CDS 2458539 2458889 0.45 - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_4 AUGUSTUS start_codon 2458887 2458889 . - 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MSKTQAQAVLLSMACAILAASDTLDNIEDADLPLNDPCEDSEVLEVVAAVMIHEALEIKGDGTRGPYNQFPKSKDWFP # TSLQQPDRWFRSNYRCIDAYNYIMFCSMILNQDESGYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 Scaffold_4 AUGUSTUS gene 2467022 2467516 0.63 + . g463 Scaffold_4 AUGUSTUS transcript 2467022 2467516 0.63 + . g463.t1 Scaffold_4 AUGUSTUS start_codon 2467022 2467024 . + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_4 AUGUSTUS CDS 2467022 2467516 0.63 + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_4 AUGUSTUS stop_codon 2467514 2467516 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MCMIINCIHLVTSSAQSSNEDDGGTVSSFAKFNRRDTSETRPQDRQGSIPPCAEHRDTRRIGEMLDMLSAKSKHKGSP # GHQDEGDSQRHGSGSNQGPQPSNDRDSAAKPSDGGAAGSATNRNNGNGDGEDGDDKGDSNDNPFFRYARKKQPAHSGGVKHDLLKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 Scaffold_4 AUGUSTUS gene 2484037 2484513 0.97 + . g464 Scaffold_4 AUGUSTUS transcript 2484037 2484513 0.97 + . g464.t1 Scaffold_4 AUGUSTUS start_codon 2484037 2484039 . + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_4 AUGUSTUS CDS 2484037 2484513 0.97 + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_4 AUGUSTUS stop_codon 2484511 2484513 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MHFRSFSFRHKFGDKKKISSSSSESEPELEPISPPDPFLPHKPLPPTSIANIVLDPGNLTALYQTASTPNTPNTPNTS # DTVSSSDASNPITDTTSLGSGLGSDSFPSSPHNQPKKSISDLVFNTTTLSALYDTREAERNVAAVESERSFGKDGAPERR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 Scaffold_4 AUGUSTUS gene 2489803 2490252 0.9 + . g465 Scaffold_4 AUGUSTUS transcript 2489803 2490252 0.9 + . g465.t1 Scaffold_4 AUGUSTUS start_codon 2489803 2489805 . + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_4 AUGUSTUS CDS 2489803 2490252 0.9 + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_4 AUGUSTUS stop_codon 2490250 2490252 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MAQKPPKSAGSVSSSPPPPPPAQNSDKESEQIEQPVLTRSSVPSLDFSPPDPTEQRTGASSRDNLSSADRQRRAFARI # AFGLFTLGFGLHVAYMGREWEQEELQEKKLVCSLMLHVLNPLLNHFTDSGKCASRSMGTNKKPILGDVFCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 Scaffold_4 AUGUSTUS gene 2501901 2503118 0.32 + . g466 Scaffold_4 AUGUSTUS transcript 2501901 2503118 0.32 + . g466.t1 Scaffold_4 AUGUSTUS start_codon 2501901 2501903 . + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_4 AUGUSTUS CDS 2501901 2503118 0.32 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_4 AUGUSTUS stop_codon 2503116 2503118 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MIGVGGNNGTTLCATILANRHNIVWHTKQGIQQPNYIGSLLRASTVRIGTEASTGKDVHVPVSDVLPMVHPNDLVLGG # WDISGVPLEKAMQRAQVLDYDLQRQVAPHMALLGKPLPSIYYPDFIAANQETRADNLIPGQDKQAHLEHIRADIRKFKKDNGLDRAVVFWTANTERYS # DIIPGVNDTAENLLSSIKSSHPEVSPSTLFAVAAILEGEPFINGAPQNTFVPGVIALAELHKSFIGGDDLKSGQTKLKSVLAEFLVNAGIKPLSISSY # NHLGNNDGRNLSAEKQFRSKEISKSSVVDDMVDANRVLYKAPEVGEKGIPVGKGEHPDHIVVINMFPAVGDSKRAIDEYYSEIFCGGRNTISIFNECE # VYFTSCSTFTELTPVDIGLPPRYPTHSRPYHSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 Scaffold_4 AUGUSTUS gene 2503980 2504223 0.55 - . g467 Scaffold_4 AUGUSTUS transcript 2503980 2504223 0.55 - . g467.t1 Scaffold_4 AUGUSTUS stop_codon 2503980 2503982 . - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_4 AUGUSTUS CDS 2503980 2504153 0.59 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_4 AUGUSTUS CDS 2504221 2504223 0.66 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_4 AUGUSTUS start_codon 2504221 2504223 . - 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MPMSTLQSKGNVDGAPLFDPSTKDLKWEDESDDSTDDNTTWTSNSDDEYETASEGWDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 Scaffold_4 AUGUSTUS gene 2524463 2525857 0.99 + . g468 Scaffold_4 AUGUSTUS transcript 2524463 2525857 0.99 + . g468.t1 Scaffold_4 AUGUSTUS start_codon 2524463 2524465 . + 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_4 AUGUSTUS CDS 2524463 2525857 0.99 + 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_4 AUGUSTUS stop_codon 2525855 2525857 . + 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MSTSQVNVPIFPEESKLTGKDSWSRFKAAVELTAQLRGYTGYLDGTIVKPASSLYSTAAGSVYPAVTATPAYSTQPYP # EEWYMRDRFVAATINLNTVDATGLGIDLTKSAANIWKDLTEKFERKDEQLIYLADHALRAEKFDPDAGTMEDHEKKMKNLKKKLTDVGGTLTAQFRII # ILASVPTDWKPETRNVPGKGSDEAFIHLHTVYLERKSESNEIEQSNKVRALIAKEVLAAMQTQPTVAASTSTRTEHPICSNPPCPSKIGHTLKKCWAK # GGGCEGKAPAWWYKKYNQEPPTSVNAASPIDTFTLSARTSRSTSTEPRPDSRRNRNSRSVLDQTTSQGGRENLSRDVLVPSPKSTSLDKCSIYNSNIS # SPLPRSVKTYIDSGASEHCWVNKADFTNYKAVLNQGGHTAVAGSGFRIEGVGTVEFLTQVKGNKRIVRLTGVKHTPSFGHNLISLMTLDRLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 Scaffold_4 AUGUSTUS gene 2526530 2528242 0.88 + . g469 Scaffold_4 AUGUSTUS transcript 2526530 2528242 0.88 + . g469.t1 Scaffold_4 AUGUSTUS start_codon 2526530 2526532 . + 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_4 AUGUSTUS CDS 2526530 2528242 0.88 + 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_4 AUGUSTUS stop_codon 2528240 2528242 . + 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MGWLNDANWTVISGVRTLLDESGLGHSFWAEAAATYCYVDSFVPSSRFPDDVPIQIFTGKRHDVSHLRPFGCDAWATL # PDTRKDGKLSRQSVKGQLIGYMGRRGYRLWIPEWRVVLENRDVRFEEGQARRTSPPMRESGKFGDLPGDTDVGYNSDVDPDFPGLDVEESTDDEIEML # GPPNAPAPAVPPFPVLDAPPNPLPANAEIQPLPPLAEPELQVLPPPGVPDVPPLPIPAQPAPLRRSARHKTPSTRYLESVEFETREREARDEGRDWAT # DSAFMRICADPWSFAASTEEDSIPTGYKQAMKHPELWREPMELEYRMLMERNVWKLVELPPGANLMGGKWVFAIKRGASGEILKRKARYVAQGFTQVF # GLDYDKTYGGVARMESVRIVLAIIACLGLSLFQVDFKSAFLNSPITHDVYMKQPEGFIQPGSENLVCKLQRSIYGTMQGSHDWQATLASGFKDDGYTS # SKADPCIRSRRRGGEYTITSTYGDDVCGGASSESERREAIKDLGKRWESDEVGSGMLLGMSISQDPSTRAITISQQGFFERMLEHFGLQNITPRRTPL # LS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 Scaffold_4 AUGUSTUS gene 2534771 2535127 0.56 + . g470 Scaffold_4 AUGUSTUS transcript 2534771 2535127 0.56 + . g470.t1 Scaffold_4 AUGUSTUS start_codon 2534771 2534773 . + 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_4 AUGUSTUS CDS 2534771 2534846 0.57 + 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_4 AUGUSTUS CDS 2534892 2535127 0.59 + 2 transcript_id "g470.t1"; gene_id "g470"; Scaffold_4 AUGUSTUS stop_codon 2535125 2535127 . + 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MVDPRVNHLSEEEEIIMQTAGTLYEVCLSILPEIPAGADTGKTALRTFILAMTCFPKAQRDAQEEIDCVIGQERLPDY # EDIVDDSDASVSLPYFRAVVLECFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 Scaffold_4 AUGUSTUS gene 2536030 2536506 0.51 - . g471 Scaffold_4 AUGUSTUS transcript 2536030 2536506 0.51 - . g471.t1 Scaffold_4 AUGUSTUS stop_codon 2536030 2536032 . - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_4 AUGUSTUS CDS 2536030 2536506 0.51 - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_4 AUGUSTUS start_codon 2536504 2536506 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MVVISLCFMITVLLDTFNGKAYVLDRAEYLKKKQRNNPEAEEYKTKLMDSTDIQETEHYDVQAAQQTKARHDKEQNER # QRRRMAQRTSLHQDHMHTTLDFSYVIWNCMELHRIASIGVAVVTEQILCSVDPIQLYTVLIPTSPTTSPVQVQHVSPSEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 Scaffold_4 AUGUSTUS gene 2541664 2542080 0.35 - . g472 Scaffold_4 AUGUSTUS transcript 2541664 2542080 0.35 - . g472.t1 Scaffold_4 AUGUSTUS stop_codon 2541664 2541666 . - 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_4 AUGUSTUS CDS 2541664 2542080 0.35 - 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_4 AUGUSTUS start_codon 2542078 2542080 . - 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MDPADIQGMEHYDVQAAQETAQQTKARHDQERNERQRRRVAQRTILHQDALNLQHFVDETQAKLDGIYGNNDINNYSR # LRSACDKDWQDVWHLGIVDFMEPEVKEKSMLALNHRAEWSGVMRLGSQTSDSYLNQFKNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 Scaffold_4 AUGUSTUS gene 2553569 2553967 0.81 + . g473 Scaffold_4 AUGUSTUS transcript 2553569 2553967 0.81 + . g473.t1 Scaffold_4 AUGUSTUS start_codon 2553569 2553571 . + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_4 AUGUSTUS CDS 2553569 2553967 0.81 + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_4 AUGUSTUS stop_codon 2553965 2553967 . + 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MRVSMNTLSLPPSTISSIINNPSLLLQPSDLSKFGLTSSQADHILVQGYNKGFKDVFILNTALTVLAFVASVVMIGHK # ELLRGDEEALKQEAKAALMLEKAPGIGQGRIPEMDEDHGLRGDVEMGSVSSPER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 Scaffold_4 AUGUSTUS gene 2556434 2556814 1 + . g474 Scaffold_4 AUGUSTUS transcript 2556434 2556814 1 + . g474.t1 Scaffold_4 AUGUSTUS start_codon 2556434 2556436 . + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_4 AUGUSTUS CDS 2556434 2556814 1 + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_4 AUGUSTUS stop_codon 2556812 2556814 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MKISTSSITNGSLVSGGKPTIHWSFDNVAKAKNDDPQHELENLINALLQDFGLPERIPDSAEFVGSRDFIKIKIPSTI # DVSRLTCPCLGTLVFDEKHHRGSLRIVEDRPHWEHPATDKILVPFVVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 Scaffold_4 AUGUSTUS gene 2568531 2568833 1 + . g475 Scaffold_4 AUGUSTUS transcript 2568531 2568833 1 + . g475.t1 Scaffold_4 AUGUSTUS start_codon 2568531 2568533 . + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_4 AUGUSTUS CDS 2568531 2568833 1 + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_4 AUGUSTUS stop_codon 2568831 2568833 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MGEACGAREAVPCPVVFDPEDLRQTKELSEKLQAVDEAFEECQAMIGLGPETWVTNEQYEMAVALGELVKQKVLARIP # EEDRARTEAHWFLDDMDEKDYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 Scaffold_4 AUGUSTUS gene 2582248 2583182 0.12 + . g476 Scaffold_4 AUGUSTUS transcript 2582248 2583182 0.12 + . g476.t1 Scaffold_4 AUGUSTUS start_codon 2582248 2582250 . + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_4 AUGUSTUS CDS 2582248 2582550 0.12 + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_4 AUGUSTUS CDS 2582613 2583182 0.57 + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_4 AUGUSTUS stop_codon 2583180 2583182 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MADVFSPDLQGPGTVLGDGEVGLHEAAVHTEEILGEGMAKMLQTFNHQEENILLQIAFQASMCAFTEWIMDSWCYHDR # DSEVEAVLQETYEQLRETGKLWDPVSARWRILTRKYVRKLYPRVEQPNLAYHILAACANILIISGLHESEQGLLDRLAARFADRVALIVERAVHLNNV # IGDDITSCEFVPIYCTPDVAFDPSTMENATENGSATAGHEAIFVHNRDNENKILCTTDLGLLKAEKVHGEEGTWNNTVLLKPKIVMPSGLTASPTESE # SPDWRTQSLHGEREES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 Scaffold_4 AUGUSTUS gene 2586040 2586957 0.98 + . g477 Scaffold_4 AUGUSTUS transcript 2586040 2586957 0.98 + . g477.t1 Scaffold_4 AUGUSTUS start_codon 2586040 2586042 . + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_4 AUGUSTUS CDS 2586040 2586957 0.98 + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_4 AUGUSTUS stop_codon 2586955 2586957 . + 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MVYSRSMLTVVIAVGAASSALAAPMSSLPVAREVTPGVPFPTRSNPANLLVHPAAREFDVVIDHGRAHEVSILPVLPL # PPRCADFFVLQYVKVDEELKFNSDRPVGLERRQDSEKGLDPSPATAPDTFKPPTPTTQSHGGTKAKLTSMMKKVTQHPKFISMMQNPKVLQLMQHPKI # APYANRLGLNGGEPAKNAAAVPAPPAENPVSPIASVAPQIPPLNFDRREVADPTPSDSNSFSPSPYAKSVRLARSFLAPRKDGDSQSGTSGPPSGNTG # IPPTSHQTSSAHGAQSVPHVPEGMSSGSWEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 Scaffold_4 AUGUSTUS gene 2593261 2594562 0.31 - . g478 Scaffold_4 AUGUSTUS transcript 2593261 2594562 0.31 - . g478.t1 Scaffold_4 AUGUSTUS stop_codon 2593261 2593263 . - 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_4 AUGUSTUS CDS 2593261 2594562 0.31 - 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_4 AUGUSTUS start_codon 2594560 2594562 . - 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MSTEALEAFETLKYMITRTPVLIKIDYKQAKLITPKPRECDEGLIVVGVDSAWSGAGWRMGQIRESMKRIALYGSCTF # NEREQNYGQPKSELFGIFRAFKELRHRIWGVHFRLDHDAQSIAQMLRSVDDVPNAPILRWVSWIRLFDFEPNHVPADQFKAEDGLSRRKPSPSDQPYD # DLTPDEFLDAYNDVVYGSQLSQSAKFLFEQLYVDYSSPFTKSWNGRYTTVPLLSTSIQSKTLPDFDIHIGSAPVHPSDMYSLFSTTASRNIEINSCRR # LPEFHYRTTLVKCSSEFLLGDELVTFEFVVSVGSTQSLPLSNEALGMVGHKNGTRDQDDKGYWEELREFFSKGRYPARLNTDRDMIRFRKRARRFFLQ # DGRIWLAPKASSDRLPRLVVEDSVKRNDLWRLPTMNVATEDGTLLIDTCWIDFIGRICMMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 Scaffold_4 AUGUSTUS gene 2595374 2595967 0.86 - . g479 Scaffold_4 AUGUSTUS transcript 2595374 2595967 0.86 - . g479.t1 Scaffold_4 AUGUSTUS stop_codon 2595374 2595376 . - 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_4 AUGUSTUS CDS 2595374 2595967 0.86 - 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_4 AUGUSTUS start_codon 2595965 2595967 . - 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MGNAEYSDFDSLLDIFPPPSFDSMIHSYLSVKGIHPTQVSSSPWTDRVLNSEFYLYSYPGKAKSMPKRKYKPVDRKVR # PVPTYMPDPQAQQFREIPAPIPTNLPLHPPDYRTSLFGKRITRERMDEMLKSIEQDTLSNEEINLLAFVVLKRELAFAYSYAEKGYFSREYFPDYEIP # TIEHIPGSPDRFRSQELSMMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 Scaffold_4 AUGUSTUS gene 2596036 2601521 0.31 - . g480 Scaffold_4 AUGUSTUS transcript 2596036 2601521 0.31 - . g480.t1 Scaffold_4 AUGUSTUS stop_codon 2596036 2596038 . - 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_4 AUGUSTUS CDS 2596036 2597226 0.48 - 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_4 AUGUSTUS CDS 2597357 2597397 0.36 - 2 transcript_id "g480.t1"; gene_id "g480"; Scaffold_4 AUGUSTUS CDS 2598083 2601521 0.68 - 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_4 AUGUSTUS start_codon 2601519 2601521 . - 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MIDTPVTDNIQKQLTILQLNTNKSDNSMHDFLRGTNADIFAIQEPYIDSKGRTRSLPHLRVVYPTGHVEHFGDSDRPK # ARSLIMMHTRIQTKRWTQLTIDSPDITAIQVITDIGTIRIFNIYNDCEHDDTLQVLEEWMRTSAANTAMDGPIHYVWLGDFNRHHPLWDEMRNHHLFT # ARNLDAAQTLISLTARFGLNMALPGSIPTLQAHNSGNYTRVDNVFCTDTLFECAVTCNTVPSLRPMLTDHLPIRTTFDIRIPIVDQRERWCWAKVNWD # DFQKRLKELLETLEPPSELTTETDFWRALREFDEAITKVIMELVPKAKPSPYQRRWWNKTLTAMKRRTSTLSGKSHRHRFERDHPIHEDFRRARQAYS # AELKQAKINKWVEYLEEATTSSVWEVGRLMENGYTDGGRTRIPGLVVSETGTQDRVVEDNVGKEFVFRGSFFPPPPHTPNVPESPIYPPPAWNFTPPT # NRQILAAIRRMKNGKATKPGTIPNDLFKATAQLIVPFLGPIYRATFTLKIYPDAWSATETIVLKKPGRPDYRDPNAWRPITLSNGHGRLMNACIAEEI # TKRAELLGLLPAMQFGARPGRNTTDSIHLMIDRIKELWREGYLVTVLYMDVKGAFPSVDLDMLNHELQMVGVPEEILGWIRRRYAQRKTQLSFDDYIS # LPFSVPGGEDQGDPFAAVGYILYAAGLLRLFQAESREQGFGFMDDVAGMKWAKGVDELHAEIGDMMSREGGVLDWAAAHNCHFGVTKFKLVDFNRRRI # PHPTEPKKTAPVTGPGVKIHDTLIKSETYAKFLGGLMDRQLRWNEHHSMMVKRGQLWVSQFRRVARMKDGMVAQLVRQLYKAKALPRMLYAADIILAP # PSRKKEKKWTQATPTRGIIRKLTSIQRQASLMISGAMTTTATDILDIHAALLPLPLEVERHRHRAAVRLLTLPTEHPLSERVENAAQNKRRTKHPSPL # IDLMGRYGLHPAKMEKRRAVRFEAQWDPKLVIQIWESKEAALRALQDDDTSIKVFTDGSGYKGYIGSSAVLYRDGQEESAIRYRLGSEEHHEVYEGEC # IGMILGLHLSRAQESVTAVSIWADNTAAITATDTSKTGPSHYILDIFHHTLTALRAQHPDATVTISWIPGHIGAEGNERADEEAKKAATHGLYEYLCP # RRKPDSKKKKKKNPLDKDHRKKPTSVQKIPIEPHKQVRFDPSSTSVPPHIQTVPQNEPSQIPAKVSIPPPSNPINREQGWKNSRPGIPRGGQEVVMQD # GDKKNSGPQYHFTSKVQDLANPESTFSHIGDMKVEIPLFQLLGISPQLSKLFSESTRTRREYGPIKETKQAESTPYHNHFEASGEEQAALTSAMATWG # SESGESNLYVAEDDPNISDFVFKCSNAVAQIPAKCFFAMTVGNLRVIINDVEFLAMIDTGSELNVGGAHLPEAASLPMDYDGTRWSLKGINGDFERLR # GCAVNAPIRIGGHDFTHHIFISRTSIGRHDIILGQPFLQWFSARVDYERGAHAKLFLWADGDRTGKPTLMVSITDPNDGRNASAIRLGTEVKPKNAFI # EEVNEADF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 Scaffold_4 AUGUSTUS gene 2602439 2603368 1 - . g481 Scaffold_4 AUGUSTUS transcript 2602439 2603368 1 - . g481.t1 Scaffold_4 AUGUSTUS stop_codon 2602439 2602441 . - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_4 AUGUSTUS CDS 2602439 2603368 1 - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_4 AUGUSTUS start_codon 2603366 2603368 . - 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MSRNASNSSKEPPPGQQKLGFHPTQPVRNQTTPASPAVSTNGDDDQRTLIAKAITMKLMASDEDCTVVLPVKLVKLAA # AAKDGKTKITQGDMWEKVALIGKILQECSFRDRMKHFRDELIEKMEERFDDETCRLEGRFKILRKEAEDTSKAAEKLKEKMEELVKDLETRGNAVREE # LVESEDGEVTQTNNNRISYATAAQAKSVAQHIQQPRHSPAIRDAEMRDRRIIIKSDVESDWKLTEKEIVTKANLAMDKMMDDEGVGTKMKVMAATKIR # GNGAFLLMGSVAEAESMKVGDRLVRFCEAWDRVPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 Scaffold_4 AUGUSTUS gene 2603495 2604886 0.55 - . g482 Scaffold_4 AUGUSTUS transcript 2603495 2604886 0.55 - . g482.t1 Scaffold_4 AUGUSTUS stop_codon 2603495 2603497 . - 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_4 AUGUSTUS CDS 2603495 2604886 0.55 - 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_4 AUGUSTUS start_codon 2604884 2604886 . - 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MPIAHTQNAPFFNGRYIEDFLGRVKQHGANAGIVNEDELVKYIVEYSSDKVKDLILYMDEFDADGKVTWKAAKEALIT # LYGSSDKPKEYTEEELKEFCRERSAKPSFSKASDIEDYLRAFVAIAASLKKRTVISEKEYNLYFVRGLPRVLKEWFASATPETKRTKDNPPSVAESLY # ILRTRFDKNSIIYEDWHKDDEEKAKFLFDDNGNRITTSIQQEIDAEVLLTNAPGSMPPSSLMSKRSSSQTVDELTKQLERLTIAVKAVKDKEAYSKAQ # VTTSQPASTVEELAQQVEQLKELMKDSSMRGSRMNQGSDSNSRRCFICGKMCGGNNSAHPIGPRFCPETNELLSEHLITFDAQRNRYVLINGHDLPLV # PRGWIGGVASYLRHQRSTSSIPSSSSVPHDTPPHLQSGNSVGLMYNDSEVLTGQAFALESVPYHFTSNPSLRSGRDTTNRYNPLDRKGLLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 Scaffold_4 AUGUSTUS gene 2612753 2613316 0.91 - . g483 Scaffold_4 AUGUSTUS transcript 2612753 2613316 0.91 - . g483.t1 Scaffold_4 AUGUSTUS stop_codon 2612753 2612755 . - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_4 AUGUSTUS CDS 2612753 2613144 0.91 - 2 transcript_id "g483.t1"; gene_id "g483"; Scaffold_4 AUGUSTUS CDS 2613211 2613316 0.91 - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_4 AUGUSTUS start_codon 2613314 2613316 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MNFTSASLPFAHKRFSNNRRVGFEERRGRWSRFKDKVVELIQTAIRAPTGSPSDGLGADGTESSTSTSVFIAAQKLLS # AEKDGEDWEINETVINGENPELFRNERDSGSPFRSDSGGGSISRHSGENGDSNYAYHPPSLRTKLHWLSMQINSFFNQKFDDPQDGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 Scaffold_4 AUGUSTUS gene 2627732 2628297 0.32 + . g484 Scaffold_4 AUGUSTUS transcript 2627732 2628297 0.32 + . g484.t1 Scaffold_4 AUGUSTUS start_codon 2627732 2627734 . + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_4 AUGUSTUS CDS 2627732 2627767 0.43 + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_4 AUGUSTUS CDS 2627893 2628297 0.32 + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_4 AUGUSTUS stop_codon 2628295 2628297 . + 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MRLWYVSIPFEVSEMATAGSRRMHNAPAQHHVEQHQHDDGNVIMQVIGHQHGHIYESVDDDEDKDSAHSEQMWKTVKQ # TMIPRLLPLRTPKKSGLNEKSRLQSKTKSVNKNFKIINDSDSLPFPRSLMMVGSTISTEAGEEQKYGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 Scaffold_4 AUGUSTUS gene 2636667 2637587 0.65 + . g485 Scaffold_4 AUGUSTUS transcript 2636667 2637587 0.65 + . g485.t1 Scaffold_4 AUGUSTUS start_codon 2636667 2636669 . + 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_4 AUGUSTUS CDS 2636667 2637587 0.65 + 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_4 AUGUSTUS stop_codon 2637585 2637587 . + 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 Scaffold_4 AUGUSTUS gene 2637644 2638192 0.57 + . g486 Scaffold_4 AUGUSTUS transcript 2637644 2638192 0.57 + . g486.t1 Scaffold_4 AUGUSTUS start_codon 2637644 2637646 . + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_4 AUGUSTUS CDS 2637644 2638192 0.57 + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_4 AUGUSTUS stop_codon 2638190 2638192 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 Scaffold_4 AUGUSTUS gene 2638222 2639118 0.79 + . g487 Scaffold_4 AUGUSTUS transcript 2638222 2639118 0.79 + . g487.t1 Scaffold_4 AUGUSTUS start_codon 2638222 2638224 . + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_4 AUGUSTUS CDS 2638222 2639118 0.79 + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_4 AUGUSTUS stop_codon 2639116 2639118 . + 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQAWHMKTIVIIQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 Scaffold_4 AUGUSTUS gene 2639280 2640742 0.86 + . g488 Scaffold_4 AUGUSTUS transcript 2639280 2640742 0.86 + . g488.t1 Scaffold_4 AUGUSTUS start_codon 2639280 2639282 . + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_4 AUGUSTUS CDS 2639280 2639652 0.86 + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_4 AUGUSTUS CDS 2639727 2640742 0.94 + 2 transcript_id "g488.t1"; gene_id "g488"; Scaffold_4 AUGUSTUS stop_codon 2640740 2640742 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILKILVWGRIAINLNPQKPHRINVITKIPLKRSEMIIGINLKTL # KELGRDMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEK # PINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFFGNEKEIYARNDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 Scaffold_4 AUGUSTUS gene 2641161 2643849 0.14 + . g489 Scaffold_4 AUGUSTUS transcript 2641161 2643849 0.14 + . g489.t1 Scaffold_4 AUGUSTUS start_codon 2641161 2641163 . + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_4 AUGUSTUS CDS 2641161 2642052 0.25 + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_4 AUGUSTUS CDS 2642124 2642415 0.69 + 2 transcript_id "g489.t1"; gene_id "g489"; Scaffold_4 AUGUSTUS CDS 2642454 2643849 0.64 + 1 transcript_id "g489.t1"; gene_id "g489"; Scaffold_4 AUGUSTUS stop_codon 2643847 2643849 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDACKGPSTRYELPEGGYETIPENPGIRRFV # WEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNV # PFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVY # GCRRLTVETDASYIKGMLDNPSCGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDNFKDQIDPRSGYLYETAQEAD # DIELDVQEALDEERSYEIRRNHMNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYH # RNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIP # SNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALI # KATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELR # RFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRLRVALISLLKWMEQYSKRRSEPSEYCRISREMNQLNCQTIFTNLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 Scaffold_4 AUGUSTUS gene 2644255 2645699 0.24 - . g490 Scaffold_4 AUGUSTUS transcript 2644255 2645699 0.24 - . g490.t1 Scaffold_4 AUGUSTUS stop_codon 2644255 2644257 . - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_4 AUGUSTUS CDS 2644255 2644682 1 - 2 transcript_id "g490.t1"; gene_id "g490"; Scaffold_4 AUGUSTUS CDS 2644764 2644896 0.9 - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_4 AUGUSTUS CDS 2645087 2645473 0.26 - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_4 AUGUSTUS CDS 2645532 2645699 0.97 - 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_4 AUGUSTUS start_codon 2645697 2645699 . - 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRSHVRQVSNLTARQSI # IDTLCLGHKLFPDIVSDSHFEQHLKFMAFANDAHVPISFMTIYINSLFRTLSSEIASSTARSVHSDHEASTRADNSRFIRKSKKKATRFASSRDVKRE # PRSVRFDSDNRRGTPYPTGPNKGSNKDEKSAVNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEF # EFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 Scaffold_4 AUGUSTUS gene 2646712 2647370 0.43 - . g491 Scaffold_4 AUGUSTUS transcript 2646712 2647370 0.43 - . g491.t1 Scaffold_4 AUGUSTUS stop_codon 2646712 2646714 . - 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_4 AUGUSTUS CDS 2646712 2647259 0.94 - 2 transcript_id "g491.t1"; gene_id "g491"; Scaffold_4 AUGUSTUS CDS 2647322 2647370 0.43 - 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_4 AUGUSTUS start_codon 2647368 2647370 . - 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTSSPVGGSVPMELDLP # TIESLAERALSPEKGAESAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 Scaffold_4 AUGUSTUS gene 2647968 2648672 0.27 - . g492 Scaffold_4 AUGUSTUS transcript 2647968 2648672 0.27 - . g492.t1 Scaffold_4 AUGUSTUS stop_codon 2647968 2647970 . - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_4 AUGUSTUS CDS 2647968 2648404 0.49 - 2 transcript_id "g492.t1"; gene_id "g492"; Scaffold_4 AUGUSTUS CDS 2648465 2648672 0.52 - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_4 AUGUSTUS start_codon 2648670 2648672 . - 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS # KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE # DEDEDTAPPPKRLKTTSSISGKIFILHFLSHFINSIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 Scaffold_4 AUGUSTUS gene 2653396 2654016 0.9 - . g493 Scaffold_4 AUGUSTUS transcript 2653396 2654016 0.9 - . g493.t1 Scaffold_4 AUGUSTUS stop_codon 2653396 2653398 . - 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_4 AUGUSTUS CDS 2653396 2653912 0.97 - 1 transcript_id "g493.t1"; gene_id "g493"; Scaffold_4 AUGUSTUS CDS 2653991 2654016 0.9 - 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_4 AUGUSTUS start_codon 2654014 2654016 . - 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MSTGSEIPTTPRPAAAVPLFPTHCDDAPEILPADENELHNSPPPAIPDLPDLPLPPACSSSATASIGTSQSTKYAISR # VQEFENREREAKDQGKDWATETAFARISADPWSFATSTKEDNIPSGYKQAMKHPELWREPMELEYKMLMEKNVWTLVELPPGANLMGGKWVFAIKRGA # SGNY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 Scaffold_4 AUGUSTUS gene 2655514 2656484 0.37 - . g494 Scaffold_4 AUGUSTUS transcript 2655514 2656484 0.37 - . g494.t1 Scaffold_4 AUGUSTUS stop_codon 2655514 2655516 . - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_4 AUGUSTUS CDS 2655514 2655798 0.75 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_4 AUGUSTUS CDS 2655909 2656484 0.38 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_4 AUGUSTUS start_codon 2656482 2656484 . - 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MSTNQVNVPIFPEESKLTGKDSWSRFKAAVELTAQLRGYTGYLDGTIVKPPSSLYSSAAGSVYPSVTATPAYSPTPYP # EEWYMRDRFVAATINLNTVDATGLGIDLAKSAANIWKDLTEKFERKDEQLIYLADHALRTEKFDPDSCTMEDHEKKMKNLKKKLTDVGGTLTDAQFRI # IILASVPTDWKPETRNQRMAAMSAQSQPTIAATTGTRHERLICSNPPCPSKIGHTLKKCWAKGGGCEGKAPAWWYKKHNQEPPTTVNSTSPIDTFTLS # ARTSPSTSTQTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 Scaffold_4 AUGUSTUS gene 2659460 2660101 0.68 + . g495 Scaffold_4 AUGUSTUS transcript 2659460 2660101 0.68 + . g495.t1 Scaffold_4 AUGUSTUS start_codon 2659460 2659462 . + 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_4 AUGUSTUS CDS 2659460 2660101 0.68 + 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_4 AUGUSTUS stop_codon 2660099 2660101 . + 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MKTLPLLPMTSINSSLRESGTADNKSRPYGVTWHHTTAALPSNDPIEDAHSHQIIQSDDGKSDLLFFSVFDGHGGRNT # SQLLSRTLINAVALKLSQLAASTTASSSTKSFTDGLWAIWSKSPSNSTPTSWDVPSISSAIENAFVEFDQVLLDAPISILKQTLQEGNLTAKSPVPDL # SSNASGIQTMQAAISGTCYAPSFFFSPTSYDVQVAVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 Scaffold_4 AUGUSTUS gene 2661842 2663194 0.36 + . g496 Scaffold_4 AUGUSTUS transcript 2661842 2663194 0.36 + . g496.t1 Scaffold_4 AUGUSTUS start_codon 2661842 2661844 . + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_4 AUGUSTUS CDS 2661842 2663194 0.36 + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_4 AUGUSTUS stop_codon 2663192 2663194 . + 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MVISMPVLWTSLGIDMFCSLNAAYSFFKRFLGRSSFHPVDFTINYDDAYPYQYPHEAPIFPLLESNCGRWRHVCVRTS # LDLVEALMQPIISSGKELPRLESLSLNPRFYDHSDEGLLDFPVDCPNLRALKLVGPRLDLKFPRPTITSLKLAEMSPSEMARVIANCPNVQALKIKQL # TSLDTSLSPVYTKCNAKKLILCVGNSREGVAPDSMMKFVDLLILPELNHIILSDPRGALESRHVESLCNNMIEHGYLHLTHLTLDRTFLTAEQLLQLF # LSMSSITYLKAWKTAVNLALKLLIAPGYRDQPGQHIGNNEGRKERENVLEGYNSNDDESEDGVDAIEVPEGKCLLPKLQNLELVLPYRLRGNLLLAFL # RSRWKPLPQMEVSSPTLTEDPQGLSDIDQKTCVSLQKLCLRYTYLDEERDLEKLQILQRSLDPFRSEGMDIEVLSELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 Scaffold_4 AUGUSTUS gene 2665250 2666008 1 + . g497 Scaffold_4 AUGUSTUS transcript 2665250 2666008 1 + . g497.t1 Scaffold_4 AUGUSTUS start_codon 2665250 2665252 . + 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_4 AUGUSTUS CDS 2665250 2666008 1 + 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_4 AUGUSTUS stop_codon 2666006 2666008 . + 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MNDESVTTASTPTRNKNSYILFYIKNKGEKLESAVKTNTPLTNGSAIQFTPTQVKKPGIAAQMQKKRPREGENGEGVE # DQGVKVNPPFIGPVLPSQESVGEGSSPSQAKRPKLDSEDPQASVIKRKIDSAKAANGKAPLPGLADYGSENEEEEVGEKTEAPEETSSKLIDRPESSS # PRRPPTPAAALSRSSGPIPTSSFYATPKAKQKPTHGGGSGPSPANRKTTFLDRKNNYNPYAFGKKNKRFGSRPRAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 Scaffold_4 AUGUSTUS gene 2668807 2669902 0.34 + . g498 Scaffold_4 AUGUSTUS transcript 2668807 2669902 0.34 + . g498.t1 Scaffold_4 AUGUSTUS start_codon 2668807 2668809 . + 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_4 AUGUSTUS CDS 2668807 2669211 0.34 + 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_4 AUGUSTUS CDS 2669271 2669456 0.97 + 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_4 AUGUSTUS CDS 2669514 2669523 0.97 + 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_4 AUGUSTUS CDS 2669601 2669902 1 + 2 transcript_id "g498.t1"; gene_id "g498"; Scaffold_4 AUGUSTUS stop_codon 2669900 2669902 . + 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MGNLGRAGYGATLDGMVIIITFRFFFFQNLNRSTAFVPFSQWPYTYDSCDVGTAPNQTKNGLPEAAVQDGGSSSDYAL # SYLPGQRLSRCTCSGSSHPGPMHSDGTYVGRSAPEIDMFEAQVTDELGYVSQSAQWAPFNDFYVWDNTTDNLIIYNSTASELNSYIGGDTQQASSVVT # ETNQLCYELSKAPCYSIYAFEYKPGFDDAVSELFLIVRYTTQMSSPQYITWYSSGTPAWTLNVAGMGADTATEISARPVPQEPMYLIINLGMSENFGT # VDLEHLTFPNHLRVDCEFSLYTKFEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 Scaffold_4 AUGUSTUS gene 2671750 2673276 0.41 - . g499 Scaffold_4 AUGUSTUS transcript 2671750 2673276 0.41 - . g499.t1 Scaffold_4 AUGUSTUS stop_codon 2671750 2671752 . - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_4 AUGUSTUS CDS 2671750 2673276 0.41 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_4 AUGUSTUS start_codon 2673274 2673276 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MLGTRTKQINSYGKRSQRIVSVFQSESGSKASIFDDLPPTKLVPVASRMKKKRSENAVDVRPKLASPKHRQVQKEKQS # PLAQPLRQKLMRAQMGRKVSNTKTAVENTPTRTPLAMYPLNTPGSPAIPSGLLRKKARPSSAVRTPLMKTRSDLVEVDIIILDDQGKTISRERRVSKG # KNVESGNSSFERSDNDERPIRPRKRLRNFVITSEDESSSDDEDVIPSPVVNPKLKVVKLPLHPPLPVPSRSLPYDLVPSPSPELAAILKATNTTDPTS # PPLAPLPLIDYDLPHIVKPRKLTPIKGRGRGFLRPPSPPSPLSDSDLEISFSDLDLGVDIGPVDTSLELPPVIPEYLRPLLEECQQSMTGLHEFSAFI # DTFAFDPAVRGILPAKNLRFRKVGEASFSEVFGIGDVVLKVIPLRDESGTSLSGSQKARMSDCADLPAPTDAKDVLKEVIVTRAMGEVCERFVKLVKA # YVVRGRYPEVLLELWDRYAEELGSESVRPGRCNLNKLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 Scaffold_4 AUGUSTUS gene 2678071 2678433 0.7 - . g500 Scaffold_4 AUGUSTUS transcript 2678071 2678433 0.7 - . g500.t1 Scaffold_4 AUGUSTUS stop_codon 2678071 2678073 . - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_4 AUGUSTUS CDS 2678071 2678433 0.7 - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_4 AUGUSTUS start_codon 2678431 2678433 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MLKKGTREESTLDELFPAALWLPEEIEWVRGSDVNEAKLENLTPSGIMGVVVMGDKGDKGPIKCLEGGRCDDGEARGG # CILTEWGTVDSGDFESDIEEVADVMREDVDWFALKPVGECEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 Scaffold_4 AUGUSTUS gene 2681036 2681674 0.82 - . g501 Scaffold_4 AUGUSTUS transcript 2681036 2681674 0.82 - . g501.t1 Scaffold_4 AUGUSTUS stop_codon 2681036 2681038 . - 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_4 AUGUSTUS CDS 2681036 2681674 0.82 - 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_4 AUGUSTUS start_codon 2681672 2681674 . - 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MTDHPLRNVPCRDYEGLLLLDYEEKWALVWGIKHYFHPQAEGNVWNIQRRTSVKTTQPSNVLGTVEIQDVDEQKVFDA # IANIPLQATQFLALQKIMEYLLGELKISHHPLPDNLLYTPKQDWRQIFSAMSNPTLQNQYPCSPYLKLARDVSRQSWFSRNRKRTSPLRRFMPYLGTV # VEDEARSKYEKAFNSTLWDACQTETGEHGIDTIVSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 Scaffold_4 AUGUSTUS gene 2683751 2684452 0.29 - . g502 Scaffold_4 AUGUSTUS transcript 2683751 2684452 0.29 - . g502.t1 Scaffold_4 AUGUSTUS stop_codon 2683751 2683753 . - 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_4 AUGUSTUS CDS 2683751 2684452 0.29 - 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_4 AUGUSTUS start_codon 2684450 2684452 . - 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MGLCRVATIGRTRWGRDMREDGYIASKADPCVRYRRIDDEYTLSTTYGDDVNGASSTEDGRKKAIADLGKRWESSEVN # SGILLGMTISQDPISKSITISQKSYFERMLEHFGMENVRIRCTPLDPKAKIIESTNPLPELDRKFMSNKPYRSFVGSLLWGACSTRPDIAFASNFFAR # FQLNPGIIHWEACEWLAGYIHGTIHYSITYRAPKPGMTASVSALHLWVTQIAIGLPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 Scaffold_4 AUGUSTUS gene 2686506 2687246 0.8 - . g503 Scaffold_4 AUGUSTUS transcript 2686506 2687246 0.8 - . g503.t1 Scaffold_4 AUGUSTUS stop_codon 2686506 2686508 . - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_4 AUGUSTUS CDS 2686506 2687246 0.8 - 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_4 AUGUSTUS start_codon 2687244 2687246 . - 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MPKSWRDLLINLKGISSDDAFIHLRQVYDNKKEDEEDIRQHSQVRALIAQEMASFHSANAASAPKKDRPMCTNPNCPP # RRRRTHPIEKCWAPGGGDEGGGPKKAETSITQTANYASDGGNHTVMELFDLCTSPSAPISSTQLPNAHTCRNCVSVSTGYGANKEVIRSVEILDSSIP # YSLSTFDKYTACSAHNEKTLLYATSKPRIPQTFLDWLQVTISGSEELISLSMRIYMERQGSQRLPESRRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 Scaffold_4 AUGUSTUS gene 2689893 2690255 0.32 - . g504 Scaffold_4 AUGUSTUS transcript 2689893 2690255 0.32 - . g504.t1 Scaffold_4 AUGUSTUS stop_codon 2689893 2689895 . - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_4 AUGUSTUS CDS 2689893 2690255 0.32 - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_4 AUGUSTUS start_codon 2690253 2690255 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MTQGEDTRTLAPASISETEYIRLGDLDSPHAKDGKSAVLFLAALQWKYTKVETVSVWLNLEEVADKMEKVVWNYFTTS # SGVLWIQWNLRVEVGEKHQLQAEIEKMKDCVGKCMKDEWCYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 Scaffold_4 AUGUSTUS gene 2691843 2692691 0.44 + . g505 Scaffold_4 AUGUSTUS transcript 2691843 2692691 0.44 + . g505.t1 Scaffold_4 AUGUSTUS start_codon 2691843 2691845 . + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_4 AUGUSTUS CDS 2691843 2692691 0.44 + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_4 AUGUSTUS stop_codon 2692689 2692691 . + 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MHVLNIPQVLNDPIAVDDEPAMAAQLGHFSYEWTRWNKGKLREALKTNPDPKSFKLLRLWPEKLECSVREGIICCILV # SLADFFFASASRELLPELPGGKFFHKRPSQAPSNGARPKKFSESQADPETRIHIDRPREPDNTSVPVALLVPSFGTFQTNVKNIAPSDRAMLFATKMA # NELCVIFRDEQERAQKFCSILSKFLGEDVVSNATIGNFKTDGGVTVDKDSPARLLVSVKSEQTGTSDLCFQVSLSYLQDTRRVCQGVVDDRNARAAAT # VDFNITSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 Scaffold_4 AUGUSTUS gene 2700568 2701191 0.9 + . g506 Scaffold_4 AUGUSTUS transcript 2700568 2701191 0.9 + . g506.t1 Scaffold_4 AUGUSTUS start_codon 2700568 2700570 . + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_4 AUGUSTUS CDS 2700568 2701191 0.9 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_4 AUGUSTUS stop_codon 2701189 2701191 . + 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MRALGKLPGSLQETYEKALKRCQDQGNAEETQHLLLWLLYAFEPFTKEQFSEILAVDLEKQVIHPSMEFKVELAIDST # LVTVGGNNVVQLAHASVKEYLISYSLQKETQDLFQLNEKLAHDIMTQTTIIYLMQKDKIDMYDDDSIASYSVLNWLSHASKVEEYKLKGKAQNLIHKC # WKIITSILQDGKQNTGDGDITIQEHHYTMEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 Scaffold_4 AUGUSTUS gene 2701504 2702663 0.69 + . g507 Scaffold_4 AUGUSTUS transcript 2701504 2702663 0.69 + . g507.t1 Scaffold_4 AUGUSTUS start_codon 2701504 2701506 . + 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_4 AUGUSTUS CDS 2701504 2701625 0.69 + 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_4 AUGUSTUS CDS 2701703 2702663 0.96 + 1 transcript_id "g507.t1"; gene_id "g507"; Scaffold_4 AUGUSTUS stop_codon 2702661 2702663 . + 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MKNEAIVKLLLEKGADVNVQGGKYGNALQAAAYAGDEAIVKENEAIVKLLLEKGADVNAQGGEYGNALQAAAYKKNEA # IVKLLLEKGADVNAQGGGYSNALQAAAHAKDEAIVNLLLENGADVNLQGGFHGSALMVAAYMGYEAIVKLLLEKGADVNAQWMNHKSALRHAVYSENE # AIAKVLLEKGADANTQAWDNVSMLQVAAEGNNEAIVRLLLEKGADVNAQGGEYGNALQAAVYQESEAIVKLLLEKGADVNAQGGEYGNALQAAAHAGD # EAIVKLLLEKGADVNAQGGEYGNALQAAVYQESEAIVKLLLEKGADVNAQGGEYGNALQAAVYQENDAIVKLLLEKGADVNAQGGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 Scaffold_4 AUGUSTUS gene 2705875 2706543 0.78 + . g508 Scaffold_4 AUGUSTUS transcript 2705875 2706543 0.78 + . g508.t1 Scaffold_4 AUGUSTUS start_codon 2705875 2705877 . + 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_4 AUGUSTUS CDS 2705875 2706543 0.78 + 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_4 AUGUSTUS stop_codon 2706541 2706543 . + 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MHLTPEISITSTTLAIAGTTVTLSFAPTRSPIQSKTQLLWKIHFLPIPHPQLPTPIMSTPVPPTPPASAEDLMTHLIR # QVANLATAMEERSSSKSSMNRPEVFKGKDGSEACCFMAQFQNWASEQPDLAKSQMKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEF # AQWFEPMDPGMEAHSVIKNLRQRKGQTVAEFVTHVACSWRASSTLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 Scaffold_4 AUGUSTUS gene 2713003 2714133 0.62 - . g509 Scaffold_4 AUGUSTUS transcript 2713003 2714133 0.62 - . g509.t1 Scaffold_4 AUGUSTUS stop_codon 2713003 2713005 . - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_4 AUGUSTUS CDS 2713003 2713325 1 - 2 transcript_id "g509.t1"; gene_id "g509"; Scaffold_4 AUGUSTUS CDS 2713495 2713620 0.72 - 2 transcript_id "g509.t1"; gene_id "g509"; Scaffold_4 AUGUSTUS CDS 2714013 2714133 0.77 - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_4 AUGUSTUS start_codon 2714131 2714133 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MHNYQDSPAWKDLQEYFNTRYNLAFGLYIDWFNPFTNKIADDIDNLDVTSWSLRDGIHVWQQAAEWLSIRTKSGRQDY # ASTTDAELSESADELEELQAEIAQYNVTLSQDSDHSVTLSGSAQSDDSTPTPKATPYLSEMDFDDDISEDPDYQPINENQQGISNFSNKQLIYIHGCI # KDIMLPTWVDRPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 Scaffold_4 AUGUSTUS gene 2721788 2723230 0.17 + . g510 Scaffold_4 AUGUSTUS transcript 2721788 2723230 0.17 + . g510.t1 Scaffold_4 AUGUSTUS start_codon 2721788 2721790 . + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_4 AUGUSTUS CDS 2721788 2721955 0.79 + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_4 AUGUSTUS CDS 2722020 2722181 0.7 + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_4 AUGUSTUS CDS 2722221 2722388 0.66 + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_4 AUGUSTUS CDS 2722463 2722485 0.49 + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_4 AUGUSTUS CDS 2722607 2722731 0.82 + 1 transcript_id "g510.t1"; gene_id "g510"; Scaffold_4 AUGUSTUS CDS 2722812 2723230 1 + 2 transcript_id "g510.t1"; gene_id "g510"; Scaffold_4 AUGUSTUS stop_codon 2723228 2723230 . + 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLPVTLRSHVRQISNLTARQSIID # TLCLGHKLFPDIVSDSHFEQHLKFMAFANDARSFQNTFVRNRLLDRARSVHSDHESSSCADNSHFIRKSKKKATRFASSRDIKREPRSMNSASEDDTP # YPTTGSNKGSNKDEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRA # RIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEIAVPVPKTVERAFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 Scaffold_4 AUGUSTUS gene 2723491 2725602 0.77 - . g511 Scaffold_4 AUGUSTUS transcript 2723491 2725602 0.77 - . g511.t1 Scaffold_4 AUGUSTUS stop_codon 2723491 2723493 . - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_4 AUGUSTUS CDS 2723491 2725602 0.77 - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_4 AUGUSTUS start_codon 2725600 2725602 . - 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHV # KGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNH # MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQP # QLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIH # GRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSK # WFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHT # IKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVED # EDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 Scaffold_4 AUGUSTUS gene 2726516 2727670 0.98 + . g512 Scaffold_4 AUGUSTUS transcript 2726516 2727670 0.98 + . g512.t1 Scaffold_4 AUGUSTUS start_codon 2726516 2726518 . + 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_4 AUGUSTUS CDS 2726516 2727670 0.98 + 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_4 AUGUSTUS stop_codon 2727668 2727670 . + 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MLTPAPPAPPTAAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGSEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFIESAGDWATPHLLHFSAENPPFGGNWDTFLKGFGQWYEPMDPGMEAHSEIKNLRQSKGQTVAEFAQKFKDIGDWTEMSDIDLRECFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPVHTAHTTPADPHAMDIDATHTSTGNSREAFLACMRRRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGPGRDRGQRQQPRRQQISATAAAPFTLFPNESVQIAASVPATAPATLNPTNQDFSGQIGQIMELLDRANA # MSPPSSGLQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 Scaffold_4 AUGUSTUS gene 2728036 2728809 0.95 + . g513 Scaffold_4 AUGUSTUS transcript 2728036 2728809 0.95 + . g513.t1 Scaffold_4 AUGUSTUS start_codon 2728036 2728038 . + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_4 AUGUSTUS CDS 2728036 2728809 0.95 + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_4 AUGUSTUS stop_codon 2728807 2728809 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MDFLITNLGGEDIILDSWLWKVNPEIDWEKGRLSVKPPRVDIEEVKDEQTSHPHLVASTIDSPIQELLSEGSQCEPNH # TETGPEENEITTATGESPIHQIRANHKTHWAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRGFKKVFSESASERLPAHLS # CPAYNQTSPSTRHMLSHTLSTSCTSPTPPKSPPQVPSCTSILHLPHTSTTIYLPKRPSPTRCHTPTATRPVSAPTRSSRMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 Scaffold_4 AUGUSTUS gene 2736427 2737001 0.3 + . g514 Scaffold_4 AUGUSTUS transcript 2736427 2737001 0.3 + . g514.t1 Scaffold_4 AUGUSTUS start_codon 2736427 2736429 . + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_4 AUGUSTUS CDS 2736427 2736446 0.31 + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_4 AUGUSTUS CDS 2736536 2737001 0.81 + 1 transcript_id "g514.t1"; gene_id "g514"; Scaffold_4 AUGUSTUS stop_codon 2736999 2737001 . + 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MVLVGTLFDENEEEENGGWADPVTENEEDYDGIRSYNDTLECYTSFEELPELDTESLTSVESPFAETPDPLDDDADYR # SAYERDLEKRMVSSVNISSVNSCAPLYMDGCPLDRSMVDALNVNDEDESSPYSWADEEDDLPPLEDEWYQSVIRRTQDVFADA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 Scaffold_4 AUGUSTUS gene 2738892 2739578 0.47 + . g515 Scaffold_4 AUGUSTUS transcript 2738892 2739578 0.47 + . g515.t1 Scaffold_4 AUGUSTUS start_codon 2738892 2738894 . + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_4 AUGUSTUS CDS 2738892 2739578 0.47 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_4 AUGUSTUS stop_codon 2739576 2739578 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MAVDLQEQVVDHPHMEVQVEKVIDSTLVTVGQNNIVQLAHASVKEYLIISEAKQTKDLFELNAQLAHDIMTQTTIIYL # MQKENLSTDHSSFAHYGVKNWLSHASKVEEYKLKGKAQSLIEKMLDNNNLYFARWEEMYRHLVNDWEKIEATPLYYGALNGLCEAVQKLISKLDLKTD # INISGGRYGTSLQAASFKGYETIVSLLLEMGADVNAQGGYMGMHYRLPQHRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 Scaffold_4 AUGUSTUS gene 2741655 2741915 0.45 + . g516 Scaffold_4 AUGUSTUS transcript 2741655 2741915 0.45 + . g516.t1 Scaffold_4 AUGUSTUS start_codon 2741655 2741657 . + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_4 AUGUSTUS CDS 2741655 2741915 0.45 + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_4 AUGUSTUS stop_codon 2741913 2741915 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MTNIADTLSQFEAPIGPHLLHYAHSESSALQPAFVLNPSSHSGPFLSNSSSPVHSGSQFLSPGSPPVFIKEYNVENTW # GIDTADDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 Scaffold_4 AUGUSTUS gene 2755157 2755786 0.43 + . g517 Scaffold_4 AUGUSTUS transcript 2755157 2755786 0.43 + . g517.t1 Scaffold_4 AUGUSTUS start_codon 2755157 2755159 . + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_4 AUGUSTUS CDS 2755157 2755441 0.43 + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_4 AUGUSTUS CDS 2755529 2755786 0.77 + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_4 AUGUSTUS stop_codon 2755784 2755786 . + 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MCLLNVQDSLILLKLSSNVYIGTLLTSFGNDVVLVLTDVLANFPDSVQKTQELQQRERALRALLKMEKRDLKNQISSI # SESCFVAVKNEMDGTRQVYPDYYNIIKTPISMANIAANVKRGNVYESVAQYSSDWDLMFENAREYNEDVSTIYNDTYILQHVFQNALEAATRIHGIIL # NDPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 Scaffold_4 AUGUSTUS gene 2755898 2756278 0.52 - . g518 Scaffold_4 AUGUSTUS transcript 2755898 2756278 0.52 - . g518.t1 Scaffold_4 AUGUSTUS stop_codon 2755898 2755900 . - 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_4 AUGUSTUS CDS 2755898 2756278 0.52 - 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_4 AUGUSTUS start_codon 2756276 2756278 . - 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MTQDINILATALEENKIQVYIMNRPSNEFIDPVRDLLGEGAKYPNSRTAFQRFRADHRIPVNLGFVEPTVGDGASGEP # EEEGELYQEEYETSREDLAVDEEEEYDKMDDAFENMVTFMSSNGMDAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 Scaffold_4 AUGUSTUS gene 2757286 2758065 0.66 - . g519 Scaffold_4 AUGUSTUS transcript 2757286 2758065 0.66 - . g519.t1 Scaffold_4 AUGUSTUS stop_codon 2757286 2757288 . - 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_4 AUGUSTUS CDS 2757286 2758065 0.66 - 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_4 AUGUSTUS start_codon 2758063 2758065 . - 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MFARLRSQKANNFQAVIALFLIGSGSAKREMEVLAHAGLSLSYAAIRYLNQLSREATRKYQELIKQCMMMIVWDNLNI # AFRVAAQRHDSKDHFDNGTTSTVLPIWDPINCSTRTPYGTLPLDMKPPRTTTDPTFQWSAMQVLPTRTDINQLHDCLIWQLKHLAMEHIGGLEHLKSS # FEACPTVDPIAVHVTEQYPLPALHEEESSIEGTITVYVSILRNLGMTNEDLKAHGLLFNDGDLLTDSLVEKVGLYFDHVHIVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 Scaffold_4 AUGUSTUS gene 2758104 2759923 0.76 - . g520 Scaffold_4 AUGUSTUS transcript 2758104 2759923 0.76 - . g520.t1 Scaffold_4 AUGUSTUS stop_codon 2758104 2758106 . - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_4 AUGUSTUS CDS 2758104 2759096 0.93 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_4 AUGUSTUS CDS 2759693 2759923 0.76 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_4 AUGUSTUS start_codon 2759921 2759923 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MSDKEVTNYLLGLPESDRIALQMHIKMSSSIETQIQTSNNWVEFQKMEGVEGFIKEVTQTVEYQSIGSFPEFIKAYYE # GEEEDVDIFQQTSSAPSSPIAHLEPADSDMLGLNLLDKPYTLPSQQASISNITSLSPIEDNTASGSTLFPFTTLHSSTSPTRNLSTPTLPDSSPGPLD # TPVHRRHIGRPQTRRVRKGLGGETNTPQTSVYFQNQQKKLTERIRSNSSAKLAQRKATRELSAAQRKEMALELKHQNLIKKRDKALQFIANLTKPEGE # EDGLVFDSLIDFFDSLQIPGGDRQVRANITRLHKARGSQIIQGVLEDAPDVIPQVLQTLFEKEGKDLQALLTRSMETPISEHLRSFSMMELSNKIQEI # APNIWKALNTITDNPEKTAAPRHEKLVRLSQFYRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 Scaffold_4 AUGUSTUS gene 2761525 2762169 0.87 + . g521 Scaffold_4 AUGUSTUS transcript 2761525 2762169 0.87 + . g521.t1 Scaffold_4 AUGUSTUS start_codon 2761525 2761527 . + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_4 AUGUSTUS CDS 2761525 2762169 0.87 + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_4 AUGUSTUS stop_codon 2762167 2762169 . + 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MRFLISALLPLITLAVHVAATNPEQGSIPLNHLPRPGDAHLHGPPPSYEEAIQSNNNIPAAHLHNPALTSFDEHEVQP # AAAMPNVSPHCLEAARQQAYAEAIQVVGNRDTSQLHVVITSGDAPMDPRTRRKAVVVWCAVIAGIAGIAVYAIWASAECHPTETAPHCTAWRRRDKID # STPNINQCKPLDVDACRNPSPTVSCSESLCHLLRIDTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 Scaffold_4 AUGUSTUS gene 2764892 2765780 0.27 + . g522 Scaffold_4 AUGUSTUS transcript 2764892 2765780 0.27 + . g522.t1 Scaffold_4 AUGUSTUS start_codon 2764892 2764894 . + 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_4 AUGUSTUS CDS 2764892 2764951 0.27 + 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_4 AUGUSTUS CDS 2765046 2765780 0.65 + 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_4 AUGUSTUS stop_codon 2765778 2765780 . + 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MTHGVAKTAVSIKKYYSSTYKTYTGASGWTYTHEGGFNVVSATEDAWRNFVSVHKQFKPFKTSGWPLWELMHEIVPAQ # ARGVHVFNAASQDTAQETGDSLSEPELDPRSRSATPLQDVKNHSPSEDSAISESQITSSQAFDESQDTLSQVSMQVSSTLSQTSVTSSQLQKTPAPKR # ASSDIADTPTPWSSKRVRLTGPEAIHSLGQSVHGISDTLRDIFGTTSKLTALSPSKKLAIAQQRIKEDVQGFYISDDQATNLKMLSIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 Scaffold_4 AUGUSTUS gene 2766395 2766730 1 - . g523 Scaffold_4 AUGUSTUS transcript 2766395 2766730 1 - . g523.t1 Scaffold_4 AUGUSTUS stop_codon 2766395 2766397 . - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_4 AUGUSTUS CDS 2766395 2766730 1 - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_4 AUGUSTUS start_codon 2766728 2766730 . - 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MDIQACIPSALIAIHNFILEHYQADLDRWILGEQAEDPLPGQCCQQEIDFGSLATSEKISRAEKRHAEIAQDRLANEM # WENYLSILEEYHKQGGVDAMDVDEDEMEIAPLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 Scaffold_4 AUGUSTUS gene 2767573 2768181 1 - . g524 Scaffold_4 AUGUSTUS transcript 2767573 2768181 1 - . g524.t1 Scaffold_4 AUGUSTUS stop_codon 2767573 2767575 . - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_4 AUGUSTUS CDS 2767573 2768181 1 - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_4 AUGUSTUS start_codon 2768179 2768181 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MPEEHIAQVVLEWPPCHDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSSIPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYMKGMLDNPSCGP # NATINHWIEHVRNYHFTCVSCLGTTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 Scaffold_4 AUGUSTUS gene 2768477 2769390 0.26 - . g525 Scaffold_4 AUGUSTUS transcript 2768477 2769390 0.26 - . g525.t1 Scaffold_4 AUGUSTUS stop_codon 2768477 2768479 . - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_4 AUGUSTUS CDS 2768477 2769204 0.49 - 2 transcript_id "g525.t1"; gene_id "g525"; Scaffold_4 AUGUSTUS CDS 2769330 2769390 0.26 - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_4 AUGUSTUS start_codon 2769388 2769390 . - 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MKEQDWSKRTLRSNAVAPEERNSEYKPVDKKINPIKATLPDEFRIERHIHGDPLMELPELSKHPKPFVPTGRYTEERK # EIIDKNHPEGFLWEQERNLMHEMMCKQEAGFAWQPSDAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPLNASYHSKW # FCVIKKDGKSLRLVHSLEPLNEVTIQHSGVPPATADLARSFSGRSCGGTLDLYVEYDERELDQLSRDMMTFQTPYGPHRLVKLPMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 Scaffold_4 AUGUSTUS gene 2778710 2779552 0.56 - . g526 Scaffold_4 AUGUSTUS transcript 2778710 2779552 0.56 - . g526.t1 Scaffold_4 AUGUSTUS stop_codon 2778710 2778712 . - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_4 AUGUSTUS CDS 2778710 2779552 0.56 - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_4 AUGUSTUS start_codon 2779550 2779552 . - 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MQPCRCRECLAQNPEGSLVSYTVLSTHRHRERLRGAFPSSVRGETAETEKPDTLGVEPAGDTPSESQTSSKGKGRAGF # DVETKGDEDITSRRKPLVSEIDVRMETLYHSETRLTFINEPSPHLPFVFPNPETLLQVNSGHFALDTTKLPNRRLLDAEARFCGLLKTIQTMPSGERS # TGETDVEDELFLALNKIHRIKERQWRSQAYPDGRGGSTFDNSMYSLPCPNHCLKLPQDVDSLFNGSPHDTGSDSCFDNVHQIPNSSSSNASASGLVPL # YRPRLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 Scaffold_4 AUGUSTUS gene 2782290 2783974 0.27 - . g527 Scaffold_4 AUGUSTUS transcript 2782290 2783974 0.27 - . g527.t1 Scaffold_4 AUGUSTUS stop_codon 2782290 2782292 . - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_4 AUGUSTUS CDS 2782290 2783557 0.57 - 2 transcript_id "g527.t1"; gene_id "g527"; Scaffold_4 AUGUSTUS CDS 2783689 2783974 0.51 - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_4 AUGUSTUS start_codon 2783972 2783974 . - 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MDIPMVGSFVDVRGSDCLPWIPVFLEARMPLMLYWGTLKDWSVPDVLNGIIPIPAGIVISTLASEQTPYVPPSLYLEE # NVHQVGVSESRRRLRLPRKCAEDRPPGRKGAHVYYWDLVEGIRVRTAVGRSNYEDIWERYGSCQRRYDSVADEWEVCTNLDPDDVPDYHDLDFEDDDD # DYFISVPAHTNEQTGHHMGVVSSEAYLTHLHSSKDDSSVASIEFPDSIEDVARHRLGFLSQRVPDNRNIVLKSQAWKNVLGLLGSGRHPPNPEPNDYV # KLQLSTFTTGLLNAVDLRHAPQAYDLAVRDSTLRPLITFEIDVLSSHNGQFFLIQAKDASDSDPFLIALRSAATVMEISRRKWGPGTEDIIKQLINQG # MSFNTLMPSYPPRHHRSIPCRRPAMLGFRPVGFVPTLQDYRSYEAARNDFLRSARGRAALLAGGIIARLARGIVNENDIYDGPTEHALQKGERALCVW # EAGGSCAFWDDQLTLEEMDLICGSYEVATGKSLRIIFFWINLKYLHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 Scaffold_4 AUGUSTUS gene 2793722 2794069 0.78 + . g528 Scaffold_4 AUGUSTUS transcript 2793722 2794069 0.78 + . g528.t1 Scaffold_4 AUGUSTUS start_codon 2793722 2793724 . + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_4 AUGUSTUS CDS 2793722 2794069 0.78 + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_4 AUGUSTUS stop_codon 2794067 2794069 . + 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MSGNRKEQRRNTHETSRTPRNENEDSTMNEGSRPAHNNNANGDGGQDKGEDNDELEGDGGGDSDDERHPSDDIPNRSQ # KSQHRSGEVKRRPLQELKEKVQANELLISICDSPTHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 Scaffold_4 AUGUSTUS gene 2799344 2800510 0.96 - . g529 Scaffold_4 AUGUSTUS transcript 2799344 2800510 0.96 - . g529.t1 Scaffold_4 AUGUSTUS stop_codon 2799344 2799346 . - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_4 AUGUSTUS CDS 2799344 2799800 0.98 - 1 transcript_id "g529.t1"; gene_id "g529"; Scaffold_4 AUGUSTUS CDS 2799885 2799918 0.96 - 2 transcript_id "g529.t1"; gene_id "g529"; Scaffold_4 AUGUSTUS CDS 2800009 2800510 0.98 - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_4 AUGUSTUS start_codon 2800508 2800510 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNGERIGDTLIYRL # LQIKFDPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMMQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWA # CFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNTSLQEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 Scaffold_4 AUGUSTUS gene 2802861 2803878 0.49 - . g530 Scaffold_4 AUGUSTUS transcript 2802861 2803878 0.49 - . g530.t1 Scaffold_4 AUGUSTUS stop_codon 2802861 2802863 . - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_4 AUGUSTUS CDS 2802861 2803646 0.84 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_4 AUGUSTUS CDS 2803771 2803878 0.49 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_4 AUGUSTUS start_codon 2803876 2803878 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MLDNHTRTANSTSRSGSGHSTQSFLPTLPGELGENKPLAPLILSQLPQVRSHPLPITHTAATTAINQLPQVRSRPLPI # TNTAAPTAVTQVHSRSLSITHAANPTTVSQLDTAPAAPAWLECTNIHVIKKVQTFTLAKTGQPPVMLQIIDKSIAYGKLQMIFNHEYSPLHTFKIKQL # VHACLMEMAERSGHNGNNDVCDRLEHGDHDSYSIPLVTYVSYYLYSNTGNNISSQVSRRIGNECADLKAHSSTILQAFGLVNHAGHLEAGALACRRTY # YYPEMSNGMVSAENTFQCIFIDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 Scaffold_4 AUGUSTUS gene 2804310 2805626 0.48 + . g531 Scaffold_4 AUGUSTUS transcript 2804310 2805626 0.48 + . g531.t1 Scaffold_4 AUGUSTUS start_codon 2804310 2804312 . + 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_4 AUGUSTUS CDS 2804310 2805626 0.48 + 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_4 AUGUSTUS stop_codon 2805624 2805626 . + 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MAYRKLRVFRRRCHSILAAYIGDYPEQMLVTCSYYGTSPVCTVSKDQLGDYPCSAELCDPIKAVQAAKLINTAEWTKH # CSDADMKPIQHPFWEDLPYTDIFRSITPDILHQMYQGVMKHLIVWITTIVGADEVDARVRRLPARHGIRHFHKGITTLSRVSGTEHKQMCTFLLALVT # DIPRKTTSQSNRLLIATRALLDFLYLSCHPIHSDESLTMVETSLSTFHANKDIFIELGAREHFNFPKIHYLCHFVPGFKLFGTSDNYNTETTERLHID # FTKDAYQASNQKDEYSQMTKWLQQREKVVQHTNYLSWCKFQRGLNPQSIPFIVPGVHYDFPGSQRSLQDMQCSLTYVLTKFPTRKMVSFSKLMQIGPD # QWGYGACNFEYALKMFIVQHSDPQSTTIGQIDNMTTFFHFHSKVYQSGIGSNSGMRTYMELRPLML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 Scaffold_4 AUGUSTUS gene 2819231 2819574 0.77 - . g532 Scaffold_4 AUGUSTUS transcript 2819231 2819574 0.77 - . g532.t1 Scaffold_4 AUGUSTUS stop_codon 2819231 2819233 . - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_4 AUGUSTUS CDS 2819231 2819444 0.77 - 1 transcript_id "g532.t1"; gene_id "g532"; Scaffold_4 AUGUSTUS CDS 2819522 2819574 0.8 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_4 AUGUSTUS start_codon 2819572 2819574 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MEFTVFSQIDTISRSGRLTSGNQGLLGQASKQQLENDFGSSKDVDVVEIILKKGRDQPGDAISSQTFITNAARGSGVI # DSKGKGLSGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 Scaffold_4 AUGUSTUS gene 2821554 2821919 0.77 - . g533 Scaffold_4 AUGUSTUS transcript 2821554 2821919 0.77 - . g533.t1 Scaffold_4 AUGUSTUS stop_codon 2821554 2821556 . - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_4 AUGUSTUS CDS 2821554 2821919 0.77 - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_4 AUGUSTUS start_codon 2821917 2821919 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MVIPLQHAADERIRVERFLKELCLGFLRNCSGQEEEGVEMRHLTPPMPVLLTRHEASRLAHSKQIKSSFHSWGIRFAD # LAQIELGIDTSSSGFDRDNDRYVQVFTVCVPEVVADKVWEQYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 Scaffold_4 AUGUSTUS gene 2827939 2828859 0.99 + . g534 Scaffold_4 AUGUSTUS transcript 2827939 2828859 0.99 + . g534.t1 Scaffold_4 AUGUSTUS start_codon 2827939 2827941 . + 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_4 AUGUSTUS CDS 2827939 2828859 0.99 + 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_4 AUGUSTUS stop_codon 2828857 2828859 . + 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MLAGKDWSPSPPPEGTAANTPERPSSAQGLRKSRATSRAMAGSALRSSSGASSPASIRGTGSNAGTPDLSRSGTSDLK # TENENYFASLGQLNANRPLDLHPSQGGRYTGFGSTPAPSAGSSNASYGLSSRAAPSLQELQQNPLGALSKGWSLFSSAVVGASKTINETVIQPGMERV # TDPEFQGNVKGILGEAQKRAGQAASGANDWGRKQFGVDVGERVGTLVGGVGGNPRNQGYGHVGSGYGEEETSGLYHDDDAEYWGRHDGWGSATSDPNS # ASVLAGPPGATSDAPAKSQTKKTDWDDEWKDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 Scaffold_4 AUGUSTUS gene 2829151 2830107 0.73 - . g535 Scaffold_4 AUGUSTUS transcript 2829151 2830107 0.73 - . g535.t1 Scaffold_4 AUGUSTUS stop_codon 2829151 2829153 . - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_4 AUGUSTUS CDS 2829151 2830107 0.73 - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_4 AUGUSTUS start_codon 2830105 2830107 . - 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MKSRRKGVTTSSMGPPASSSSSSNTNSTSSLPPSQSLEPPFTPTNPPTWGYPSWSQNENNSEMVYRPWNNPVNTEPST # WGTQQAFNYDYSSSQAPAMYSSPPSVPSMGHAPPIAIRSSFSHPHTNFTPTVPSIPSTTVPSSSSYSSIPLPRHTYTRTLVGPLSANATRLLDEHRKP # GVFFLFQDLSVRTEGTFRLRMRLMNVGKYPAPETGATGVMSIDDRDGHERGLPGVSPVLAQVYSEPFTVYSAKRFPGVPGVYCYFRNFLLTDHNFPTD # TTALSIAFGNQGQKLPLRNRHGNSSGKRRRRGDDDDEDDSEESD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 Scaffold_4 AUGUSTUS gene 2831591 2833006 0.64 - . g536 Scaffold_4 AUGUSTUS transcript 2831591 2833006 0.64 - . g536.t1 Scaffold_4 AUGUSTUS stop_codon 2831591 2831593 . - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_4 AUGUSTUS CDS 2831591 2833006 0.64 - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_4 AUGUSTUS start_codon 2833004 2833006 . - 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MASLRAVLDQVKNSDYPPTAVTYVLLMTTLAHRRDVAGVELLYKEAVEERGIVPNRRMVNTLMNAHVIAGSWKGVIRV # FDYIRSDAHPRIRLTIELYTTLLKAYVLIGAPFPVVSKIFSKLEDLNVKPDSYTFALLIQSACDAGEMEIAWEIFREMDKLAQSWTSNLYIDVYILTI # IMAGYLRAGKRQKAKAVYDELVARQIQPSAVTFSVMLTSYGNQRSEEAMRIAEAFINELMNIPERPWAKPSYGKPSALELVYGPLLKGYTTLHKAEDV # ERLHNDYSAAGGVETLGTLSALFDVYRRTYQIENVKEMWPAIFALGVEYVKETPVINTSKDDPSANRLLNNILCLPLSIYIDALSAAGEHEEIARVWK # TFQEHGFSFDAHNWNHLAVTLIRAGQLERAFQVVEHVILPYQDQARDLIASRNSTPNSPLMYSLEDLDKDEEEFNTTFIESQAQLKKRGVVAAAIHPP # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 Scaffold_4 AUGUSTUS gene 2836824 2838076 0.48 - . g537 Scaffold_4 AUGUSTUS transcript 2836824 2838076 0.48 - . g537.t1 Scaffold_4 AUGUSTUS stop_codon 2836824 2836826 . - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_4 AUGUSTUS CDS 2836824 2837068 0.93 - 2 transcript_id "g537.t1"; gene_id "g537"; Scaffold_4 AUGUSTUS CDS 2837140 2838076 0.48 - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_4 AUGUSTUS start_codon 2838074 2838076 . - 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MPDLSPSLLNFDDPHRFMPSDDQLLFDMEDVSFTHDASSGPFSWDLKNDTDSDIKPAYYTAGPSPLSSNYDYLSQASP # TDSFYDPSAYLTHEDSTSFDNNLFGSWIHEPELIPIPSPVAPIPISPNDPQNLEPFFTFGERSHFPQDHGLSPSEFAALQPLPMSPSSSYEESHAFPR # QRVDSMTSISPADISAVQTPEWVSLFDNTATPSSISIRTPASSRPSVRHSPISSDGVQRIRMPRRASITSSQLFQSASAPSHSHLQTQSRSASSMASR # RAESVSLSDDRDATVRRRRKVSNTSVEEHEKSDKPNDSVPTKSALRPPKLAPSAWQLYFTDWIQRQQASNTRKLNVAQAAKEAGQEYASLSAEEKEVS # LCFFSLYACDVGDADIVFSWE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 Scaffold_4 AUGUSTUS gene 2839995 2841747 0.15 + . g538 Scaffold_4 AUGUSTUS transcript 2839995 2841747 0.15 + . g538.t1 Scaffold_4 AUGUSTUS start_codon 2839995 2839997 . + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_4 AUGUSTUS CDS 2839995 2840248 0.15 + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_4 AUGUSTUS CDS 2840301 2841747 0.36 + 1 transcript_id "g538.t1"; gene_id "g538"; Scaffold_4 AUGUSTUS stop_codon 2841745 2841747 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MSSRTKSKPPAHSMGITAGAEDVKYQAKYKELKRKVKEIEGVSRGFFSRKIQMYNSLQKDNDKLHFKVLTAKRNIQRM # KLERASVILYERLAQISPSPVPNDQHSISTPHPAAVVHHSPIIQPVPNRHRVDVGDLVGIDFDANFVDYSQHSRINPSRPLPAIDTTVAPSVHHHIPP # PSSRHGSGSGSDSRQLPPFTQFLDQPRSPRSHPHSDSHQRTRSQSSSSRSHNLPPQQAPYHIGNAQGHQYADSLPPMQHALHSPPLLDREREGSRSRR # HDLHELAGTHDAHAHSMPPLSPSVDSRSSARIHNHQRLGPGTYINRDDPRSHEMDRERDWEQERDIRDRELNYSNARQRERDAVVSSMRSPPPVHRRA # PSAMDYHDQHIPSSRAREEYYHENSLGSGGPSGGGSGGIYARVSRSGTPGSGSGSNSAGANEGPSRPDSRSSYFEDRSRGYRFRHVNAGLPTNEEPTL # DFVHEDGRSQSRDRSSATGVGFPLQHRETVDAVGRMDLRRDRENKDAKRKIRGDMDVDTENGSTGVMSSYPGGISDERGGKRYHRDDNIEDVRMGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 Scaffold_4 AUGUSTUS gene 2848686 2849093 0.98 - . g539 Scaffold_4 AUGUSTUS transcript 2848686 2849093 0.98 - . g539.t1 Scaffold_4 AUGUSTUS stop_codon 2848686 2848688 . - 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_4 AUGUSTUS CDS 2848686 2849093 0.98 - 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_4 AUGUSTUS start_codon 2849091 2849093 . - 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MCFLSSLLLILSLILTTTMLNEHTSAPSSPQQSLTEWVQSRFSGLYEHPSPDTSDTNTTQSRIQSMFTPTAQIYLNHT # GPVPLEEFTKNLEQTFGTNKTEVEWKECFEVPDSNKEEKDDNHEVVEGEVSLCLWDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 Scaffold_4 AUGUSTUS gene 2851319 2851708 0.72 + . g540 Scaffold_4 AUGUSTUS transcript 2851319 2851708 0.72 + . g540.t1 Scaffold_4 AUGUSTUS start_codon 2851319 2851321 . + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_4 AUGUSTUS CDS 2851319 2851708 0.72 + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_4 AUGUSTUS stop_codon 2851706 2851708 . + 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MAFIVSLIATANILRILSTFFLVHAVPIGLGLGNSLSSRDDSYLDITQYLAAHNTIRAVHDAPLLIWSDDLAIGAQAW # ANACNFKHSDGVLSELPYGENMAAATGDFGINAAVESFMSDEGDFLYAPYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 Scaffold_4 AUGUSTUS gene 2864209 2865859 0.3 - . g541 Scaffold_4 AUGUSTUS transcript 2864209 2865859 0.3 - . g541.t1 Scaffold_4 AUGUSTUS stop_codon 2864209 2864211 . - 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_4 AUGUSTUS CDS 2864209 2865098 0.93 - 2 transcript_id "g541.t1"; gene_id "g541"; Scaffold_4 AUGUSTUS CDS 2865156 2865391 0.42 - 1 transcript_id "g541.t1"; gene_id "g541"; Scaffold_4 AUGUSTUS CDS 2865498 2865859 0.54 - 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_4 AUGUSTUS start_codon 2865857 2865859 . - 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MLKLTSPEALVKVLERTLYPTLDTLPAKPRSDIVEVLQKALKDTERVHELRTTIEYETRRKSLESQIKNLEKDAKRNW # KHGYEEQGEMMSEIATEVLEWLPDLWRIGVEEGIEIQAIQRCFAEFSDMDFELTIEDSDGQTIYKHRYQPVSDTVAWMWRELWISASASQSPFEAGIL # DDVESLNLKDSVLGLIRTGNLGQFEQEEGDEDDDEYQDAHWTPSMRAAASRVLDARHAARLVEFNTNLSTAVYNTLLQESPKIKPMLLDTLRKHVFGA # QTTNFSSNVYRSAAEIFAKDFPDDLPKLHDALPSWEKSFDIMQLFVKHFSTQESSTLREKGLQIIEQGFCDARSSVMSEIEDTFPGFDEAYDWLEERV # SEGKISKKEPQQRFGPEARKRDAFIDKFEDIAIRNRYGDSYSEEFGYWDDRDVGVDSDDSDYEEQMDIRQPDMSRPFLIWATALCEWPDKEEAQKLWE # RMNSSGDDDNLLFSVEGVADSLAGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 Scaffold_4 AUGUSTUS gene 2866622 2867156 0.66 + . g542 Scaffold_4 AUGUSTUS transcript 2866622 2867156 0.66 + . g542.t1 Scaffold_4 AUGUSTUS start_codon 2866622 2866624 . + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_4 AUGUSTUS CDS 2866622 2866631 0.68 + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_4 AUGUSTUS CDS 2866771 2867156 0.98 + 2 transcript_id "g542.t1"; gene_id "g542"; Scaffold_4 AUGUSTUS stop_codon 2867154 2867156 . + 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MSDVFNGVPSSCFPSSTGLGASFDVDLAYKVGIALGEECRAKGCHILLGPTVNTQRSPLGGRSFESFAEDPTLNGLIA # AAYINGVQSKGVSATIKHYVANDQEFERFSISSEHVFLNSTTDNNENLTVNLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 Scaffold_4 AUGUSTUS gene 2869556 2873214 0.37 + . g543 Scaffold_4 AUGUSTUS transcript 2869556 2873214 0.37 + . g543.t1 Scaffold_4 AUGUSTUS start_codon 2869556 2869558 . + 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_4 AUGUSTUS CDS 2869556 2869929 0.4 + 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_4 AUGUSTUS CDS 2870751 2873214 0.67 + 1 transcript_id "g543.t1"; gene_id "g543"; Scaffold_4 AUGUSTUS stop_codon 2873212 2873214 . + 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MFPFGFGLSYSAFEYSALNCSEISSEGKFTVTFTIKNTSSVYGREVAQIYIADDEASLPRPQRELKGFKKVALQAGES # QNVETELDREALGFFDERRGEWVAEKGVFSVLVGASSEDIKLKGSVDAKSTIEKAKVYTYSLPHPAFPDVHREDLIFIALCSGGDYGTGLDNCGIKIS # YGLARAGFGKQLCRAALNHDEKSEELRNFIRQWKLELAQELKTNASGFLPRKSPKLASTIPNSFPDIKVLLAYLRPVTSESLGRSERYDDLLVNDGGC # DGWLKKDPSLPLLAEKCEFYFEWGFLESIIKRFRTIIFHGITLRIMRRACILKPTCGAKSINLETICAHFAAGDHAIEDTESPTPEFIQDVSKTRTHE # STSNTLEYRVAIDPTILVQLATRGVKGIRRPDDKDEWAEFEEEVENDSSDNKKKEYPDPTLSLKLWLPAVLVKEAVPGLVETYEEMRRQKEEKKAGKG # RKVKVVEPKTKARPKPKPSASAATLATKSSSSQPILKTNQVDSSDDDMDYDSRLFISGRPAHSTTHPRKDHTGWISQFTLPDLSSSDYPSPSTSSVSP # PRKLKSAGSSSHTSHTHSHDLKLSLKFSQRDKGKQKATTVSRGNSLLSTIDAIATPKKNKKSDIRQMPRFGSSSPEKATPRPLPVSVENTFDEDSDDC # DYNGPFNFNHIHSPAPPGPPQTPSPQKKTRKANAVHSSASSASEENINPREDKVEVLNKSPRKSKDHRYPKGLDYGDFPNREQARKTIRDIPHPSRAA # RAASPTPMRRTPNKSTSASTVNKAAVSAHSPSLPLPSPLSSSSNRPLPPFAIAPTVVGPIIISDSEDEEQQPPKVIPIIAPQPKSRPRPKLKAATTSD # IPKSHPDHRLGRSGAFQAGRTEFSDTEDDDIPPLLRARARVKVADQPQYKVKAKAKVRTTTTTMTTTRTKTVVDIIELSDDSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 Scaffold_4 AUGUSTUS gene 2875995 2876546 0.86 + . g544 Scaffold_4 AUGUSTUS transcript 2875995 2876546 0.86 + . g544.t1 Scaffold_4 AUGUSTUS start_codon 2875995 2875997 . + 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_4 AUGUSTUS CDS 2875995 2876546 0.86 + 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_4 AUGUSTUS stop_codon 2876544 2876546 . + 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MRTVRYFFIQVLFLSNKYVSGDKYWNGDSAEDSPETLEQSGKPDIEVKDLAIRIYQTLKGQNIPESGKKYWLCVGSRC # LRANKDPKAPSDLLSDVIIGRGTLQKSKDCGEISFDDIEHKRQILAVFVKGQRHYFKDNSNPTNWDYLAALLRELRRESSGGPQLANQGEIEQYMQEE # AKKNLFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 Scaffold_4 AUGUSTUS gene 2878429 2879196 0.71 - . g545 Scaffold_4 AUGUSTUS transcript 2878429 2879196 0.71 - . g545.t1 Scaffold_4 AUGUSTUS stop_codon 2878429 2878431 . - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_4 AUGUSTUS CDS 2878429 2879196 0.71 - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_4 AUGUSTUS start_codon 2879194 2879196 . - 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MLVYDPAPGLFPVDFLCDTLWLTIFLSRSGFKSSGCQRSARSLRTTAAKDWSVVLPFFFFIRYLIPNADSDNSSDAGS # SSDNESSHEDDTEEPHPEFKNVPIRLWRTKNEDFHQWVDSKLATFKGEHWWLCVGKQCYRGDPDPHQDDPDPHQDDPDPHQEDMLVVNMIVISDNKDL # QNLQNSFLIGHISFLDLEHRKWALRTIRKGNLHFYETNLDFVKSEIAQLKRSNTDSKSVFMDTQFEASLAKMREMKNFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 Scaffold_4 AUGUSTUS gene 2888860 2889505 0.37 - . g546 Scaffold_4 AUGUSTUS transcript 2888860 2889505 0.37 - . g546.t1 Scaffold_4 AUGUSTUS stop_codon 2888860 2888862 . - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_4 AUGUSTUS CDS 2888860 2889093 0.96 - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_4 AUGUSTUS CDS 2889227 2889505 0.37 - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_4 AUGUSTUS start_codon 2889503 2889505 . - 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MSSLAEYRIAFGEEFRFEMIISTLKLPELNNAVVGDASPADGFGYGYEESDIWEARNAAMLLLNAIATATGSVEDRIM # LREEYGRRGLNEAIVFEDEETMRERVQRVLSRLADSNLEQSRLGSRSGTSESSLSDLLEDIIRLAKQHGELYPIMVDVLNHYGQLLVRDIGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 Scaffold_4 AUGUSTUS gene 2889676 2890212 0.94 - . g547 Scaffold_4 AUGUSTUS transcript 2889676 2890212 0.94 - . g547.t1 Scaffold_4 AUGUSTUS stop_codon 2889676 2889678 . - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_4 AUGUSTUS CDS 2889676 2890212 0.94 - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_4 AUGUSTUS start_codon 2890210 2890212 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MRRLSLTSWNNPSEETADQSSVTDSPQTQTATVIAPDPDPQPVASQSTGSLWSSLWILSGGDKSDKYSSDNDKKKTKP # AKWYVDQLKSGRLKGDRLQALVLGLRVQLSTVNLVWIQEFIEVEKGMDQLDVLLVDLVGKGPKSKVLSETNASTLLETAKCFRALLNTDVSLFVIGKF # NY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 Scaffold_4 AUGUSTUS gene 2892430 2895192 0.1 - . g548 Scaffold_4 AUGUSTUS transcript 2892430 2895192 0.1 - . g548.t1 Scaffold_4 AUGUSTUS stop_codon 2892430 2892432 . - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_4 AUGUSTUS CDS 2892430 2893110 0.66 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_4 AUGUSTUS CDS 2893305 2893792 0.75 - 2 transcript_id "g548.t1"; gene_id "g548"; Scaffold_4 AUGUSTUS CDS 2893971 2894193 0.6 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_4 AUGUSTUS CDS 2894271 2894561 0.24 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_4 AUGUSTUS CDS 2894710 2895192 0.44 - 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_4 AUGUSTUS start_codon 2895190 2895192 . - 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MSDGDLPDGSEGELVYVEQIHTMRAYELTTLYVDYGHILAKDDVLATAIQTQYYRFLPYLRRALHNLVAEFEPEYLKI # NPTAATTDSANLQSREFNIAFYHLPLVSGIRELRTHKIGTLMSISGTVTRTSEVRPELLFGSFVCEVCKGLVNDIEQQFKYTEENPSEIPTGSMPRSL # DVILRSELVERAKAGDKCVFTGTFIVVPDVSQLGLPGGENAQLQREANRGNSTSAGIGGGVTGLKSLGVRDLQYKTAFLACMGGTNIRGEEEVGEESG # QSFIQSLTEPEFDELKAMIDSDNIYQRLVESIAPTVYGHEIVKKGLLLQLMSGVHKQTASSAAGLTAAVVKDEETGDFTIEAGALMLADNGICAIDEF # DKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPIGGRYDRKKTLRANLQMSAPIMSRFDLFFVVLDECNEKTDRNIAEHIVNVHRYQD # EAINPEFSTETLQRYIRYARTFNPKNQLYFRGRVDSDLHTGTSMNSNTNLQITPAYVREAYTLLRQSIIHVEQDDVDFDEEELDGKRERLVAQDPSTE # AAEESQDVEMSGVDQSEESQQIDGGETSTVVNQTSSTAVAGQSSHADQVQQAAAATSSKRRMVISHDKYITLKSLIVYHLSEVERETLQGLDRDDLID # WYLETKEEEMQDIEDIEYEKELITKMLRKLVKVSDMDILSLVQTSLRYLSGKLPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 Scaffold_4 AUGUSTUS gene 2895706 2896110 0.43 + . g549 Scaffold_4 AUGUSTUS transcript 2895706 2896110 0.43 + . g549.t1 Scaffold_4 AUGUSTUS start_codon 2895706 2895708 . + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_4 AUGUSTUS CDS 2895706 2896110 0.43 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_4 AUGUSTUS stop_codon 2896108 2896110 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MKDLEPLDPSYVQEVLSQPPFTSIPGVINVRDLGGYPSMTHPGKSTKPGFMYRSAEVASITDEGDLILRIFFATLLNC # VGKEQVRRLGIKTVFDLRSDTEIKKYNAPLPTIEDVELLHVPVFQIEDYSPEMMAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 Scaffold_4 AUGUSTUS gene 2899062 2901737 0.28 - . g550 Scaffold_4 AUGUSTUS transcript 2899062 2901737 0.28 - . g550.t1 Scaffold_4 AUGUSTUS stop_codon 2899062 2899064 . - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_4 AUGUSTUS CDS 2899062 2899629 0.89 - 1 transcript_id "g550.t1"; gene_id "g550"; Scaffold_4 AUGUSTUS CDS 2899692 2900238 0.88 - 2 transcript_id "g550.t1"; gene_id "g550"; Scaffold_4 AUGUSTUS CDS 2900287 2900588 0.98 - 1 transcript_id "g550.t1"; gene_id "g550"; Scaffold_4 AUGUSTUS CDS 2900641 2900981 0.91 - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_4 AUGUSTUS CDS 2901043 2901364 0.59 - 1 transcript_id "g550.t1"; gene_id "g550"; Scaffold_4 AUGUSTUS CDS 2901544 2901737 0.42 - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_4 AUGUSTUS start_codon 2901735 2901737 . - 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MNLEPNKEEASAATLKEIKRQYFGRTDSEQASRDCYSQSTITYVTPCHPCSPCALDKLYVAPFYGQIRECHQQGDDRR # ISLIIDQLVDMFSNPNNALHVRNGGLIGLAGTAIALGVDVAPYMDKFVYPVLDCFVDPENRIRYFSAECLYNIAKVSKGEVLIYFNEIFDALSKLAAD # SELSVKNGAELLDRLLKDIVAESASVYIPIHAESEKPYNESQGVLVPHPVDPYSAKKAFSLAHFIPLLRERIYVVSPFTRSYLVSWITVLDSVPELEL # ISYLPEFLEGLLKYLSDPTEDVRVATEVLLADFLREIRDVTVVRKRSEKLAKSTHTVGDTESIVPSEGGQTEHSITDSPERAVFLADHDDAQYPDSEY # KEDRASDFDVRDAGSWVPGQGVKIDFPSIVEILIEQLDGERMSSAFPLLTHVDTQTDDEIQQSTALRWLAEFINFASEVMIPFTPRLIPAILPNLAHH # ASMIQTIAVRTNKLLLSVIQNLPSPPEVPARSQEKPPSTRVQASPTPTAVPAPTSSNSRQPTMAKDPSASLRDAASPETTGDTVSPPPMNANSSSASG # VRDSTGNLVLVRPQSPVSVLSHSNQNLQASITEEPDVFDYQATVNELTIQFLSEFEETRVAALKWLIMLHQKAPRKILAMDDGTFPALLKTLSDSSEE # VIKHDLQLLAQISSSSEENYFKAFMMNLLELFSTDRRLLETRGSLIIRQLCLNLNTERIYKAFAEILEKEDVSVNLFNEVRLLMFTLSIGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 Scaffold_4 AUGUSTUS gene 2903255 2903782 0.98 - . g551 Scaffold_4 AUGUSTUS transcript 2903255 2903782 0.98 - . g551.t1 Scaffold_4 AUGUSTUS stop_codon 2903255 2903257 . - 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_4 AUGUSTUS CDS 2903255 2903782 0.98 - 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_4 AUGUSTUS start_codon 2903780 2903782 . - 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MSREGRKIYDSATLLRRLNLAPIDLIAKEGLALVNGTAASAAVAALAIHDCHILALAAQVLAAYGNITRAHIFLAESV # PFLAVEAIKGSQEPFQPFLHDLSRPHKGQIEVAATIRHILKSSKLARIQHEESDPEGQLRQDTYCVRGSPQWIGPLLEDLMLAQDQIDIELNSTTGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 Scaffold_4 AUGUSTUS gene 2913819 2914525 0.29 + . g552 Scaffold_4 AUGUSTUS transcript 2913819 2914525 0.29 + . g552.t1 Scaffold_4 AUGUSTUS start_codon 2913819 2913821 . + 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_4 AUGUSTUS CDS 2913819 2913904 0.32 + 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_4 AUGUSTUS CDS 2914024 2914525 0.84 + 1 transcript_id "g552.t1"; gene_id "g552"; Scaffold_4 AUGUSTUS stop_codon 2914523 2914525 . + 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MGSAENRTQFVKAITDFATNYSLDGINFDFSSRGSNSVGANLTLSAATAITPFFDSKGNALTNVSAFADVFDFVTVMN # YDVWGSWSTGVGPNAPLNDSCAAKPNQQGSAVSAVAAWYTAGMPVDKIVLGVPSYGHSFSVNQTSAFVSSTELAAYPPFNATAFPLGDSWDTGATEPD # ACGLLENNGGTQDCGGRFM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 Scaffold_4 AUGUSTUS gene 2914580 2914894 0.55 + . g553 Scaffold_4 AUGUSTUS transcript 2914580 2914894 0.55 + . g553.t1 Scaffold_4 AUGUSTUS start_codon 2914580 2914582 . + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_4 AUGUSTUS CDS 2914580 2914894 0.55 + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_4 AUGUSTUS stop_codon 2914892 2914894 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MDILIPKETLLLNFLIDLMNAVKRYVAVDTRGFDPWIADITFQPYLYVEDAELMISFDNAESFTAKGNFIAEYGLAGF # AMWEAGGDFNDILLDAIRAAVGLDDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 Scaffold_4 AUGUSTUS gene 2918211 2918912 0.85 + . g554 Scaffold_4 AUGUSTUS transcript 2918211 2918912 0.85 + . g554.t1 Scaffold_4 AUGUSTUS start_codon 2918211 2918213 . + 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_4 AUGUSTUS CDS 2918211 2918912 0.85 + 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_4 AUGUSTUS stop_codon 2918910 2918912 . + 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MRGMTRESRPSRVISTSDSASAYRQLCKENQNLQERFDATIKANCAAEERRRKDYDKWTHFKSWILCVAELEQFKQYE # KEVGLDRVDRGDRAKELFRIVKGKKYKLSQLDSLEDQMREFFRSLSSTLFVNTLLAVFDLAEQDSNESRMVPTPASIIRTENTNTAKLPSLTPFSPSS # KANKPLNHDNLSPSPLFDPNTTVIPARRLIRQVPPPSHNFVPTCYNNIQVLCDQEYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 Scaffold_4 AUGUSTUS gene 2919585 2920970 0.39 + . g555 Scaffold_4 AUGUSTUS transcript 2919585 2920970 0.39 + . g555.t1 Scaffold_4 AUGUSTUS start_codon 2919585 2919587 . + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_4 AUGUSTUS CDS 2919585 2920228 0.49 + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_4 AUGUSTUS CDS 2920305 2920449 0.44 + 1 transcript_id "g555.t1"; gene_id "g555"; Scaffold_4 AUGUSTUS CDS 2920503 2920970 0.61 + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_4 AUGUSTUS stop_codon 2920968 2920970 . + 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MLASIRRNANAKASSSSSHADSSPPARRSPLSPLSPTPVSRIRRAISPILPELENEDRLDEQGSELPPTKYRKSTAGR # RIPSGSDNAAGKDDDRFRRKSAPSALTFEENEHANSSPSTMRHALVSRNKSRSRSRTTKGKEERDYDNYKENENTTTVDNKLQPSHSERRKSAGDRTT # SGLARAKARTGEVNVVASTSKSTPKGPLDDYLMYKGRGSREEDTAINGMYEINPAQNAGLEYQYDEVVRGREKRKRLLGEDCDDCREYYEAVGPMPPR # LQPPLWKSPVKDSHNPDPLSKRCPHHRVGGTMKKGSNNSEADDHIFGDLDSPSPSKRNQSSKRNQQIRSTPSTSAPGIAAHKQNISRHRAVWARGNTP # PAYWDIGFPDTQRAEEINESAREMQRKKKEMIEMEAAREDGRYRRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 Scaffold_4 AUGUSTUS gene 2922918 2923646 0.64 - . g556 Scaffold_4 AUGUSTUS transcript 2922918 2923646 0.64 - . g556.t1 Scaffold_4 AUGUSTUS stop_codon 2922918 2922920 . - 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_4 AUGUSTUS CDS 2922918 2923646 0.64 - 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_4 AUGUSTUS start_codon 2923644 2923646 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MNTPYTLHHSSDGRGQNPQQHHDANDAADERLGYKLGDGFWRFFKSHGSRIVVLEFGRISAGSQISPRQTLSPLSRLA # SRASHIAREGYAEGSEAPGYGYEYSYIRDVQEMEDRWIEAQVRDANREQVEAERLAEVEREREEFESWTKPFPPSAGAAAASSPMSSSFSSMSASSQN # LASLTPNLRTFICSASLSSSHDQDLTFNGLDAFDDAADAFDALEWDWTHLIGSLLILCYLVIQMCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 Scaffold_4 AUGUSTUS gene 2926434 2927908 0.32 - . g557 Scaffold_4 AUGUSTUS transcript 2926434 2927908 0.32 - . g557.t1 Scaffold_4 AUGUSTUS stop_codon 2926434 2926436 . - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_4 AUGUSTUS CDS 2926434 2926949 1 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_4 AUGUSTUS CDS 2927006 2927908 0.32 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_4 AUGUSTUS start_codon 2927906 2927908 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MKAYASIVRKSNEEDTPSPSSSLPELLPLPPISTAVNPFFDASRSSPMMNYSSFNQPPPSNQAQLAQLNQLASSSRPS # TPTSITPGSPAWLLPNQPPLPAPTRKMLHTRFHALLSIFDRTILRTFKSRYTQFLIFWYTSLDPEFADIFQGMLVDRALFQPADNGGNSAQTPIVTRA # AAASYIGSFVSRAKFVDREGARRVVGVLCEFLKAHLDSVESILKNSTSLSNNTRSLNTEALNVTGDQNTVFYAVAQALFLIFCFRWRDLLEDDEEPDD # MVSLRLQGTKTAAAGKKWMKQLDVVQRWFFADDYPKVCSPNVANQFARVAHATDFIYCYTILEFNRRSDASSGDGSVLHTLTHGHHLTAELNTFFPFD # PYKLPKSGVYIQEVYRDWTSVAIDEESDDDETSDSDEDTDQEPAHFSSDFGMPISISVAGDEAHENTDETAPGLGASFDAMSISPAKDGMNAAEQVLA # LA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 Scaffold_4 AUGUSTUS gene 2928905 2929246 0.95 - . g558 Scaffold_4 AUGUSTUS transcript 2928905 2929246 0.95 - . g558.t1 Scaffold_4 AUGUSTUS stop_codon 2928905 2928907 . - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_4 AUGUSTUS CDS 2928905 2929246 0.95 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_4 AUGUSTUS start_codon 2929244 2929246 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MDPHSRFSHFDNKRNPKAGPQSLSQKPRFMDNPIKPNLEDFASAKQQNRKSSAARESSASILVRRPFVTNSRVKQDEK # SRKDMYLAFVNNALQEKANVSSSNHQSSPWLDASI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 Scaffold_4 AUGUSTUS gene 2931945 2932595 0.65 + . g559 Scaffold_4 AUGUSTUS transcript 2931945 2932595 0.65 + . g559.t1 Scaffold_4 AUGUSTUS start_codon 2931945 2931947 . + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_4 AUGUSTUS CDS 2931945 2932595 0.65 + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_4 AUGUSTUS stop_codon 2932593 2932595 . + 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MSVDFHSSSDNHSPYFSPTVSYQASNSTGHQYLNSNMKPVPRLDIGIVDDMGHRYNSLSASTTSWSPSPSSMSIDTEA # LYLRSQQYGSPQSSTRSESSFINGFPCHCGTGPDDNDGRHLSGSDALYLDAMVHSDPNALTCTTVSPQILGLSFEQELTPLNFFNDPVLIPQGKTQVA # TERVLAASRRRRGQLKPGAKLLHCHMCQATFTAKHNLTSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 Scaffold_4 AUGUSTUS gene 2944226 2945304 0.72 + . g560 Scaffold_4 AUGUSTUS transcript 2944226 2945304 0.72 + . g560.t1 Scaffold_4 AUGUSTUS start_codon 2944226 2944228 . + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_4 AUGUSTUS CDS 2944226 2944480 1 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_4 AUGUSTUS CDS 2944564 2944705 0.72 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_4 AUGUSTUS CDS 2944754 2945304 0.72 + 2 transcript_id "g560.t1"; gene_id "g560"; Scaffold_4 AUGUSTUS stop_codon 2945302 2945304 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MANATASTATRNPFPFSHRPNTLDRDRVVIPSGWDSWGKIAVLREFEPTVWGEGWEADLESEGGEDVKNGAKKMYRDL # VPDLGTKPPPLPPFNSPIPEQSFLARNYDESTKKADRDPRGAFRNPVEGDGGAYGLNSTSGAGTGIVGPMGTNSFNLPNVEKLFMEMEGSPSDRSDKL # SSSLSDRPDRSDRLSSSLNERPSSGHDRRTRPTTNRPTMLTSTGASPPSGKGPSSPSPSSLSPSGISPTSGAQGAGGSGQSQHEVLQNFFQSLLSSKD # KKERERGAGSPSMGRPKSGMSNGSSKDKGERDKVDKDEGSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 Scaffold_4 AUGUSTUS gene 2946129 2946995 0.57 - . g561 Scaffold_4 AUGUSTUS transcript 2946129 2946995 0.57 - . g561.t1 Scaffold_4 AUGUSTUS stop_codon 2946129 2946131 . - 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_4 AUGUSTUS CDS 2946129 2946995 0.57 - 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_4 AUGUSTUS start_codon 2946993 2946995 . - 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MMETAGASSVLPSFAARSSSPAPIAPTDEVSAYSRSWVPPRSYLQSGSSLSRSSSLRRPTRSRTVDFNDFTSRRRSTI # RNTTSGATSSANTDATSNTASESRDRDSNSWLSPGATRRFFGLSRPRRSNPELNLWSDLPDGDDGLTIGDNTTVPYLPASSSSHGVILPPLSEAEISG # ERSTTSIPGSNLNPTFPRLRRGSLRRPESLLSRQASPAETVVIPDDYDSSRRAPSPPDISEYIVESFDRPRFGRGTFSSLPILIPEGGSEGGATYGTI # ETAAYPTPGSTVDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 Scaffold_4 AUGUSTUS gene 2955453 2957154 0.53 + . g562 Scaffold_4 AUGUSTUS transcript 2955453 2957154 0.53 + . g562.t1 Scaffold_4 AUGUSTUS start_codon 2955453 2955455 . + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_4 AUGUSTUS CDS 2955453 2956406 0.53 + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_4 AUGUSTUS CDS 2956564 2957154 1 + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_4 AUGUSTUS stop_codon 2957152 2957154 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MYLRRFSDEVPSPVSPVQSQDAPFIHELGPPNAPFMSESGHGHGNGHGQNSSPSNSVYNGSVGAHLASKGSNNDLSRS # RNNSLTFRAPFLSPASRPTSNIASNTWNPPTYPQTRPGSPTASSTALAFTQRHSGKQPFQSALLSEKIPKEDKPWLAKPAPRQRASYWFTLFGVFLGL # AGAALLCFFELRSLNLLDESQLCTVFFDDFTSGSLDTSIWSRTVELGGFGNGEFEIMTNKDENLKIENSQLYLIPTLTSASIGNTSAIFNGYTYDLGD # DCTTSNETACSVTSDSSTKTVIPPVQSARISTNGTYSLKYGRIQIMESRGNSITYPDQGVNYVRSSLNYAPLASLLSQSTMYGWWFTKRLDSSSWNTG # FHTYTLEWTDQWMRMYVDSRLQAMLDISLKSSKESFFNRAGYPSTAINSSSGDTVAVENIYDEAGGGWNAPFDQEFYLIIQLAVGGTSGWFPDGAGGK # MWTDGSTEAMYDFAEAQDEWYASWPTSEDDKALRVDWVKMWNMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 Scaffold_4 AUGUSTUS gene 2959800 2960777 0.7 + . g563 Scaffold_4 AUGUSTUS transcript 2959800 2960777 0.7 + . g563.t1 Scaffold_4 AUGUSTUS start_codon 2959800 2959802 . + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_4 AUGUSTUS CDS 2959800 2959951 0.78 + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_4 AUGUSTUS CDS 2960087 2960777 0.71 + 1 transcript_id "g563.t1"; gene_id "g563"; Scaffold_4 AUGUSTUS stop_codon 2960775 2960777 . + 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MKCSSAASALILASLSISAFETYAAPVSILDQNIPSVPSTPSTPNPVPFPPHFYTVGSRNSSLPEQREVSSCRRRRLG # DVVDKPPRSSRKSSKKTTEGPPEDPAKFVVTDPQAKKSPRKSSKDANERKSTNTHRHKKTHKSDPPVDAETIQSPIENSLDIQSQLSSPAPVIRKRPK # KSKHSAQNVDESLTTNESFEKSSTKPSSLTLSATSQRTHRKPKPKPIPPKPKKPNSDGYFYAQNTTAAFNSASSSSATNANAFAVNDGNFGGGNVAGI # GKPPGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 Scaffold_4 AUGUSTUS gene 2962808 2963164 0.39 + . g564 Scaffold_4 AUGUSTUS transcript 2962808 2963164 0.39 + . g564.t1 Scaffold_4 AUGUSTUS start_codon 2962808 2962810 . + 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_4 AUGUSTUS CDS 2962808 2963164 0.39 + 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_4 AUGUSTUS stop_codon 2963162 2963164 . + 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MLFGLSSVNPGDEVDNVHGRSMSVPPGFDESPTRERQRESLFAKYNDADAAAEFTVGQEDKLDAAGGFGSSGKLSVSK # SDPTVFKLSIEGKKVEFELSLVEYLENERNGHDSSDVGRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 Scaffold_4 AUGUSTUS gene 2964952 2965659 0.55 + . g565 Scaffold_4 AUGUSTUS transcript 2964952 2965659 0.55 + . g565.t1 Scaffold_4 AUGUSTUS start_codon 2964952 2964954 . + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_4 AUGUSTUS CDS 2964952 2965659 0.55 + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_4 AUGUSTUS stop_codon 2965657 2965659 . + 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MTCRYIHMTDLVDQMFPPIHRKWAPEFTDFNFWKPPMQEFPLPDFSPPSPALSARSDSSTFARIRNFSLVGTRQNNIP # KVAAAVAAASSRALDDEQPLRNMKLQQMSSFERLSSTLGFSGNGSSSSVLKDRRSDSPDTRSYSSSSYAGSEDEDDDDGWNGGRRERRRSTTSMPGSL # EDMNFGNDDDEEYVHDDPNDDYNEEYDPHGEDEVDEVAADDAFDEDLLAAGEMKNVPFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 Scaffold_4 AUGUSTUS gene 2965914 2966984 0.28 - . g566 Scaffold_4 AUGUSTUS transcript 2965914 2966984 0.28 - . g566.t1 Scaffold_4 AUGUSTUS stop_codon 2965914 2965916 . - 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_4 AUGUSTUS CDS 2965914 2966661 0.97 - 1 transcript_id "g566.t1"; gene_id "g566"; Scaffold_4 AUGUSTUS CDS 2966741 2966881 0.4 - 1 transcript_id "g566.t1"; gene_id "g566"; Scaffold_4 AUGUSTUS CDS 2966932 2966984 0.3 - 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_4 AUGUSTUS start_codon 2966982 2966984 . - 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MTAGVIQVSLQWAMFSLILVLYMIYYPPHLKYVNLGFEYDESLPLRLSKSTEKTKEWKTSIVVSCFIISITTGFLLAT # FPTSPSSSPSPSPDPIPIPSPDDSTIAHSVTQWATFLGVSSAILAAIQYIPQIAHTFRHKVVGALSIPMMCIQTPGAVLMVLSIALRPGTNWTSWATF # AVAGIMQGTLLVMCICWKIRQKRLGLDDFGHNIVEDTLSESYLSTTSSLANSGHRHPAADVDVPGLVVEDEDAVAVRVALANALESAVEGDVRSGGVR # EVREIPIHAYHEQDDENTPLLTTENKALLLLLAVGSDSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 Scaffold_4 AUGUSTUS gene 2969681 2970274 0.82 - . g567 Scaffold_4 AUGUSTUS transcript 2969681 2970274 0.82 - . g567.t1 Scaffold_4 AUGUSTUS stop_codon 2969681 2969683 . - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_4 AUGUSTUS CDS 2969681 2970274 0.82 - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_4 AUGUSTUS start_codon 2970272 2970274 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MPATQATALQQAQIHRLIVPLPQDWTPMSGIPLGQAQVSTDKNSNMGTSTTVQTLFDSADRLQHIYQAFELWDRMEQF # ALGLVNVVPGPNFQQGTRQGLLRAFPMPNLGPHLQPHPQELPTWPSQHDIQTQVDPNLPPVDSAWTLRPGDSLPSLRTQLKHAAFLRAWFEAHCRNHL # SSWSVVNQPYKINSFLNFLNQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 Scaffold_4 AUGUSTUS gene 2973893 2974501 1 + . g568 Scaffold_4 AUGUSTUS transcript 2973893 2974501 1 + . g568.t1 Scaffold_4 AUGUSTUS start_codon 2973893 2973895 . + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_4 AUGUSTUS CDS 2973893 2974501 1 + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_4 AUGUSTUS stop_codon 2974499 2974501 . + 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MLALSSPLPHSDGAGRWDDIVPALPSIDQLTADWEQLMLEYIHHITDTPLPGPNPPAPVSAVDRVTEPSQEVVVEQSP # EVPVAPVSSSSIGSQPQVPLFLPEQESPTSPSPPPPSPTLPPLFGSVVNLAIDLTGDDDELYKTEESRVARVSMTGEVVDLAPGQVSLRRIIVASPPL # PVVFLSNHPFLYLFSTLKLSLSSCLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 Scaffold_4 AUGUSTUS gene 2975063 2975428 0.63 - . g569 Scaffold_4 AUGUSTUS transcript 2975063 2975428 0.63 - . g569.t1 Scaffold_4 AUGUSTUS stop_codon 2975063 2975065 . - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_4 AUGUSTUS CDS 2975063 2975428 0.63 - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_4 AUGUSTUS start_codon 2975426 2975428 . - 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKVYAKYTDQKRQEAP # DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSHAY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 Scaffold_4 AUGUSTUS gene 2983011 2984492 0.49 + . g570 Scaffold_4 AUGUSTUS transcript 2983011 2984492 0.49 + . g570.t1 Scaffold_4 AUGUSTUS start_codon 2983011 2983013 . + 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_4 AUGUSTUS CDS 2983011 2983180 0.59 + 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_4 AUGUSTUS CDS 2983829 2983953 0.57 + 1 transcript_id "g570.t1"; gene_id "g570"; Scaffold_4 AUGUSTUS CDS 2984036 2984186 0.88 + 2 transcript_id "g570.t1"; gene_id "g570"; Scaffold_4 AUGUSTUS CDS 2984258 2984492 0.97 + 1 transcript_id "g570.t1"; gene_id "g570"; Scaffold_4 AUGUSTUS stop_codon 2984490 2984492 . + 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MPIHHKKDLDIARVAEPHLGTLQQHYCFIQRQEDETIPSRQQSLSFVGLPSIFMISCTPYPTTGSNKGSNKDEKSAVN # DVSPHLSKVHCHADSHVSSNLTHSKHINHALAQVVSTNLDTPPAPLESQAPNSLLLHSTFRQLNSNLTQNCRQDSGSDSSASDASFATAQSIPTTGSE # DTVVTPTEIAVPVPKTVKRATTPFTRGVTPRWKTKDTSLPRSVIHLIDSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 Scaffold_4 AUGUSTUS gene 2984720 2988143 0.03 - . g571 Scaffold_4 AUGUSTUS transcript 2984720 2988143 0.03 - . g571.t1 Scaffold_4 AUGUSTUS stop_codon 2984720 2984722 . - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_4 AUGUSTUS CDS 2984720 2985012 0.94 - 2 transcript_id "g571.t1"; gene_id "g571"; Scaffold_4 AUGUSTUS CDS 2985691 2985833 0.35 - 1 transcript_id "g571.t1"; gene_id "g571"; Scaffold_4 AUGUSTUS CDS 2985974 2986001 0.34 - 2 transcript_id "g571.t1"; gene_id "g571"; Scaffold_4 AUGUSTUS CDS 2986254 2986379 0.78 - 2 transcript_id "g571.t1"; gene_id "g571"; Scaffold_4 AUGUSTUS CDS 2986956 2987300 0.22 - 2 transcript_id "g571.t1"; gene_id "g571"; Scaffold_4 AUGUSTUS CDS 2987420 2988143 0.28 - 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_4 AUGUSTUS start_codon 2988141 2988143 . - 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN # VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFVETDASYIKGMLDNPSCGPNATINRWIEHVRNY # HFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPKKWLLRSCNPCNPQEADDIELDVQEALD # EERSYEIRRNHKLEAKNATCESSVGILVEKEKRMHIQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGLNISSMEGIHCLRDGTKGGSYIIAEMDG # TVLKEKVGAFRVLPHFTRNESIELPNNIHKLIDLTAKQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDKELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 Scaffold_4 AUGUSTUS gene 2988764 2990356 0.1 - . g572 Scaffold_4 AUGUSTUS transcript 2988764 2990356 0.1 - . g572.t1 Scaffold_4 AUGUSTUS stop_codon 2988764 2988766 . - 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_4 AUGUSTUS CDS 2988764 2989241 1 - 1 transcript_id "g572.t1"; gene_id "g572"; Scaffold_4 AUGUSTUS CDS 2989337 2989686 0.28 - 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_4 AUGUSTUS CDS 2989790 2990356 0.21 - 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_4 AUGUSTUS start_codon 2990354 2990356 . - 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE # EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE # ITISDPNSHKRVTVKMIKGKFSFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTI # GDKQVFCVWRDGVLGEFDDQLNNDQFNLNPINLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFE # KVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVERRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 Scaffold_4 AUGUSTUS gene 2990613 2991657 0.17 - . g573 Scaffold_4 AUGUSTUS transcript 2990613 2991657 0.17 - . g573.t1 Scaffold_4 AUGUSTUS stop_codon 2990613 2990615 . - 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_4 AUGUSTUS CDS 2990613 2990994 0.58 - 1 transcript_id "g573.t1"; gene_id "g573"; Scaffold_4 AUGUSTUS CDS 2991143 2991657 0.29 - 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_4 AUGUSTUS start_codon 2991655 2991657 . - 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVSVLVFD # GVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRD # RRIKLIVMDILQPIKLGMKSRDQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 Scaffold_4 AUGUSTUS gene 2991741 2992634 0.82 - . g574 Scaffold_4 AUGUSTUS transcript 2991741 2992634 0.82 - . g574.t1 Scaffold_4 AUGUSTUS stop_codon 2991741 2991743 . - 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_4 AUGUSTUS CDS 2991741 2992634 0.82 - 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_4 AUGUSTUS start_codon 2992632 2992634 . - 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 Scaffold_4 AUGUSTUS gene 2999986 3001218 0.23 + . g575 Scaffold_4 AUGUSTUS transcript 2999986 3001218 0.23 + . g575.t1 Scaffold_4 AUGUSTUS start_codon 2999986 2999988 . + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_4 AUGUSTUS CDS 2999986 3000278 0.65 + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_4 AUGUSTUS CDS 3000320 3000739 0.23 + 1 transcript_id "g575.t1"; gene_id "g575"; Scaffold_4 AUGUSTUS CDS 3000864 3001218 0.95 + 1 transcript_id "g575.t1"; gene_id "g575"; Scaffold_4 AUGUSTUS stop_codon 3001216 3001218 . + 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGVLAVPAVL # AVLVDLVDLVPQSLLTSPTSNELCWNSSRGSRVPLRPLVPSSPLSAALLTALNPRARSRSQSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDN # FGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAEAHQGRNGAFARAGDARRLPSRSSSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 Scaffold_4 AUGUSTUS gene 3012642 3013466 0.96 - . g576 Scaffold_4 AUGUSTUS transcript 3012642 3013466 0.96 - . g576.t1 Scaffold_4 AUGUSTUS stop_codon 3012642 3012644 . - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_4 AUGUSTUS CDS 3012642 3013466 0.96 - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_4 AUGUSTUS start_codon 3013464 3013466 . - 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MANITVRFPSGKLLLLPFYVTHLDSSCKAVLGYSFLSRYNLLIDWASQNITFCNTSHFDSPQMSVPSGTNTVDAKVAV # PLPELSLSVLPTILETPPGDSLRSRSCSRSRTLWAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVNIALVSAAVFNRACKDAGMEPILLCAIHSEVAA # RAADCSSTTPTVPPLPHSIPEEYAEFADVFDEIAADSLPEHRPYNLKIDLEEGASPPLGRIYPLSEKELVTLKDFIDNQLATGAITPSSSPHSALVLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 Scaffold_4 AUGUSTUS gene 3014691 3017779 0.32 - . g577 Scaffold_4 AUGUSTUS transcript 3014691 3017779 0.32 - . g577.t1 Scaffold_4 AUGUSTUS stop_codon 3014691 3014693 . - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_4 AUGUSTUS CDS 3014691 3015261 0.81 - 1 transcript_id "g577.t1"; gene_id "g577"; Scaffold_4 AUGUSTUS CDS 3017154 3017779 0.49 - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_4 AUGUSTUS start_codon 3017777 3017779 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MVEFVINSQTHLALGMFPFELTYRYLPLFNIPVGQCSGIPVVDNCIRILREARQDAGAALHLGKKQQKEGYEHGKRKA # HQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYCILEKVGPLDYCLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDELEYEVEDI # LDSQVRWKKLEYLVKWKGYDAGHNSWEPTPKPHGSAKEGLSLISSTPDLDSLLAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETKNIRKYN # IRFNTLAASTNWDSAALKWAYGRGLAERIKDEMAHLPEPAMLADYCQEVLCIDNRYWKCEETRKCEAGKPFIAWNPKKKGSSDFKDWFYCHALPDFAS # LPIIFLLTTSLYLPTVYPELPLSAFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 Scaffold_4 AUGUSTUS gene 3032215 3033756 0.4 - . g578 Scaffold_4 AUGUSTUS transcript 3032215 3033756 0.4 - . g578.t1 Scaffold_4 AUGUSTUS stop_codon 3032215 3032217 . - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_4 AUGUSTUS CDS 3032215 3032472 0.63 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_4 AUGUSTUS CDS 3032558 3032860 0.65 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_4 AUGUSTUS CDS 3032902 3033756 0.64 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_4 AUGUSTUS start_codon 3033754 3033756 . - 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MYFFTQPPAGARVDSEMPIYQFSDPELWRDWSFTDYYPDWRGIQAYFQYVDKKVGITRDVLFNSRVASAHWNDSVDRW # TVTTEDGRVFRGQFLSLCTGIGSKFHIPEFRGLDTFRGEVHHSSRWPEEYDFKGKKAGIIGTGATGVQIIQEIAPVVSHLTVFQRTPNLTLPMRQRKI # SEEEQKKLKDLYPILYGRRYQTFAGFPYDLDPKPVADTTPEERALAFEDQWEKGGFAFGLARIESYIPTKSSTTRCMLSGERRSEKGSLILNSRKSSH # QRDLHIRSESDPNVKLVDVNEAGIEEITPKGLKTSDGVEHELDVLVLATGFDMVTGGITSIDIRGQDGIPIKEKWAGGVQSYLGLASASYPNMFWIYG # PQSPSSFSNGPSSIHMKENNISSIVPTEEAQHAYSKHVDELGAAGLWLGAKTSWYLGTNIKGKKSQMLQFPTGIPAYAKLCNDSAAKAYDGFDMKQSP # A] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 Scaffold_4 AUGUSTUS gene 3035347 3036554 0.86 - . g579 Scaffold_4 AUGUSTUS transcript 3035347 3036554 0.86 - . g579.t1 Scaffold_4 AUGUSTUS stop_codon 3035347 3035349 . - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_4 AUGUSTUS CDS 3035347 3036349 0.94 - 1 transcript_id "g579.t1"; gene_id "g579"; Scaffold_4 AUGUSTUS CDS 3036421 3036554 0.89 - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_4 AUGUSTUS start_codon 3036552 3036554 . - 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MTATGEYDVIIVGAGFAGVHQLLNIRKLGLTVKIIEAGEDLAGTCFSSGARVDSPMAIYQYSDPDLWRDWSFTELYPD # WREIQAYFRYVDNKFDVKRDVLFNSRVVSAHWNDSVDRWTVTTEDGQLFQSQFISLCTGIASKYHLPELRGIESFKGEVHHSSRWPEKYNFEGKRVGV # IGTGATGVQIIQEIAPIVDYLTVFQRTPNLALPMRQRKVSVEEQARLKKELYPIFYGRRYQTFSGFLYDVDPKPIADTTPEELALGFEEKWAKGGLTF # WLGAYAELFSNKEFNDEAYAFWRKKVRERIPDPELQEKLAPMKPPHPFGVKRPSLEQRYFEVYSQRNVTLVDISKTAIEEITPNGLKTNNGVEHNLDV # WYLRQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 Scaffold_4 AUGUSTUS gene 3055434 3055934 0.96 + . g580 Scaffold_4 AUGUSTUS transcript 3055434 3055934 0.96 + . g580.t1 Scaffold_4 AUGUSTUS start_codon 3055434 3055436 . + 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_4 AUGUSTUS CDS 3055434 3055934 0.96 + 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_4 AUGUSTUS stop_codon 3055932 3055934 . + 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MVISSEGDRHAGANDDEENDHSNNLHRRRRDERSGSDSEDDPGKYGINGRQPPKKRMKTGGETDMHTSVTIYTTDDDD # EDEDGSGTSSESELDSVAEEEAEYDVDVIDVDAGMHVDVGKDAVVSEPVNMLTKAESKPLSNGGNEKKRSYWLSKGIVSGDVNIEGED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 Scaffold_4 AUGUSTUS gene 3057759 3059360 0.13 + . g581 Scaffold_4 AUGUSTUS transcript 3057759 3059360 0.13 + . g581.t1 Scaffold_4 AUGUSTUS start_codon 3057759 3057761 . + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_4 AUGUSTUS CDS 3057759 3058376 0.52 + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_4 AUGUSTUS CDS 3058462 3058710 0.18 + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_4 AUGUSTUS CDS 3058782 3059360 0.19 + 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_4 AUGUSTUS stop_codon 3059358 3059360 . + 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MKSSEVGIKPVEVQVLKEPAVKLEKVLYVTHDSFSVYLSLLISYRRNVTWSLPHDTGIEVRDLLKSMATLAYPGPSYK # NPYLDPSSRPDSPPLQLGPGSSLFYESGDGFVPFEPIFSRAQRPGFGRAKPKERNEGPVMQPIAKSQLFGIRKTKDKGKDVDADMDTKDLFALGLPPP # RSISQVVPRLSTVTVDEDEGFDLLKENMKIKRTTSSPAQASGASSLSSVTTPRSSQEVDELNLNLAISSPNTDLSPIKLLKESRMGESNLYFPSESIY # TFFAYFDAQISLSCLRLVISFDYSLTNPHPLFDPLSYAAFLLETLNKRNNRLSKKDEPLPPIFQDKIPEALPVPLSSLRNDLRSSPILDFDEPDVNPL # IDKTPMKAEAASIVKENFDDAASMAGQVGSTVAVDSLATGMRGTDNTADVDIFESELHAIFKDVQTEDPLGLIMREKLDPMKNGKEMLMEGGSFIFLD # LRNVNRLLLCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 Scaffold_4 AUGUSTUS gene 3059718 3061799 0.87 + . g582 Scaffold_4 AUGUSTUS transcript 3059718 3061799 0.87 + . g582.t1 Scaffold_4 AUGUSTUS start_codon 3059718 3059720 . + 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_4 AUGUSTUS CDS 3059718 3061799 0.87 + 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_4 AUGUSTUS stop_codon 3061797 3061799 . + 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MTKEQGLARVEELSERAEEACRVAENDNVNHNSDAESRAERIWTEWSHHGDQITSSVLLSRADVGKIDIVLSREERRR # SKGPGSSKVVERVADDCENGETAQLLDDPEEEERGVNSAERTAAVAGDFEGMAAVAEYHSRTSLTSAPANLNTQHLFNFTSDAAPPSQVYDAELSSRA # ETDFGIPSFLEESDIAIHTHDRALHADDQPLESFAAVQVLDEYLHTNQYGYEFVEEFGSDSDKENQDPSNPEAIAQVTDLEWDHSDTSLLLHGQRERP # NYQQDEDDRNRLAKRPRLYWEGDDRYQSREYRDDDGGPEVEDSGIGLLDYLSCSPARAVNMPPNATQDDQAYIVNRVLFEDNHPADDVNDERIQNYFD # LEDDPISTQLQNSDFVPLAFDSQPVPDAQSQQPWPPSTLQSAPRGSFSKKAAPFIIPFHDHSVGIAEFARLRARKLRTPPPAPEPPKPTTAESDSFEE # VIASKIAPEAIFDKNTLRLPGADRTLRTTAHWYMASMNLIQKQALVRSLRSGICGVGLVEREMLTGVDLIIDPHTAVIFTNLLALPSEVDVLINTICE # QSWRYDHLLVVFEAFVPSMSFKPDSAASAKESLSAYSPPVLKAIRKFRRDVSLAEACGNKREGCQVMTAFAETVQDAAVFARTFGDKAERRGDNATGL # WDSRAWLDDGVGEVSIDFKIFLPKFSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 Scaffold_4 AUGUSTUS gene 3070409 3071594 0.39 + . g583 Scaffold_4 AUGUSTUS transcript 3070409 3071594 0.39 + . g583.t1 Scaffold_4 AUGUSTUS start_codon 3070409 3070411 . + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_4 AUGUSTUS CDS 3070409 3070555 0.82 + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_4 AUGUSTUS CDS 3070677 3071594 0.43 + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_4 AUGUSTUS stop_codon 3071592 3071594 . + 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MELNELLVKSRGYEATVETCHILSQSIMEGIGDQVQPNKDGSMPGLHSQKGGVHSLCNLLSLVQPLHESFDCLGLWFD # ETDEVAWHDERTKSSESGGTVRTSERGLRSCGKRQSQAQTKSRAERIWALWSHRGDQVTSSVDVGKIDIMLSREERRRRLKGPVSSEMAERAADNCEG # METAQRLDEREEEDCDVDPVGGAVAVAGGFEEMVARSSLASAPADLNTQHSFNFTSDAAPPSQVYNAELFSRAETDFGIPSFLEKESNIAIHTHDRAL # HADDQPLESFAVQVLDEYPHTNQYGYEFVEEFGSDSDKENQNPSNPEAIAQVTDLEWDHSNNPFVATWSTRTSRLSTRRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 Scaffold_4 AUGUSTUS gene 3072315 3073609 0.25 + . g584 Scaffold_4 AUGUSTUS transcript 3072315 3073609 0.25 + . g584.t1 Scaffold_4 AUGUSTUS start_codon 3072315 3072317 . + 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_4 AUGUSTUS CDS 3072315 3072326 0.25 + 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_4 AUGUSTUS CDS 3072890 3073609 0.95 + 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_4 AUGUSTUS stop_codon 3073607 3073609 . + 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MLMIQKNADQTQHPTSPPLTTAGSSSSKPQSNVAALREKIAKFEKKGGVPVPRGSFGLGAPPSDSGQAKASRELYGNR # IPAPVKPQNTGGGSIRPQYTGGSLMQQFTGPANSTRSPSPLEGSTRSFSSPSPPLEPLRPIHTGRRATDFSKAMELARKAEIENQQVYDPRWRENSTS # PPPSSPPPIIANRRFSFLTEDPPAIIVSPQLDVPAVPDEALSSDLVCAHLFSLYKFFVHDMYTEGYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 Scaffold_4 AUGUSTUS gene 3073638 3075862 0.75 + . g585 Scaffold_4 AUGUSTUS transcript 3073638 3075862 0.75 + . g585.t1 Scaffold_4 AUGUSTUS start_codon 3073638 3073640 . + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_4 AUGUSTUS CDS 3073638 3074583 0.75 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_4 AUGUSTUS CDS 3074712 3075862 0.84 + 2 transcript_id "g585.t1"; gene_id "g585"; Scaffold_4 AUGUSTUS stop_codon 3075860 3075862 . + 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MQDMSPAAVDPSISLDSWHEESSPLIFIPPESASVVALETEVLQDTSFDNQSEVTEIPSSNVLLASVDSEAHEGVHES # SRRPEAVSSEVSVDPVEPLVLRVESRTSVKEHGNPSEQIKSTSIVTVADLHTEFSTFNSSDDLPVESLSSTSVVETEKKSLDASSATLQQEIEDVGGS # HHKLSDPLSTISTSISRVEDELPSPPPQWSTENDTAALNTKEARLLPPLSIPSPPPVIRDSFLARNIDDPSPRSSYTDSPGHLTLAHKISPLTSRGVP # MFLPGIRSPINVEAEATAQPNAPIAEPQHIVDIVPSAQSDTHTISPPGVEFGTVVVGDPSQRPVPKMAHPRSFSSSHTDSDFNPAFEGTKINNTFNAV # VRGKTRDDPASYSATFPRVNASTPQRRGGRPPTLEDPMSPGFGDLLSLVAQSAILEQKLMNGEYPDESVITNPIHNGATSAPPRPSMGVEERQAKETE # DQERYKDLLRRRPSTKSMKGRGSSDSRRKPSFSLRNPLARSKSANRKEDESDLGLGPAPPRSSKESSAAPNRSKSMYLTSSSQPSLSTIPPVPNIPSV # VSNNNNVYSDDIPPTPPPKSPSAKYLSSFRRFTSTRSQGASQRHSVSMSSEISSEDSVAVLTPPDNSPGFTGTGPLFQTRSRTQSGHRPGSVINVPWP # SVSPKKNQGSVSRATSLRVKCFVEGRSRALVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 Scaffold_4 AUGUSTUS gene 3091164 3092168 0.61 - . g586 Scaffold_4 AUGUSTUS transcript 3091164 3092168 0.61 - . g586.t1 Scaffold_4 AUGUSTUS stop_codon 3091164 3091166 . - 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_4 AUGUSTUS CDS 3091164 3092168 0.61 - 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_4 AUGUSTUS start_codon 3092166 3092168 . - 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MPKTQPFVRCRSTTASSGYSMIDAKSRVREHARNISRTSSKNATAAPTLYVFRIRSKRLSFGFQASISFTGFQQIPTK # NTNINLPSGPGPEPNAPLDRTFIGLSGGQIFHEMMLRHGVKHIFGYPGGAILPVFDAIYKSPYFDFILPRHEQGAGHMAEGYARVSGKPGVVLVTSGP # GATNVITPMQDALSDGVPLVVFSGQVATSAIGSDAFQEADVIGISRSCTKWNVMVKDISELPRRINEAFKIATSGRPGPVLVDLPKDVTAGILRTPLP # TRPPHWHQPWPSHESFTGFGSTDRRCFDSTGSCTNQPGSASLDLRRQWCSFITHGTQTPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 Scaffold_4 AUGUSTUS gene 3096715 3097287 0.97 + . g587 Scaffold_4 AUGUSTUS transcript 3096715 3097287 0.97 + . g587.t1 Scaffold_4 AUGUSTUS start_codon 3096715 3096717 . + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_4 AUGUSTUS CDS 3096715 3097287 0.97 + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_4 AUGUSTUS stop_codon 3097285 3097287 . + 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MSTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS # QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWEEFLKEFGQRFESVDPGMEARSEIKNLNKVKVRQSRNLLRSSRILGIGLECLTLIYENAS # SLPYFRRSDKISSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 Scaffold_4 AUGUSTUS gene 3099638 3101653 0.6 + . g588 Scaffold_4 AUGUSTUS transcript 3099638 3101653 0.6 + . g588.t1 Scaffold_4 AUGUSTUS start_codon 3099638 3099640 . + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_4 AUGUSTUS CDS 3099638 3101653 0.6 + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_4 AUGUSTUS stop_codon 3101651 3101653 . + 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREM # LAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNRQQTVLKPNHFTK # IAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFW # WPTLRSFVEKYVEGCETCARKKIQRHPRAVTQPLDVPLGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHALPCTSSITAEGVADIYYKEIFRLH # GLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLP # LFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDFVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLD # LPISLDRIHPVFHVDKLYPWKGNTINGEIPPPPEPVYLEDEDEPEYEVEEILDSRVRWKRLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHP # TAAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 Scaffold_4 AUGUSTUS gene 3102222 3102964 0.34 + . g589 Scaffold_4 AUGUSTUS transcript 3102222 3102964 0.34 + . g589.t1 Scaffold_4 AUGUSTUS start_codon 3102222 3102224 . + 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_4 AUGUSTUS CDS 3102222 3102448 0.35 + 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_4 AUGUSTUS CDS 3102583 3102964 0.86 + 1 transcript_id "g589.t1"; gene_id "g589"; Scaffold_4 AUGUSTUS stop_codon 3102962 3102964 . + 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQSDLAKANQR # FEPMDPGMEARSEIKNLRQSKGQTVAEFAEKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRN # SGYPPTHTAHTTPADPHAMDIDANPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 Scaffold_4 AUGUSTUS gene 3103034 3103321 0.72 + . g590 Scaffold_4 AUGUSTUS transcript 3103034 3103321 0.72 + . g590.t1 Scaffold_4 AUGUSTUS start_codon 3103034 3103036 . + 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_4 AUGUSTUS CDS 3103034 3103321 0.72 + 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_4 AUGUSTUS stop_codon 3103319 3103321 . + 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MSSKTAHTEKPPAVTVDAEDIWKQSAKTSSWDSDETEADASNLDANKYLLRDPHQFSLFPNESVQIASSTSTSAPAPV # AATPSPPNQDFPTRLVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 Scaffold_4 AUGUSTUS gene 3103753 3104601 0.91 + . g591 Scaffold_4 AUGUSTUS transcript 3103753 3104601 0.91 + . g591.t1 Scaffold_4 AUGUSTUS start_codon 3103753 3103755 . + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_4 AUGUSTUS CDS 3103753 3104601 0.91 + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_4 AUGUSTUS stop_codon 3104599 3104601 . + 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MDGLSDHQPRREDVILGLPWLRKVNPEIDWEKGRLSVKPPWVTIEEVPDEEISYSHLAAANTESPIPEPQTWNLPLNP # LTLRCHWKQPLKRVNQQWWKNRQHQIQANHKNSPGMGKAGILEEQTEEVWCAAGFTYSQQLAEEANRAKPVKTFEEMVPEQYRDFKKVFSESASEQLP # AHQPWDHAIDLIPGAPVTMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDLPETERVYCEELLPPLVADIISQAS # RGSIFHQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 Scaffold_4 AUGUSTUS gene 3105139 3105522 0.96 + . g592 Scaffold_4 AUGUSTUS transcript 3105139 3105522 0.96 + . g592.t1 Scaffold_4 AUGUSTUS start_codon 3105139 3105141 . + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_4 AUGUSTUS CDS 3105139 3105522 0.96 + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_4 AUGUSTUS stop_codon 3105520 3105522 . + 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MDTQQQAFDTLRKAFISAPILALWTPDRPTRIEVDASGFATGSALMQKQDDGQWHPVAFKSASMQPAERNYEIYDWEM # LAIIEALKDYPSPLTSSLITLTLNFGAQLKTSPAAKPAGLYTFHGLTST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 Scaffold_4 AUGUSTUS gene 3110799 3114440 0.24 - . g593 Scaffold_4 AUGUSTUS transcript 3110799 3114440 0.24 - . g593.t1 Scaffold_4 AUGUSTUS stop_codon 3110799 3110801 . - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_4 AUGUSTUS CDS 3110799 3112063 0.75 - 2 transcript_id "g593.t1"; gene_id "g593"; Scaffold_4 AUGUSTUS CDS 3113427 3113758 0.63 - 1 transcript_id "g593.t1"; gene_id "g593"; Scaffold_4 AUGUSTUS CDS 3114106 3114440 0.46 - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_4 AUGUSTUS start_codon 3114438 3114440 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRQLLELILQSPSHSPPYGKQPQRRAASESPRDPPPHFDLD # TGDHDDQDPPVDPDDPGADNNMTIWMTIPGFTACGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKY # NIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYLLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAINPVVAKVAVPLP # EPSPSVSPTILETPPGDSPCSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAV # DRSSTAPTVPPLHHSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPK # KDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNTPAAFQRFVNDIFSD # MLDVCVIVYLDDILIYSDTPEEHREHIKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSRRKFRQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 Scaffold_4 AUGUSTUS gene 3115209 3115895 0.41 + . g594 Scaffold_4 AUGUSTUS transcript 3115209 3115895 0.41 + . g594.t1 Scaffold_4 AUGUSTUS start_codon 3115209 3115211 . + 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_4 AUGUSTUS CDS 3115209 3115895 0.41 + 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_4 AUGUSTUS stop_codon 3115893 3115895 . + 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MAEFVINSRTHSALGMSPFELTYGYFPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYKQGKWKA # HQFKVGDFVWLSAEDINLQLSSEKPGDRQLGPYRILEKIGPLDYRLDLPISLDRIHPVFHVDKLYPWKGNAINGEIPPPPEPVYLEDEDEPEYEVEEI # LDSRVQWKRLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 Scaffold_4 AUGUSTUS gene 3115934 3116892 0.13 + . g595 Scaffold_4 AUGUSTUS transcript 3115934 3116892 0.13 + . g595.t1 Scaffold_4 AUGUSTUS start_codon 3115934 3115936 . + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_4 AUGUSTUS CDS 3115934 3115938 0.25 + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_4 AUGUSTUS CDS 3116050 3116501 0.36 + 1 transcript_id "g595.t1"; gene_id "g595"; Scaffold_4 AUGUSTUS CDS 3116561 3116892 0.58 + 2 transcript_id "g595.t1"; gene_id "g595"; Scaffold_4 AUGUSTUS stop_codon 3116890 3116892 . + 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MNNMLACRADSRFGSSSPGEHELLINVTNYPNSDWYFDYITYESLNNPAFNGEVLQAGNAELIDATNYSMITFDAGWS # DNINDTATNIPGSKHLQNLDIRLRSESSSQQIPVPKALKAVCSECFHCWEVLPTAFGPLAENTGFADEAILKFNGTSLSLYGDTSGNVSNTASYICKT # CMFARARVLAGERSPAPKAPRAKFQPCSGCFGCWEALSAAFGELAEKTGFADVSGRHSSAKPGYSAKHQEQIPADPSAESTESSML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 Scaffold_4 AUGUSTUS gene 3119755 3123879 0.62 + . g596 Scaffold_4 AUGUSTUS transcript 3119755 3123879 0.62 + . g596.t1 Scaffold_4 AUGUSTUS start_codon 3119755 3119757 . + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_4 AUGUSTUS CDS 3119755 3123879 0.62 + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_4 AUGUSTUS stop_codon 3123877 3123879 . + 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MPPVFSTVLNDTVTYAKWKPSGNGMPGSMSCGKITVETLETCKRDLRIFLTNNRKLAPSDYVSRCMNVWEDPRVSNWI # NQNRDDFEKLGFNEFFTVLRERVLEHDWQDSTFRKMRAVRMPDDLRTSVSDLAVQLLVLNNLLKGTPRFQSEESLKIMLIDATDPGLREAYNKEIEDH # AANLTHGIHSKDFDTFTRAFQVLDNSRHRQLDMARQMAEHMIRSRPASRANTPLTSSSAANVQNRRGGNPGGSSGLAGRLPPLTTNERRLLSDNEGCF # KCRSFFVKCRTSSNEHEFPLPVGNNYKELTSADVDTARKLRGPTPESNKKPRTNAIATISAVDEDDDDVVASIMPSAVLGNGTDSEEEVSAPFRVSHL # RWKCHVSGPKSVFPVLVNSLIDNGAHLALIHPDLVDRLGLPRRLLKHPEPVSAAFQPEHKQKTTQPLTEFVTLKVSSTDGSFTSRNVPFIVAPGLCTQ # LLLGLPWLTHNQIVIDYALHTCIHKPSSIDLLHPPSVHRTFSFKSKSIENVHSTLRKSGNQAKEARKGFLAELKDVCSTIRPKFPPSSISPTITATNV # IAAVRSRIESLATLATLQEHESRLKKKYYSIFEPIPHVDDLPTSVTAKIQLIDASKSISSRSYRCPRKFRAAWQTLIQKHLDSGKIRASDSPYASPSF # VIPKADPNALPRWVADYRQLNDNTVVDAHPLPRIDDILADCAKGKIWGKIDMTDSFFQTRMDEDSIKLTAITTPFGLYEWTVMPQGLKNSPAIHQRRV # TSALRHLIGKICYVYVDDIIIWSKNIEEHVANIEKVLLALRMARLYCNPKKCELFTFDVHFLGHSISTNGISADDKKVERILDWPKPQTLKELQAFLG # LVRYVSAFLPRLAELTDILTGLTSNCVDKQRLPWEPCHQKAFEDIKALVASRECLTVIDHDQLDTHQIFVTTDASDRCSGAVLSFGPTWETARPVSFD # SSTFKNAELNYPVHEKELLAIIRALKKWRVDLLGVPFVIMTDHRTLENFHSQPDLSRRQARWMEFFSQFDCKIVYVEGDRNTVADALSRRSDLCAEHT # HLDSSADAISGSRHPYAYCPDSDDNYDLPILCVVPDSCWSGAQALTLAPLPEWGSPPIAATLGISSDATLLQSIRDGYTTDTWCKDLPSMASSMPLIR # KDLESKLWYIGDRLIIPRVGNIREELFRLAHDNLGHFGFDKSYAALRESYYWPHMRRDLEKAYVPACDECQRNKSTTHKKTGPLHPLPVPKRRFSSVA # MDFIGPLPEDDGSNCILTITDRLGADICIVPCRTDLTASSCAQLFFDSWYCENGLPDDIVCDRDHLFISKFWEALRTLTGVRLRMSTSYHPETDGSSE # RSNKTVIQMLRYHVERNQKGWK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 Scaffold_4 AUGUSTUS gene 3123907 3124470 0.44 + . g597 Scaffold_4 AUGUSTUS transcript 3123907 3124470 0.44 + . g597.t1 Scaffold_4 AUGUSTUS start_codon 3123907 3123909 . + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_4 AUGUSTUS CDS 3123907 3124470 0.44 + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_4 AUGUSTUS stop_codon 3124468 3124470 . + 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MNTVNSSIGMSGFQLRSGFSPRLIPPLVPNLPPTSSEHEFDAHSFLTNIQVDVLEAQDCLLSAKLDQVRSHNRHRRAD # PAFQINDRVLLKTKHRKNEYKRKGEKRAAKFFPRYDGPYTITDVHPEFSAYTLDLPPNLNIFPTFHADELKLYTDNDPELFPNCEFPRPGPIVTENGL # LELQVDRILDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 Scaffold_4 AUGUSTUS gene 3136002 3137219 0.84 - . g598 Scaffold_4 AUGUSTUS transcript 3136002 3137219 0.84 - . g598.t1 Scaffold_4 AUGUSTUS stop_codon 3136002 3136004 . - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_4 AUGUSTUS CDS 3136002 3137219 0.84 - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_4 AUGUSTUS start_codon 3137217 3137219 . - 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MALRNDPDATPMPIGEAQAMGLVGPGVDPNPASVVASSTSSQNLQHFPRARPSTGNGRNSNWGDTGELGTPGRDIETR # ELREFWKAYMRTPLSGPGGGTVGGMLGGNIPGHHDMHILSPGGTSSGMNPGAPLGHPTTGAPSPYRRQRVSSLPSVKTPTAIFDEERYAAGFVGFNGP # YGAKYPQQPDSHLLHSHRVQPSHANHQQAHNVHYGAQPGGPTMHGNAEDLRSYEAAVLARKAPVNLSMEGLGGKMRRKAGGVIAKDNNSRMTPASASA # SPNLSSASHSQGSSSSPSSSSSADSSPAIPQALSHESSLHVQGGESASRRPSFKRGASQVLEKGGSGKLARRTSSSRYDSLDHEYDYGEHALLSPLDN # GGVDFFNSSSTSVFGVEADEFSWAGGLQASASS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 Scaffold_4 AUGUSTUS gene 3139814 3140796 0.66 - . g599 Scaffold_4 AUGUSTUS transcript 3139814 3140796 0.66 - . g599.t1 Scaffold_4 AUGUSTUS stop_codon 3139814 3139816 . - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_4 AUGUSTUS CDS 3139814 3140457 0.74 - 2 transcript_id "g599.t1"; gene_id "g599"; Scaffold_4 AUGUSTUS CDS 3140502 3140796 0.66 - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_4 AUGUSTUS start_codon 3140794 3140796 . - 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MKTAFLTTIVALACTVSAFVTPQVRDGSSSSSTIDDTTILNYALTLEYLESAFYTGALSNFSQDDFTNDGLPEWARGR # FEQIAAHEQAHVELLSNALGTVFNRSIVTYDCAYSPYTSPSSFAALSQLLEGVGVSAYAGAAQYITNKEYLTAAAVILSTEARHAAWIAGPVNKENPW # SGSLDTPLGLSVVYTLAAQFITGCPSSNPSLPVKAFPALTFDNASPGQATNVTADGVDAEGQYVAFFSGLATSFVQVQNGQVVVPNNSLAYAVLSSSN # TTADDSTITAGVAVLSFPFNSNGTSSSSTGDSSMNVVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 Scaffold_4 AUGUSTUS gene 3144540 3145244 0.56 + . g600 Scaffold_4 AUGUSTUS transcript 3144540 3145244 0.56 + . g600.t1 Scaffold_4 AUGUSTUS start_codon 3144540 3144542 . + 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_4 AUGUSTUS CDS 3144540 3145244 0.56 + 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_4 AUGUSTUS stop_codon 3145242 3145244 . + 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MLLLIWSPKPIVTRQSETYYRSHKSYDKPLPLTRLQDPATVDLSVVIPAYNETERLPIMLEQTISHLTSINEQRKKHN # SKNNKSSKAKLSSPSSRPRTFEVLIVDDGSTDGTSDASLALARSKYPDFDIKVVNMELNQGKGAAVRHGMLHSGGQQLLMVDADGASRFQDLERLWEG # MDEITGGDDAGEGVVVGSRAHMVKTEAVVKVSPFSVSFLVLGKNSQLLAFSDPLFVTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 Scaffold_4 AUGUSTUS gene 3163681 3164544 0.76 + . g601 Scaffold_4 AUGUSTUS transcript 3163681 3164544 0.76 + . g601.t1 Scaffold_4 AUGUSTUS start_codon 3163681 3163683 . + 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_4 AUGUSTUS CDS 3163681 3164544 0.76 + 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_4 AUGUSTUS stop_codon 3164542 3164544 . + 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 Scaffold_4 AUGUSTUS gene 3164599 3165207 0.63 + . g602 Scaffold_4 AUGUSTUS transcript 3164599 3165207 0.63 + . g602.t1 Scaffold_4 AUGUSTUS start_codon 3164599 3164601 . + 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_4 AUGUSTUS CDS 3164599 3165207 0.63 + 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_4 AUGUSTUS stop_codon 3165205 3165207 . + 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD # HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS # DRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 Scaffold_4 AUGUSTUS gene 3165237 3167271 0.32 + . g603 Scaffold_4 AUGUSTUS transcript 3165237 3167271 0.32 + . g603.t1 Scaffold_4 AUGUSTUS start_codon 3165237 3165239 . + 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_4 AUGUSTUS CDS 3165237 3166629 0.55 + 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_4 AUGUSTUS CDS 3166742 3167271 0.37 + 2 transcript_id "g603.t1"; gene_id "g603"; Scaffold_4 AUGUSTUS stop_codon 3167269 3167271 . + 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTDGYKRC # EQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGGSSLNPYERKFRRGDLL # NLYCKILVWGRIAINLNPQKPHRINVITKIPLKRSEMIIGINLKTLKELGREWFDMKYSKEELNLPKISTEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 Scaffold_4 AUGUSTUS gene 3168642 3169652 0.98 + . g604 Scaffold_4 AUGUSTUS transcript 3168642 3169652 0.98 + . g604.t1 Scaffold_4 AUGUSTUS start_codon 3168642 3168644 . + 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_4 AUGUSTUS CDS 3168642 3169652 0.98 + 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_4 AUGUSTUS stop_codon 3169650 3169652 . + 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKK # KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSR # ITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVF # SRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQKMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 Scaffold_4 AUGUSTUS gene 3169974 3171007 0.2 + . g605 Scaffold_4 AUGUSTUS transcript 3169974 3171007 0.2 + . g605.t1 Scaffold_4 AUGUSTUS start_codon 3169974 3169976 . + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_4 AUGUSTUS CDS 3169974 3170638 0.36 + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_4 AUGUSTUS CDS 3170716 3171007 0.36 + 1 transcript_id "g605.t1"; gene_id "g605"; Scaffold_4 AUGUSTUS stop_codon 3171005 3171007 . + 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQ # LDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 Scaffold_4 AUGUSTUS gene 3173836 3174459 0.25 - . g606 Scaffold_4 AUGUSTUS transcript 3173836 3174459 0.25 - . g606.t1 Scaffold_4 AUGUSTUS stop_codon 3173836 3173838 . - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_4 AUGUSTUS CDS 3173836 3174350 0.75 - 2 transcript_id "g606.t1"; gene_id "g606"; Scaffold_4 AUGUSTUS CDS 3174411 3174459 0.25 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_4 AUGUSTUS start_codon 3174457 3174459 . - 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MNALNALHVATTSSTLNLTSSLRRAQELRMQLDGLGTLFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESIS # VEDWTVLATLFQWSSPFNLNGLNFDNRTPAEWIDLLRSLHSGASSATVTADGHLVDASQPPAAAVEVSEALDPQGSPPSTVIEQTSGVENLASLSEGS # PIQTELDLPQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 Scaffold_4 AUGUSTUS gene 3180523 3181869 0.14 - . g607 Scaffold_4 AUGUSTUS transcript 3180523 3181869 0.14 - . g607.t1 Scaffold_4 AUGUSTUS stop_codon 3180523 3180525 . - 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_4 AUGUSTUS CDS 3180523 3180687 0.96 - 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_4 AUGUSTUS CDS 3180771 3181167 0.79 - 1 transcript_id "g607.t1"; gene_id "g607"; Scaffold_4 AUGUSTUS CDS 3181293 3181719 0.45 - 2 transcript_id "g607.t1"; gene_id "g607"; Scaffold_4 AUGUSTUS CDS 3181836 3181869 0.39 - 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_4 AUGUSTUS start_codon 3181867 3181869 . - 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MEENNNLSIAPSIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG # DPSGPGGPGGPGGPGGPGGPGGPVLLSLLTSPTSNVLCWNSSRGSRAPLRPLVPSSPLSAVPLTALNPRARSRSQSGSAKEWFVPDILDPDLDSLPAW # TSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYVKKFFVLTIV # IGNARKLESVRLPSGSSAPFTPKLLRSCTPCNRAKATRCLSAEDEWDSSEVINNTAVTPLVPGDRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 Scaffold_4 AUGUSTUS gene 3190353 3191029 0.42 - . g608 Scaffold_4 AUGUSTUS transcript 3190353 3191029 0.42 - . g608.t1 Scaffold_4 AUGUSTUS stop_codon 3190353 3190355 . - 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_4 AUGUSTUS CDS 3190353 3190907 0.8 - 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_4 AUGUSTUS CDS 3191000 3191029 0.42 - 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_4 AUGUSTUS start_codon 3191027 3191029 . - 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MVLSKLQLVLVSNQLALKLLFTFDRTSTQVTDSTSLITSTSTETSLTSTLSSSTDSGASMSITSLTTTTTSSSSSLLS # ESSTSQSESTSTSTTTLSSVSSSTTSTSTDTTESTSTATFFVTSTLPPSSATSSTSSSSSGLVVTITSSDVVPSTSASATASTLGTNNAIATYGGSIP # SVLVLIWGGALFGAALGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 Scaffold_4 AUGUSTUS gene 3202008 3202568 1 - . g609 Scaffold_4 AUGUSTUS transcript 3202008 3202568 1 - . g609.t1 Scaffold_4 AUGUSTUS stop_codon 3202008 3202010 . - 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_4 AUGUSTUS CDS 3202008 3202568 1 - 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_4 AUGUSTUS start_codon 3202566 3202568 . - 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MSDKSLHVGDLLVVLFARSHPPDTFHWAICVPITPKEALKFHAKETGGHWFFEDNPVPKHALLSDATVSASIKIGEYT # LKFTETNSHKVIHGYEPGELKSISSVNDLQSLFKSIPLAVPVVDAAAEPVFRCRVWFKEAVRQLHAHGYIQCIDVNDLEVECKSLARLNDPSQSSYAG # YKYYESSKSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 Scaffold_4 AUGUSTUS gene 3203424 3203912 0.83 - . g610 Scaffold_4 AUGUSTUS transcript 3203424 3203912 0.83 - . g610.t1 Scaffold_4 AUGUSTUS stop_codon 3203424 3203426 . - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_4 AUGUSTUS CDS 3203424 3203912 0.83 - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_4 AUGUSTUS start_codon 3203910 3203912 . - 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MWDSRVSTHERSRSLFCDWVMNIRNFEEGVILEAKDTTDTGDESIIGSKSWYDPPPPWEYKEPVSLPYPVSVSISRLA # ADEGDISSAWRIADHYHYSDLSGSVSNLGPKQSCEPCMKDAILVPLISTLQASKQDDGREPDYKYTPPTTPGLFSILILSGTPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 Scaffold_4 AUGUSTUS gene 3216025 3216654 0.51 - . g611 Scaffold_4 AUGUSTUS transcript 3216025 3216654 0.51 - . g611.t1 Scaffold_4 AUGUSTUS stop_codon 3216025 3216027 . - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_4 AUGUSTUS CDS 3216025 3216654 0.51 - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_4 AUGUSTUS start_codon 3216652 3216654 . - 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MLEKARMSGFIEQPSDSEDEPGSDADLRNVIQGFTDGGRSASATGHERDVEPEAALDRRRSLEALQNYYNSYDIGSTR # KKSPTRQISPRPSFSRSASEEDLSDDRSRYTSDDKHSMYKTNNASQARSLASGWADDHRWSMSVDGESRASFMDAEKSDEARERFIRRIEGMFDQNGR # ELPPNLGTGRNAIIPPVPKLPQGLQGSSSKTWI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 Scaffold_4 AUGUSTUS gene 3217239 3218285 1 - . g612 Scaffold_4 AUGUSTUS transcript 3217239 3218285 1 - . g612.t1 Scaffold_4 AUGUSTUS stop_codon 3217239 3217241 . - 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_4 AUGUSTUS CDS 3217239 3218285 1 - 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_4 AUGUSTUS start_codon 3218283 3218285 . - 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MVDKRENDEKRRKKNDSEPGLDAGYFTGYETDATSTRTKLKKKKTKIKKMSGDGYETDDGSSHPPLRKSKSKSRFFKL # GNRSKPNVDEDESTQAPAEVPPPPPPLPAPAFRLPIAAMFATTLNLNVENAVLEPPIGPLGFSRPQSPTVASMSPSLASSESATILQNQKNGYDVESL # VGVHEPSIMAVNTTSSSPSKRTIIRFASDSSDNHGTTSSSNGHSFLSRLTNVSSSSASTTGSVTSPNLKSLNISYPLTRSPSPPSPPFKTQPMVAPTS # GLDRSNTKRAPRPLFLNRIPSSQKKSTSNSGDNSPSDWSPAGSPFVVLTPNPASSSASGGRPGISYHDFRGTPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 Scaffold_4 AUGUSTUS gene 3219320 3220283 0.28 - . g613 Scaffold_4 AUGUSTUS transcript 3219320 3220283 0.28 - . g613.t1 Scaffold_4 AUGUSTUS stop_codon 3219320 3219322 . - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_4 AUGUSTUS CDS 3219320 3220171 0.96 - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_4 AUGUSTUS CDS 3220224 3220283 0.28 - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_4 AUGUSTUS start_codon 3220281 3220283 . - 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MILFLWILVLSQLVWGAMVRVAVDEVEETSPTINNTAINSPVPVTGSISLVTTSAIGTAQGPSSDISTGSLNSDNFQL # ASIIGESVGGAVALGGFIVITLILRRTARQLGWPGNSPRHDLERGHGGYGTGDPGRKKPSPLSLGKQRATDPGGGDQEFMLQTLDYGFDDSRGSRNQY # TSNPDTPFEVGLSSRARTGPRPNPRLLYPSNLSGRESERSSNIDINALAKEVAKILMQPPAAPSSIAGDTIQVDDWSEQQMLKGDRGRQDGTCSGVID # DMSRDTHSPAPPLYQSCQSIHNMKFRSML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 Scaffold_4 AUGUSTUS gene 3224673 3225305 0.95 + . g614 Scaffold_4 AUGUSTUS transcript 3224673 3225305 0.95 + . g614.t1 Scaffold_4 AUGUSTUS start_codon 3224673 3224675 . + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_4 AUGUSTUS CDS 3224673 3225305 0.95 + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_4 AUGUSTUS stop_codon 3225303 3225305 . + 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MSYDSSLLAAAPQATREMRQEGYNPYILDQEQKQSNASSAPVVGGSANDLTSKEYPPNSNLHNPSALPKTPFYRTRKG # IIIIAISFIIAAVIGGAVGGTSHKSHTLSTVSSSSSASTDSQAVQGASTNTASSATATITTTLTTVIQSATQPGGAIGPVTTTITSTITESAAPTNTG # SANTNGVGNGNQDVNSSGFVGSKRRLSRVVKRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 Scaffold_4 AUGUSTUS gene 3231090 3233351 1 - . g615 Scaffold_4 AUGUSTUS transcript 3231090 3233351 1 - . g615.t1 Scaffold_4 AUGUSTUS stop_codon 3231090 3231092 . - 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_4 AUGUSTUS CDS 3231090 3232908 1 - 1 transcript_id "g615.t1"; gene_id "g615"; Scaffold_4 AUGUSTUS CDS 3232963 3233351 1 - 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_4 AUGUSTUS start_codon 3233349 3233351 . - 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MASTISLTTQKVTIPHIPELYDSNFLDVLLPPSKDDVVMDIGTPTPTNAMMDALQATTHHTYTENGAPALSSTGSPTV # DAFSGLNSYSNAKNLDVLLTKSWQEDPGLTLRLIWQLRSIHDGKSQKEGFYRAFGWLYKKHPRTAIANLHMLVRPVCSNKKRPEFSLSHGYWKDLLNI # LALATTGELDAMNATFLHHPRNPYTYPRDKPKEKLTSEAHERHNAEAQARAKARRTSVGEERHGILKRRLEDPNYRALYVMVTRLFVEQLIKDMRVVR # ELQQLPPNENRIPLLKKLSLAAKWAPSSGASHDRVTNISTAIALLLHHSRSQISQPFPSALSTFDTAQFANPELATDQYTILRSYLNRWVLIPIRSLL # LLPEPLMCSNRWSEIRYNRVASVCMKNNTEHFFQHDPDRFQQYLIDVESGEEDNQWCDATSSPIVTEVVKINTILHNTRPESLSKYPKLQNFKKELAE # TKLRVLEAQWKSLVERVKESGSLENSLAICDVSGSMGLLAPAGSTSRDPSPIAPAISLSLLLARLAKPPFNQGFITFSASPKFVTLDPSLGLARTIEI # MKGSDWGMNTDFNAVFLNLLLPLALKNKIPKEEMIKQLFVFSDMQFDVARHQSSGNASEKGDDWKTNHDHIADAYAKAGYDMPRIVYWDLAGYGTSEV # TVEREGVALMNGFSPSMLKVFMGEEDELEDGWEKVGKTKDEVDSENFNPMNVMKRSVMKPSFDGLVVID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 Scaffold_4 AUGUSTUS gene 3235263 3236146 0.95 - . g616 Scaffold_4 AUGUSTUS transcript 3235263 3236146 0.95 - . g616.t1 Scaffold_4 AUGUSTUS stop_codon 3235263 3235265 . - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_4 AUGUSTUS CDS 3235263 3235670 1 - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_4 AUGUSTUS CDS 3235743 3235917 0.99 - 1 transcript_id "g616.t1"; gene_id "g616"; Scaffold_4 AUGUSTUS CDS 3235995 3236146 0.95 - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_4 AUGUSTUS start_codon 3236144 3236146 . - 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MQPSASGIEGVKLIKGELATSGDLLMNEEKFLKRRPEDVPVDQVGSSHARAEKHTKSSNEDSEVDSDADSDGGGEMDL # TGDEAEIARDDEASDEEEEEGSELDEEEVWKASMPKVLADDDDLMNDSDVDPDGDDSDERSSLNDEDLQDEDVEEDSDNELSLVEGSDNEDLISLNDD # GLIEYDGSDAEVGDAEEWDGIGIDSAKSNKRKRNDEEKKRRKKLKSLPTFASYEDYAKMIEDGPEDDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 Scaffold_4 AUGUSTUS gene 3236987 3237598 0.78 - . g617 Scaffold_4 AUGUSTUS transcript 3236987 3237598 0.78 - . g617.t1 Scaffold_4 AUGUSTUS stop_codon 3236987 3236989 . - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_4 AUGUSTUS CDS 3236987 3237598 0.78 - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_4 AUGUSTUS start_codon 3237596 3237598 . - 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MKGVVVREITALVLRPAAPTAAATMLAAAAFAATTSQLPANIASRKIRFAEDDTPAPTASSATSKSKGKVATTEKKQV # NVHARYYATITFNQIVLTPADRDVALKLIDVYFEMFKELLGEGKISEEGGVVEDGDEIAEVKTDKNGRVFNGKQSKGKGKGKIKEIKGAAGFGEIEDE # NSKLISAILTGVNRALPFAKIDAKDVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 Scaffold_4 AUGUSTUS gene 3238012 3238960 0.98 - . g618 Scaffold_4 AUGUSTUS transcript 3238012 3238960 0.98 - . g618.t1 Scaffold_4 AUGUSTUS stop_codon 3238012 3238014 . - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_4 AUGUSTUS CDS 3238012 3238673 0.99 - 2 transcript_id "g618.t1"; gene_id "g618"; Scaffold_4 AUGUSTUS CDS 3238756 3238960 0.99 - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_4 AUGUSTUS start_codon 3238958 3238960 . - 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MVLSRKHTGHKVEIDSRASITTGKAKKTSKKNAVLKEQIQSLGGTAEDYELVRDVDEDMDSGSIAVDAKGLNFNLPEL # PQERPDPKSSKKLPPSKAEVPSIVEPSSIPKIKKPGKERTRKDTPSKTPSKAPAIDAKSQTELANKVVFNPASRFIVPPASQWYNAVSRLNVETALPT # ITPAQLNSFHTRAAELHTEDMKTFTSSSSGSSSASEASFLSKIIQSGTLSDRLSALTLLVQSSPVHNLKALETLKGMSERGKGQGGREESLKALRCVV # DWWVGGGAPERKLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 Scaffold_4 AUGUSTUS gene 3242340 3243113 0.99 - . g619 Scaffold_4 AUGUSTUS transcript 3242340 3243113 0.99 - . g619.t1 Scaffold_4 AUGUSTUS stop_codon 3242340 3242342 . - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_4 AUGUSTUS CDS 3242340 3243113 0.99 - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_4 AUGUSTUS start_codon 3243111 3243113 . - 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MWSSNFIRIKQVEGLNVDQVWHTLTTTQREQLALSLADLWSQLMLQTFNQIGSLYECPEGQFAVGPMTFLPSKNHYAI # APPDRAKCGPFNTAKEWLEATARQELAYRLSLSPQPDASSRINSVLDLIRVSEDLESSIKWEASRLSIEHVDYSTHNVLVSPVDPTKIMAVIDWEGAR # IVPMWAMNPAFRWPHDSDELEIRHLKALMRDRICSQVPGWSSAIGNECRPLRVLCMKATLSDRNPDLINPDGYPLDMSPDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 Scaffold_4 AUGUSTUS gene 3248773 3250640 0.39 + . g620 Scaffold_4 AUGUSTUS transcript 3248773 3250640 0.39 + . g620.t1 Scaffold_4 AUGUSTUS start_codon 3248773 3248775 . + 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_4 AUGUSTUS CDS 3248773 3248969 0.4 + 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_4 AUGUSTUS CDS 3249122 3250640 0.52 + 1 transcript_id "g620.t1"; gene_id "g620"; Scaffold_4 AUGUSTUS stop_codon 3250638 3250640 . + 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MSSVGFGKSPESAMVDEIFNNPDVWSIQFDEERNADSAGAVDSGEGFIFILGYILNQISRPQFREYARVPEGYHLKRR # SKLQLEAFTLRPFESRHRIMPYLSSASSMSDSSSIASSTPSLNSSLPTISDEDSLRSNLKSVKAPVKWRGMQDIDEGPHSSLSLVALMESSNNISPEA # GERMSILWSHQNIFRALPTPKGVEYSFREESPSSSQPSAESIGSTMHAVTRAFPLLETQGDSSQPGVMKPRRNVPPLTISTTTRTTTTTITQVVTIQS # PAKSSPASITVVSASATWSILELYGDSPKPSPKLPKLPKTSGHLDRSFKPSDLQFPSRPRLPPKSAFASNFPSGQLQSELTSRIVELPANFVNPDLRP # KLKGASSQMKSDVVKKDAALSGSRKNGKVRPLPQVPRDHSPPPPVPMIPFKVTSPPTTMIVSAAVGASNPSFGSLPSDSESRSTLGHPSASPFPRSHK # AHSDVASSEASLRTKKSALRTRMPPPPPLPLDSPLPALPANAIQELQGPIEGLKIIEPLAIPIMQQSKAPENKADEVKETGKGSSCSILVPHDRSSVH # LSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 Scaffold_4 AUGUSTUS gene 3251679 3252692 0.44 + . g621 Scaffold_4 AUGUSTUS transcript 3251679 3252692 0.44 + . g621.t1 Scaffold_4 AUGUSTUS start_codon 3251679 3251681 . + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_4 AUGUSTUS CDS 3251679 3252692 0.44 + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_4 AUGUSTUS stop_codon 3252690 3252692 . + 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MSLHRLRIGVIPRQHQKEGSNVLLKHTDRNQVPPSAVPRPSHKKNASTSALHQKTDAGNRSIKKVSSHSSLRSPDTLA # LAPDLAGRFRNGSSSMRRPIILDVPLPDARMLAQRMKAPSATSSRPYGEVSDAFTPSTISADVDSVLPQTRFNQVSSIEDQILLAAPEPIVATTSWVF # LPSERLTESISPPIQANSVPKNDLLTESNKEASKAVSRRSRSVSGARTPKAPLPPLPSHVVRGSPLHPVPNSDSVSRTPSPGPSILIRSKVASPAPST # MHVRFQSINKHPFPAVAVPIVKAELEKSLDRWKAIVVVNRRIQKVVPPQGRSASVLPPSRETI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 Scaffold_4 AUGUSTUS gene 3259696 3261042 1 - . g622 Scaffold_4 AUGUSTUS transcript 3259696 3261042 1 - . g622.t1 Scaffold_4 AUGUSTUS stop_codon 3259696 3259698 . - 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_4 AUGUSTUS CDS 3259696 3261042 1 - 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_4 AUGUSTUS start_codon 3261040 3261042 . - 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MILEQFLKNVLIYVLVKIQSPVVPDIEDAILKHPEASHQAKKESRIQDLRRYFGSPPSDPSQPAYKPFANHRCSISIK # DPASSKARLSLRPLSFLSVIKKRHAKTKPPTRDQPDPYVTHSSHGFSDTNRRASIRLWRIADAVVGAHPRAEPLHARLSVHGGVLYVGDSRLVSDNGL # GIPWYQPANKESVIIIPAIARGASMKSVGSTSITSTGSERAPNADPDSMANTNLAPRNISIAKPSTCNQTSAELNVTLVSNSQVVQPVLATPNSSEPM # TYFAQVNSESPSSPTSCHPAESIISIPVSEVNSSNSNKDSEIVSTQSVEIALNAKSHHNRRMKTKAIPSNWEERVPGLVTIAPLPAYSEISKKESKSS # VTTTKKSSNFGTYKGPRPELKVVTNRPIELDECHKSDVKNSSRGLSTRLRASRNRKLTPDGKENLSMSMGSTNAAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 Scaffold_4 AUGUSTUS gene 3264567 3264899 0.65 + . g623 Scaffold_4 AUGUSTUS transcript 3264567 3264899 0.65 + . g623.t1 Scaffold_4 AUGUSTUS start_codon 3264567 3264569 . + 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_4 AUGUSTUS CDS 3264567 3264899 0.65 + 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_4 AUGUSTUS stop_codon 3264897 3264899 . + 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MQEKFARLFDDAPQIPYSDVLHVFKSEFGRPPCGPDGVFEIFEEQAIASASIAQVHRAKLRPLPGDTEGKWVAVKIQK # PDVAKQMKWDLGAYRFVMYMFEKWAFDLPCTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 Scaffold_4 AUGUSTUS gene 3270614 3271822 0.56 + . g624 Scaffold_4 AUGUSTUS transcript 3270614 3271822 0.56 + . g624.t1 Scaffold_4 AUGUSTUS start_codon 3270614 3270616 . + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_4 AUGUSTUS CDS 3270614 3270946 0.97 + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_4 AUGUSTUS CDS 3271307 3271822 0.58 + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_4 AUGUSTUS stop_codon 3271820 3271822 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MANSYNPIAVESAWYDWWNAQGFFSPRFTTEGNVRPEGLFVIPAPPPNVTGSLHIGHALTTAIQDGLVRWNRMLGKTT # LFVPGFDHAGISTQSVVESDSSSRQAKLDMISALSGRTLLNVPGYDAKEKFEFGVITSFAYPIEGSDEMLIVATTRPETMLGDTAIAVHPDDMRYKSL # HGKFAVHPFVDRRIPIIADSMVDMEFGTGAVKITPAHDPNDYEVGQRHQLQFINILNDDGTFNSNAGESFKGMKRFHARVAIVKALQEKGLYIEAKDN # PMQIPVCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 Scaffold_4 AUGUSTUS gene 3275260 3276222 0.82 + . g625 Scaffold_4 AUGUSTUS transcript 3275260 3276222 0.82 + . g625.t1 Scaffold_4 AUGUSTUS start_codon 3275260 3275262 . + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_4 AUGUSTUS CDS 3275260 3275519 0.82 + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_4 AUGUSTUS CDS 3275664 3276222 1 + 1 transcript_id "g625.t1"; gene_id "g625"; Scaffold_4 AUGUSTUS stop_codon 3276220 3276222 . + 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MNLTFVLDTTLSGSFVHVGSSSTSGFASNVSVFSVEDLDDGPHVLLVNVLPNSVFVFDYLVYTVNEQLSSPSSTSNTM # MPTARANTNIWTRRRRSAKRERLEQARERELASARNTPPIIGPAPFIPRYFPRIGPAAPPPYIGPTHNVRDTSFFHTSSPPSPNLPPLYPQPVASSIP # LSYADIPPSIPPPPLLDEVEAHWIALPPSPPPPFGETIGNSASTADVTEITSPLEVEVPTPTNAHDRTASTTASHQEPGVDTVTEDPGVPTLIAPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 Scaffold_4 AUGUSTUS gene 3278380 3278979 0.59 + . g626 Scaffold_4 AUGUSTUS transcript 3278380 3278979 0.59 + . g626.t1 Scaffold_4 AUGUSTUS start_codon 3278380 3278382 . + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_4 AUGUSTUS CDS 3278380 3278979 0.59 + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_4 AUGUSTUS stop_codon 3278977 3278979 . + 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MSRTQLQPLQLNSLPKAHEHDEYTARPGGNRSAPSWNTAPNNTSSSRSSMSGKESSSSAIDPTPGLPLGLSRPLNQIE # QEKLAQLDRLKFFLATAPSRWDSNGSNASSSSSDPYLNMGMGMNSGLNIPHHAPTHPALNRFLLPTQEYVTCVLWNGLYHITGTDIVRALVFRHVLFC # RSSSFWLNFSALGSTLLAGRYAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 Scaffold_4 AUGUSTUS gene 3279300 3281366 0.29 + . g627 Scaffold_4 AUGUSTUS transcript 3279300 3281366 0.29 + . g627.t1 Scaffold_4 AUGUSTUS start_codon 3279300 3279302 . + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_4 AUGUSTUS CDS 3279300 3280191 0.62 + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_4 AUGUSTUS CDS 3280244 3280547 0.79 + 2 transcript_id "g627.t1"; gene_id "g627"; Scaffold_4 AUGUSTUS CDS 3280682 3281366 0.46 + 1 transcript_id "g627.t1"; gene_id "g627"; Scaffold_4 AUGUSTUS stop_codon 3281364 3281366 . + 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MGLESTTQVVGEPALSFVYDGAFKRSLYEQFVKAAGGKEGEGELERVVRGLEEGDAIGFNGNKEGNAHAEAGMSSDAD # NDPSGDESASSSDVEGLNHRNQRGVGAPAADNPNSPFFNMFSLFEGSPTYKQRRKKPSRPSALSSAAMASTTSAQHGIVTEGIASNGDIVRGRYDMRT # INGTPNSSVSSVNRYSYPPSGEQYALYPTGSTYSHDPRANIGYHPSSSPPNTTQYPILHNSYGMDVGYGQGEYSSNVSAGVRVKQESISAADMFLMQA # RGGLPNVPFVESRATKRHSYAGSSMETGTIPVWLEGKYTGVDMAASTSTPLPPFANRGKSMDHSMTVSSPYIQAQQISSAASPYMSNVSMSESPPRSS # TVSSPRDSRGSPISTSGSPSSVPPPPKHLRTHTLERPFICTKDGCGKRFSRSDNLSQHLRVCKGGKSHNDTETSDNANIEGDSLGLSGMEWGVNVGEW # INSEMDEEAQPSVFSANRGRATNVDADMDDTLSEQPSTADIGVGLNMFGGSRGLGMGMGMSTSVNGNNDYNSYPSSIPSSVASLDVPMELCEVELTGD # VRDVHGDEEGLVRVHVRGESGDEGYFTGDSNYNTEVSTLVDSNVQTIDFTSLAKFRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 Scaffold_4 AUGUSTUS gene 3281516 3282502 0.94 + . g628 Scaffold_4 AUGUSTUS transcript 3281516 3282502 0.94 + . g628.t1 Scaffold_4 AUGUSTUS start_codon 3281516 3281518 . + 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_4 AUGUSTUS CDS 3281516 3282502 0.94 + 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_4 AUGUSTUS stop_codon 3282500 3282502 . + 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MHNLNGLYVEHLPAFSTISVPSLSPNRTSWGAGSVPRPHPPYSRQHLNGTNEVEYSMEDPSVSHHGGSASLPVPGMNL # SVSAPSHKLAFDHSSLYPQGMPEPSSALFAASMGGLSVDSSTAGGPVRRHRSMTPSLMRGADGGFVRRPTSGGGSGDNMTSSIYHPYASSSRASSLSR # GGGSVHSSPAGHSMPLPGIGMQRSESRASSLSVEVSGSDHLHQARQMLSRPGSVDPSASSSNSYPGEVYRTESPAPFVNHLPIGPGRVTDSPGTFVVD # LPRPGSSYQHPSHIHSATVPAQFGMSVLDEQFSMQGVNSSAGNGGFYPQHVSTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 Scaffold_4 AUGUSTUS gene 3283028 3283429 0.74 - . g629 Scaffold_4 AUGUSTUS transcript 3283028 3283429 0.74 - . g629.t1 Scaffold_4 AUGUSTUS stop_codon 3283028 3283030 . - 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_4 AUGUSTUS CDS 3283028 3283429 0.74 - 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_4 AUGUSTUS start_codon 3283427 3283429 . - 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MLRSAVSGPYPPTKSTSPPLDFKLEVVEAPPTPDQLKTIMSYVSPNSTLSVFLSAHPSTPSGSEAPQSASAIHNIAAH # NPNVMKWPIVVDWTKGRVSIGDVEGVQSILETLRKQRDGELPQEEEVDRPKGWFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 Scaffold_4 AUGUSTUS gene 3284263 3285075 1 + . g630 Scaffold_4 AUGUSTUS transcript 3284263 3285075 1 + . g630.t1 Scaffold_4 AUGUSTUS start_codon 3284263 3284265 . + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_4 AUGUSTUS CDS 3284263 3285075 1 + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_4 AUGUSTUS stop_codon 3285073 3285075 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MIHPKVIAKDLAEYSYPEYPLKPLVDHKYDTDSPSALENADTAILTNPTFVPDRFMNTLTPIFIIRNPIRMIPSWYKN # TSENFGATTKESEWPFTATFHWCRILYDYYDNYFKAHPRPGYPILPLVVDGDDLVLHTEDIMTQLCDHIHLDSSAVKYTWESGDPYSSWPAAAAPDDL # KTPAVKKVIDAFGGNVARSTGVIRDAEVRLVLTALSRFSWYQQKYSKPLNLDEEGNKWADIWGKEVADDLVETVKKAMVDYDYMLQRRIRPTKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 Scaffold_4 AUGUSTUS gene 3286478 3287954 0.58 - . g631 Scaffold_4 AUGUSTUS transcript 3286478 3287954 0.58 - . g631.t1 Scaffold_4 AUGUSTUS stop_codon 3286478 3286480 . - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_4 AUGUSTUS CDS 3286478 3287243 0.61 - 1 transcript_id "g631.t1"; gene_id "g631"; Scaffold_4 AUGUSTUS CDS 3287389 3287426 0.58 - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_4 AUGUSTUS CDS 3287559 3287954 0.79 - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_4 AUGUSTUS start_codon 3287952 3287954 . - 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MGDSSDSSDDEKEKDPRFEKKFRRRRKIKNIEERSEDGEDTLKGEHTDDSTSRRSVSRSNTATDPNTASLTVADLHQH # IKCPIDDNEDRPKSRRSSFQLSRAAAGLASSQILNKVRGDSSYGFHLYLMTPPKPARHHHFRRRSRSSVHAVDNRDDAAAMNKPLPPTLKPLSLKGLS # FLRSRSAPPSPRDTVSYNDLSIPNATIDHGSPPSMPRTNSHSNVENSRTPTSIYAGEERIVRGPPSIIVEQYDVGPPPTSISSDERPAYNPAEEATSE # KLAKVPPYQPTIFSPVAKVANAPQFIPPGSRSASPAPSLEAFLLDRKRRIGVSASGSPGLLAASTGASLVAVPVAGSVSLRATPSKGARFKSTPLGGI # DKPGNLLADRAGRSQDTTTADENSGTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 Scaffold_4 AUGUSTUS gene 3294849 3295541 0.99 - . g632 Scaffold_4 AUGUSTUS transcript 3294849 3295541 0.99 - . g632.t1 Scaffold_4 AUGUSTUS stop_codon 3294849 3294851 . - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_4 AUGUSTUS CDS 3294849 3295541 0.99 - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_4 AUGUSTUS start_codon 3295539 3295541 . - 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MSQLPVADEPPSQTQTQSETRVNSRKTTVTAHQTLDTISEDTQESQTTNSSSTNPKGKKRKIAADNDDIISVEEALAP # TASKSRSSSAAPPSKKRAIEKVNAVEPSSQKPSSTAKIVKASGALPGKPDTDPVFLKAVTSTKRGKKAEDDFDREFNKLKISKPELDRSKETPRINGP # FWMILVMIETFEEISWSLSRWMSTKIAFRINELLQIIQSGGPAQLQEIQPRGQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 Scaffold_4 AUGUSTUS gene 3296443 3297315 0.62 - . g633 Scaffold_4 AUGUSTUS transcript 3296443 3297315 0.62 - . g633.t1 Scaffold_4 AUGUSTUS stop_codon 3296443 3296445 . - 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_4 AUGUSTUS CDS 3296443 3297205 0.69 - 1 transcript_id "g633.t1"; gene_id "g633"; Scaffold_4 AUGUSTUS CDS 3297263 3297315 0.63 - 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_4 AUGUSTUS start_codon 3297313 3297315 . - 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MDLQSGDELGLANGIMVLVTWQLTCYISHPTPSIISSCASLGISALTNPHPSVDYHIIGAYSFSPEIGTSLLSRCNFV # KLEWLEKVIELCNKSNTQDYIPPPLSKYRPAFSPSLAHQYKNFSIWEPDQRRNELFHGHRFLCVAEKDNDIDSTLREFVARGSGAIQTFCVFNGTLKW # REALKRGTAKDAVLVLVADQATVTAAFGETGWQDLCEEASRYILLFVNYGRSSSSRYHKRFFSTLDLIQAVLNADTAIFRVPVDDNSQNRKGRAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 Scaffold_4 AUGUSTUS gene 3304372 3306615 0.99 + . g634 Scaffold_4 AUGUSTUS transcript 3304372 3306615 0.99 + . g634.t1 Scaffold_4 AUGUSTUS start_codon 3304372 3304374 . + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_4 AUGUSTUS CDS 3304372 3306615 0.99 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_4 AUGUSTUS stop_codon 3306613 3306615 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MGGFTRPTDIRASHWWPGGSYVSEGKQYEEPSPFAYEPHTVFLLESRYDIKYEIGRTDSPAHIVAVCRASDFEAVLEM # FNSRSTPHDCKQLMDNARWPWLTPKKHRSIKWWTSAEERLEALHDLGYSPPSLGQQAVQDALQQAVRDNDDEEFKAKKDFRRHLAQTAAVAARVSEEQ # QLSNIATDIKPLQGKIPFELEFEDGTVAHPSGFVPPTPADKQYDPEYHLSPHPHSRVATELRRRQMETVNEHHSDSLVPRIEQWKALKERKDQEGGLM # STLTSGILSGGVSAATEPRDAKIPTEIHGVHDNAVAQPMQHPSGFVPPTARMSRGESDARTSVVKGQNSNSGEAPEAPERWPTFASGDIHNADEVKST # VAPSGSPQKHFQDVYHLRKEYFEFIKDEPFWRPLISLTVSTRPIAKTLARLSRGLSQGKPFYSVVPPDDRKSKASFAGRLRSLRVTRMRTLAIEMAQL # LAGARGGPIGVRFDEHSRGRGIDGEGLEKPIPWNKRVIGVGIGQWYPLSDELTESFKVLAEKEVTEVYESDFEGKDKKSKSPFLIYQLDDNGRPIGEV # PEFPWPALDKMNDDVRTGVQAMDMVKKMERLLLRDPPAGKVLSIVVDRTDSPSTQYTDLVNAISDHHTPITIHFVGYEQPPTEPAAGYELRGGFAREA # LKKRIDSFYREHTDSIALARTMRISGVIYPRVERDWSRELVKSREVYQFTPDDEPWTANLDTENSLEEADAESDSDNTSRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 Scaffold_4 AUGUSTUS gene 3307325 3308177 0.79 - . g635 Scaffold_4 AUGUSTUS transcript 3307325 3308177 0.79 - . g635.t1 Scaffold_4 AUGUSTUS stop_codon 3307325 3307327 . - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_4 AUGUSTUS CDS 3307325 3307531 0.96 - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_4 AUGUSTUS CDS 3307801 3308108 0.8 - 2 transcript_id "g635.t1"; gene_id "g635"; Scaffold_4 AUGUSTUS CDS 3308168 3308177 0.87 - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_4 AUGUSTUS start_codon 3308175 3308177 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MVVGESGLGKTTLINTLFSTELSPPKNYSRRHHKQLDKLTEVEIIKAELEEKQFKVKLTVIDTPGFGDYVNNRDSWSP # IVEFIDDQHEAYMRQEQQPQRSEKTDLRIRDVIQAQGIRIYTPPIEADDEGADHARVLTEAIPFSIIGSTEDVQTADGRVVKGREYLWGVAEGSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 Scaffold_4 AUGUSTUS gene 3317301 3318083 0.93 + . g636 Scaffold_4 AUGUSTUS transcript 3317301 3318083 0.93 + . g636.t1 Scaffold_4 AUGUSTUS start_codon 3317301 3317303 . + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_4 AUGUSTUS CDS 3317301 3318083 0.93 + 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_4 AUGUSTUS stop_codon 3318081 3318083 . + 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MDQNQNQNPWDPNAGSTAPSSVSSIPPSPSPTSLDDVLRAVLSGQSEMRRELQSFRSTVITEFAKYEGRVQQVEAQSL # ELHQTTKAHSEELSRVRGELSSISEHLVTPTNHEMAIQALQAELAALRTQISSNSTALTVSGRPAHNPRMPADSSYDGKTQDGAAEFIRRIEVHSQQV # SFSSDCAKILFAMGCLTGEASKWADPFVEDAEDAGSNWDEWRTLFLHQFGDIDPENTASSELRALRQNSSSLSQHISNFRSIFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 Scaffold_4 AUGUSTUS gene 3318533 3320224 0.88 + . g637 Scaffold_4 AUGUSTUS transcript 3318533 3320224 0.88 + . g637.t1 Scaffold_4 AUGUSTUS start_codon 3318533 3318535 . + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_4 AUGUSTUS CDS 3318533 3320224 0.88 + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_4 AUGUSTUS stop_codon 3320222 3320224 . + 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MTTPRSTNSFHVLSKLANTSLVDDSDCPAPVKGRTPLSDFSPFEIPISLMVHGTVVSATARVVKTYAMVDTGASVPLI # NSRFIQEHKIPLTQKRRPVLLRTVDNSQVKSGMVTYDTTMRMVVGDHREDVRFDVADIGDDNIILGISWLRKHQPQIDWACTTITFNSDWCRTRCRRR # RKHKPIPTAKKVVQTISGRGKPTNTTAGGQAMRTRTERNQNLKRSKTLKTRLRRHEKADAIRVARAAIQDALQWTEGEGMAGTSDGRVCRPVLTGTTR # ESACPRGPERGDQSWIFEHSYDIDLETAYVKAGRSFSQQLVESARPTVSQSTEDMVPSEYHEFLDRFDKRESDRLPAHTPHDLAIELEDGAALPKLGK # LYQMSPAELKALKKFLDENLDKGYIRPSHTPLGAPVFFVKKKDGGLRLCVDFRALNTITKKDSYPIPLTADLIDRLKAANLFTTLDMRWGYHNVRIRE # GDEWKTSFRTRYGQFEFLVMPFGLSNAPAAFQRMVNELFHDLVDVSVIIYLDDIIIFSEDTSKHEEHVREVLRRLREADLFLNLKMQIPCKRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 Scaffold_4 AUGUSTUS gene 3331991 3333499 1 - . g638 Scaffold_4 AUGUSTUS transcript 3331991 3333499 1 - . g638.t1 Scaffold_4 AUGUSTUS stop_codon 3331991 3331993 . - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_4 AUGUSTUS CDS 3331991 3333499 1 - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_4 AUGUSTUS start_codon 3333497 3333499 . - 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MLPNFYAQHWATSQIPFLGFSPSSNPFKFHFLKCLDYHFDSVPIEKNFDGYVLKSSVKDNWDSLERNMRAFLRACMKL # NWLGIPEDFRLWPYPNNYGYRYRWRTDADARHAVMRSRQAFIPLIACISFFLHTLYHLDNKWVKLIASNYASVLPSPNPFWSKRQKEYEELRRGPVPS # KWQWKERLQQETSISSEWLAYFHQLMDIPMVGTFLDVHNSDCVPWIPVFLEAKMPLMLYWGSTDNWSIHSMLDSVIPTPTATVIRTLISEQTPYPPPP # HVQENSPTELDVSNYKPRLRLPRIDGGTLPRPNEDLFSFIKRRDAQRLRAIFSETAVERQSRLSREKNAEKDRAPGRKGARVYYWDLVKGVRVWTAVG # RNNYEDIWERYGSRQWRYDSVADEWEVCTDLDPEDSPDYNLDDDDDDDSDCFISVQTHMNEETDHNAGTASSSSYLARLHLITRTEPDSLNSVTGFCE # DIEDVDSGFSNNLCPIIATLYLNHRSGTRCWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 Scaffold_4 AUGUSTUS gene 3338555 3339212 0.61 + . g639 Scaffold_4 AUGUSTUS transcript 3338555 3339212 0.61 + . g639.t1 Scaffold_4 AUGUSTUS start_codon 3338555 3338557 . + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_4 AUGUSTUS CDS 3338555 3338845 0.78 + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_4 AUGUSTUS CDS 3338901 3339212 0.72 + 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_4 AUGUSTUS stop_codon 3339210 3339212 . + 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MSPGQDSSDVDSEMEYDTPDEGVQTRVHSATHSNQDSSENLQRSMPQHSHTSLQDLPQTPPPRADHRMDDLNDTPRAP # DPNDTPRFSSSSRDQQPMQEPSSPTIQLLEVAKEEKVQQEPRAPNNDAQSNSQGQNSTSSVDAVGILLAIIALNLKNRTVENFVRGTSNTIKECLHTI # ARIDHRNAAETRRENCCNFVETRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 Scaffold_4 AUGUSTUS gene 3339253 3339660 0.67 + . g640 Scaffold_4 AUGUSTUS transcript 3339253 3339660 0.67 + . g640.t1 Scaffold_4 AUGUSTUS start_codon 3339253 3339255 . + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_4 AUGUSTUS CDS 3339253 3339660 0.67 + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_4 AUGUSTUS stop_codon 3339658 3339660 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MLARIGETLEKQFAGKPAQQRGNMANERGANSQSDTAKTERKPSDRAEEQDNEGDDEADAAYTFSYAKKKRIARSGEI # KRRPVEELRSKVRMAIFSNNLYSPLNVGVDLHVAQYNNERSRSIKKHGNSTRSRRIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 Scaffold_4 AUGUSTUS gene 3339895 3341165 0.49 + . g641 Scaffold_4 AUGUSTUS transcript 3339895 3341165 0.49 + . g641.t1 Scaffold_4 AUGUSTUS start_codon 3339895 3339897 . + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_4 AUGUSTUS CDS 3339895 3339912 0.83 + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_4 AUGUSTUS CDS 3340065 3340068 0.84 + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_4 AUGUSTUS CDS 3340135 3340166 0.85 + 2 transcript_id "g641.t1"; gene_id "g641"; Scaffold_4 AUGUSTUS CDS 3340207 3340335 0.59 + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_4 AUGUSTUS CDS 3340422 3341165 0.6 + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_4 AUGUSTUS stop_codon 3341163 3341165 . + 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MTRVNILMITRSDEALCNIAGGPKSPWNKGASYVFVEILEKQKLITKPSVEDRDGLREAFLMAEEKHSELSQVRTSIR # KLIWTLNKLFHQQREVILTFESLQPYLKVFDELGVAGMSSDEEDPGMSKPRVQYIVKGTRWRAALVKNFVRPIDYVHLEGRCSVDGEKFSFTRGSPPR # LRVDNNDRSSNSKYVVGLPSNFYDATWLEEKEPGWSKGGHGFVNEIIHPQKPMKLVFPPDLAKYVLSVSISKSISNIVIECCRKGNTPVAQLRVRRSK # LSVGMNSRSIPSGTVETKIGDIVVNMIIDACADT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 Scaffold_4 AUGUSTUS gene 3343570 3345551 0.1 + . g642 Scaffold_4 AUGUSTUS transcript 3343570 3345551 0.1 + . g642.t1 Scaffold_4 AUGUSTUS start_codon 3343570 3343572 . + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_4 AUGUSTUS CDS 3343570 3343728 0.56 + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_4 AUGUSTUS CDS 3343778 3344052 0.28 + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_4 AUGUSTUS CDS 3344311 3344741 0.48 + 1 transcript_id "g642.t1"; gene_id "g642"; Scaffold_4 AUGUSTUS CDS 3344893 3345551 1 + 2 transcript_id "g642.t1"; gene_id "g642"; Scaffold_4 AUGUSTUS stop_codon 3345549 3345551 . + 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MSSLFVSLLTRAPELKELIAMYSSTSAHGGDLKTNMVAIIGATLDLQEKVVSQAMTPLSSVFMLSIDAELNFDLLKKI # VNTGHSRCVALEVNLQGVLCYFLISIPVYEEVNIPVSVKTVEVGQSGPSIQKVQKIIGILLVKQCVLAIVSRFSVEKAKSAKKAVKHSLATRLKERVG # INASDSDHSSSGTETDIEDVKIEVMPATNQHEVFKSAALPDEPQTDISEGEIFSAREGRPKRKAIINRDDIELDEMEFGIGKNTGPDMSNLMTSMTPD # VELTTTETNEVCMPMRRSEPIGGEIYDEFDAGGAHGEPYIHQRSGLAPNVQVSKIPQGPIQKTLANVKSLSFFRSRSVPPTLPDDKETSTFTETTTSK # AGMDDLEQAKQDGNQRNNVIKTTNISGSPLAIEALLLDRRRHLVAASTWTAGSSDMNRMVPKGKFKSGPIKKSYSHPTELIGTTPPGALPSVVQSPTR # SQSWKKKDVEERPDDDLDLTLVKTWTDHSNDGVQSQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 Scaffold_4 AUGUSTUS gene 3358929 3359897 0.62 - . g643 Scaffold_4 AUGUSTUS transcript 3358929 3359897 0.62 - . g643.t1 Scaffold_4 AUGUSTUS stop_codon 3358929 3358931 . - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_4 AUGUSTUS CDS 3358929 3359897 0.62 - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_4 AUGUSTUS start_codon 3359895 3359897 . - 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MDDFYGWDFKRNLLLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKIIGFWVDIVKGSISLSSESIQGLVADI # TSFLSSPKRQAALRDWQHLAGSLNWSLNVLPWARPALTEMYRKMSGKTLQFRAIPINGEVYRDLTWFSDLLQTAIGIRFVDAQRWHDSEADFVGWTDA # SNIGLSYVYAGNGFCYQLHPTEGSPVVDIFFRELLSILCLFHHIASKPSPPQHVLIYSDSLDSVQVLNSLSTRESSHNSILLAIAAIVLKTGIDIRVR # HIAGKSNIRADLLSRLLLDDYKLQFPSERVRLFEPPRELLPARWRGCF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 Scaffold_4 AUGUSTUS gene 3360612 3362498 0.97 - . g644 Scaffold_4 AUGUSTUS transcript 3360612 3362498 0.97 - . g644.t1 Scaffold_4 AUGUSTUS stop_codon 3360612 3360614 . - 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_4 AUGUSTUS CDS 3360612 3362498 0.97 - 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_4 AUGUSTUS start_codon 3362496 3362498 . - 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSSTQISLDKGKGRAQPAQSTSYIASRPSPELR # SVRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPLQDRISAAPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSL # TDDPTVVRDFIGQIQEIQRDHLRASRERVAAAKAARAAAAAASKSRISDGPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSN # SLQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSQISSLPLFLRLGNCGCSSLWTVMLTPQSVYSLPSHSLIPYLSPCSNSLSRIGMWTLK # RSMLPSLVTLVSLMIALPLAQSTNWSRKSTQSVLSLSHLKHSGSEFLMPGLPQCLRSIPIVRVSFLHTRHLLWSFSGLLHQIPLLPLEWTGRRARKLL # TLPLTLEMQKTSDFCCLRNFSVLENVPAPLLALLLLQSARILLVSFGMKGNALPHVQIAASMASVVSVESPTKQLTPNPAMRSLSTVDQRVKTALAGP # RSLAGTKRAAPESNSGSSNSIPRFRRGYLWSTSSSSSEIIPPSIQSTYTAPPLPSPPEHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 Scaffold_4 AUGUSTUS gene 3363955 3364791 0.52 - . g645 Scaffold_4 AUGUSTUS transcript 3363955 3364791 0.52 - . g645.t1 Scaffold_4 AUGUSTUS stop_codon 3363955 3363957 . - 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_4 AUGUSTUS CDS 3363955 3364791 0.52 - 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_4 AUGUSTUS start_codon 3364789 3364791 . - 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MRSNTSFVNWNEFGMQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTR # FNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKE # VLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPIT # SDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 Scaffold_4 AUGUSTUS gene 3364858 3366127 0.21 - . g646 Scaffold_4 AUGUSTUS transcript 3364858 3366127 0.21 - . g646.t1 Scaffold_4 AUGUSTUS stop_codon 3364858 3364860 . - 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_4 AUGUSTUS CDS 3364858 3365558 0.48 - 2 transcript_id "g646.t1"; gene_id "g646"; Scaffold_4 AUGUSTUS CDS 3365654 3365812 0.64 - 2 transcript_id "g646.t1"; gene_id "g646"; Scaffold_4 AUGUSTUS CDS 3365866 3366127 0.55 - 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_4 AUGUSTUS start_codon 3366125 3366127 . - 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTP # KQQPLKVTSNSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEQPIANDVPYELGNLRVNASTTLQVEPRNYREAMHSSEAFKWEEAMNDEISAHL # ANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTI # YMKQPEGFKQGGPEKVCRLNKSIYGLKQSPRLWSEKLCSVLVKLGFKRLESDPCVYLFQRGDIKVIVPVWVDISLLLLKTLVSSINSSLNYPRSSNSE # I] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 Scaffold_4 AUGUSTUS gene 3366777 3367401 0.4 - . g647 Scaffold_4 AUGUSTUS transcript 3366777 3367401 0.4 - . g647.t1 Scaffold_4 AUGUSTUS stop_codon 3366777 3366779 . - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_4 AUGUSTUS CDS 3366777 3367224 0.95 - 1 transcript_id "g647.t1"; gene_id "g647"; Scaffold_4 AUGUSTUS CDS 3367379 3367401 0.4 - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_4 AUGUSTUS start_codon 3367399 3367401 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MSAVGSLLPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIR # SLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALVNKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 Scaffold_4 AUGUSTUS gene 3367994 3368887 0.63 - . g648 Scaffold_4 AUGUSTUS transcript 3367994 3368887 0.63 - . g648.t1 Scaffold_4 AUGUSTUS stop_codon 3367994 3367996 . - 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_4 AUGUSTUS CDS 3367994 3368887 0.63 - 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_4 AUGUSTUS start_codon 3368885 3368887 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTP # KQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEWWKTKPSSSRVPAPNDDS # DDSNDDYYGDAELASISTQQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLHQERKQLGLLGYSGLNTMLMVLLNDLKPASVLRVSAKD # LVLTIWKPMLPLCAGPHYVLSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 Scaffold_4 AUGUSTUS gene 3369080 3370617 0.38 - . g649 Scaffold_4 AUGUSTUS transcript 3369080 3370617 0.38 - . g649.t1 Scaffold_4 AUGUSTUS stop_codon 3369080 3369082 . - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_4 AUGUSTUS CDS 3369080 3370241 0.58 - 1 transcript_id "g649.t1"; gene_id "g649"; Scaffold_4 AUGUSTUS CDS 3370301 3370343 0.56 - 2 transcript_id "g649.t1"; gene_id "g649"; Scaffold_4 AUGUSTUS CDS 3370422 3370617 0.68 - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_4 AUGUSTUS start_codon 3370615 3370617 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MRSSPSQSLADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALIPFLAEQQNQEHAE # QQAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKGIQANKAKVTEDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIR # NYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEARQVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLN # GLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTG # IISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGSKYNVQLEIDLNKMESLKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 Scaffold_4 AUGUSTUS gene 3371433 3373629 0.48 - . g650 Scaffold_4 AUGUSTUS transcript 3371433 3373629 0.48 - . g650.t1 Scaffold_4 AUGUSTUS stop_codon 3371433 3371435 . - 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_4 AUGUSTUS CDS 3371433 3372370 0.83 - 2 transcript_id "g650.t1"; gene_id "g650"; Scaffold_4 AUGUSTUS CDS 3372889 3373007 0.87 - 1 transcript_id "g650.t1"; gene_id "g650"; Scaffold_4 AUGUSTUS CDS 3373172 3373629 0.85 - 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_4 AUGUSTUS start_codon 3373627 3373629 . - 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MSSSTTISTTPSFKVLNKDNYNDWKGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQ # QVPIKAHQEDPIRMWSILEQQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVHNQEHAEQQSVNRAAQAASSSNKK # KNNYRAPVRTGEPKDYFNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMH # ANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQ # DEGIEVQRTARNRPQQNGVAERLNRTLAELLTAMLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVCVEHTVVIEHFLH # TLHSASSLLVITVVTYLVYKVLYRHHYLVLQLIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 Scaffold_4 AUGUSTUS gene 3380895 3382848 0.25 + . g651 Scaffold_4 AUGUSTUS transcript 3380895 3382848 0.25 + . g651.t1 Scaffold_4 AUGUSTUS start_codon 3380895 3380897 . + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_4 AUGUSTUS CDS 3380895 3381801 0.47 + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_4 AUGUSTUS CDS 3381884 3382848 0.57 + 2 transcript_id "g651.t1"; gene_id "g651"; Scaffold_4 AUGUSTUS stop_codon 3382846 3382848 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIP # VTEDESDELPIAIRRPACNRKPPGEWWKTKPSSSRVPAPNDDSDDSNDDYYGDAELASISTQQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTW # DIVDLPPGEKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDIDTTIYMKQP # EGFKQGGPEKVCRLNKSIYGLKQSPRLWSNIKVIVPVWVDDITLACKDPGVLDKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIR # KLEEFSMQDSKPVKTPLNPTVSLSKEDSPKTPEDKEAMINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYEL # ELGPDPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSS # IQVAKNPEHHGRMKHLDRTFYWLREQVTHGKLAPSYLPTEDNPADLLTKALVKQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 Scaffold_4 AUGUSTUS gene 3386470 3387217 0.7 - . g652 Scaffold_4 AUGUSTUS transcript 3386470 3387217 0.7 - . g652.t1 Scaffold_4 AUGUSTUS stop_codon 3386470 3386472 . - 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_4 AUGUSTUS CDS 3386470 3386903 0.97 - 2 transcript_id "g652.t1"; gene_id "g652"; Scaffold_4 AUGUSTUS CDS 3386959 3387217 0.71 - 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_4 AUGUSTUS start_codon 3387215 3387217 . - 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MPPRTQAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLSENMEEEQQFEYSTLYTGDGQP # VQVLTPHRAIARRTGKQPQCRATSQSPHDPPPHFDLDAGDHDDQDPPVDPDNPSADNDNPDNDNLDDDSGGLPCGEPGDPSGPGGPHSPISPNIPNEQ # CAMLELLSGFKGSIETLGSVLPALGQPSDSSESKSKVKEPKAQDILCQSRPGLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 Scaffold_4 AUGUSTUS gene 3395997 3397223 0.59 - . g653 Scaffold_4 AUGUSTUS transcript 3395997 3397223 0.59 - . g653.t1 Scaffold_4 AUGUSTUS stop_codon 3395997 3395999 . - 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_4 AUGUSTUS CDS 3395997 3397223 0.59 - 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_4 AUGUSTUS start_codon 3397221 3397223 . - 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MEVRHSSWEPPDPNLQIPLNQMEVRHSNRGHVPSRRYLESAEYEKREEAARNNGADWSTDTPLAGHTFALITQSPYSF # AATTGDLWVPQSYKQAMKYPDLWTEPMQKEIDTLVSKECWDLVLLPPDANLTGGRWTYAIKFDANGNLLKRKARYVAQGYTQIQGQDYDKTYGGVARM # ESVRLVLAIIAVLRLSIFQVDFTAAFLNRPITHDVYLKQPEGFVKPGMEHLVCKLKKSIYGTMQGSHDWQETLAAGYKADGYITSRADPCIRYRRKGN # DYTITSTYGDDVCGGSSTAAGRDEAVADLGKRWEANEVTSQVLLGMTIRQDPESKSITISQKAYFNRMLTHFGLDKVRRWTTPLPPNVKLHASPNPLP # EQDQQFMQDKPYRAVVGSILWDRCAHARTWPLQEVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 Scaffold_4 AUGUSTUS gene 3403002 3403571 0.89 + . g654 Scaffold_4 AUGUSTUS transcript 3403002 3403571 0.89 + . g654.t1 Scaffold_4 AUGUSTUS start_codon 3403002 3403004 . + 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_4 AUGUSTUS CDS 3403002 3403571 0.89 + 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_4 AUGUSTUS stop_codon 3403569 3403571 . + 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MIRLATVKLHKNAIVARERDVAAREAAIIVREQQLETRAAQTEIELNSLRHTISQNQHLQFSQQDLEVAIQQAIARRE # EELRVLVLHREEEVAVAIAKREEEIIASVNKREEELNEAWVMREEQIRQEVDDRVRWIHEREVDLAAEENRLEEVRLELEGKVRKWEAKSVKGIHFRI # LEVYVFISLMTSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 Scaffold_4 AUGUSTUS gene 3403750 3404145 0.75 - . g655 Scaffold_4 AUGUSTUS transcript 3403750 3404145 0.75 - . g655.t1 Scaffold_4 AUGUSTUS stop_codon 3403750 3403752 . - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_4 AUGUSTUS CDS 3403750 3404145 0.75 - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_4 AUGUSTUS start_codon 3404143 3404145 . - 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MEPETLDLEVADDRIDGRRIRVGGGIEVIEVDADDGRLEGDTLRSPFAVLPYLRGLSLRQLGLGGGDSVSSALSSVST # SAFLQSGSKILVKSRPTLGESTKSFARSLGAGVVSTSPVEVSTTPFIADAGVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 Scaffold_4 AUGUSTUS gene 3430890 3431501 0.97 - . g656 Scaffold_4 AUGUSTUS transcript 3430890 3431501 0.97 - . g656.t1 Scaffold_4 AUGUSTUS stop_codon 3430890 3430892 . - 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_4 AUGUSTUS CDS 3430890 3431501 0.97 - 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_4 AUGUSTUS start_codon 3431499 3431501 . - 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MSAPSHDRRRSARRTKSPSVISTANSVPVTKSQAKHNFISSNKLSSEPGPGAQSTSIEVKPSSSADSNNQLHDIMRKV # IKALEGVTGAHLDMEIFGLEEEEKENDSEKERDEQDGEDRSRNDPNPEKDEEGEVARELILNGNGNGVAQATDGKKKVDWEIPRKLLHSSIGTHSSRS # TQPALMSEINQVFSQYIYIYLPGTPEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 Scaffold_4 AUGUSTUS gene 3434705 3436141 0.48 + . g657 Scaffold_4 AUGUSTUS transcript 3434705 3436141 0.48 + . g657.t1 Scaffold_4 AUGUSTUS start_codon 3434705 3434707 . + 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_4 AUGUSTUS CDS 3434705 3436141 0.48 + 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_4 AUGUSTUS stop_codon 3436139 3436141 . + 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MSSLSTSSPPATVTLSNENPFIHSSVAQNLIGPSYRSYNENGGSNPINPMGTSGINDSVGRSALMKMNEMSRRAGDAL # NPNGNPSGGNAFSFGDGGDRPPSRLWTAATNAGLINPDGSFVNPLNNTVPVSSPNPDAWNNVASVGPTKITSRRDALAKIEELQRMRPASAGFLSNAA # AKLVSATETFGSNGENRNVPVQEGSQDNSMDSGSSITDMSNEEVVMPSASTVAANAEQEQEQRSQESQSNSSDPWNMMLPNVPSLSSFGSQDGSASLQ # IQQEQPSTPLSMLTSFPDYTSSHEGLQVYTVGHLMPRNTIDDMNGTWSFDPGMFEGGGFNFSGNTMVGGQERKVDGGSPTMASSSQVFDPLPSSSSSP # PSGPDSSSKKLRVRRSAFVPGWAVSPRVLLVDDDAVSRKLGSKFLQVFGCKIDVAVDGVSAVNKMNLEKYDLVLMVRLNSINMSIFSYFSIRTLLCLN # STVFQRHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 Scaffold_4 AUGUSTUS gene 3439163 3439360 0.75 - . g658 Scaffold_4 AUGUSTUS transcript 3439163 3439360 0.75 - . g658.t1 Scaffold_4 AUGUSTUS stop_codon 3439163 3439165 . - 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_4 AUGUSTUS CDS 3439163 3439360 0.75 - 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_4 AUGUSTUS start_codon 3439358 3439360 . - 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MLARLKEILDDNVVGPVEDRLARAWEVLKGAGGESKEYAEEKYAESQQVFEDMKGGAYEKVKGEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 Scaffold_4 AUGUSTUS gene 3440065 3440727 0.97 - . g659 Scaffold_4 AUGUSTUS transcript 3440065 3440727 0.97 - . g659.t1 Scaffold_4 AUGUSTUS stop_codon 3440065 3440067 . - 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_4 AUGUSTUS CDS 3440065 3440727 0.97 - 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_4 AUGUSTUS start_codon 3440725 3440727 . - 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MQIRLQKFVILSLFIVSPAYASSDSWFSSKPKSDSATAAFPSSFSSWTPSQYTSFQETFASLRDSTFDSWDESRLREW # LLEQGIVAPKGPKEQIVLAAKRRWKDWQEAKEKYSASASQAASAYMSDASATASQASSAASSYAAQATTDVLPDRPFDSTKDYVWSTWDDTQLRKFLV # ENGVIDTRTAAGKKRDELIKSAKTHYATASGNAWETWSDSYIVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 Scaffold_4 AUGUSTUS gene 3443627 3445005 0.29 - . g660 Scaffold_4 AUGUSTUS transcript 3443627 3445005 0.29 - . g660.t1 Scaffold_4 AUGUSTUS stop_codon 3443627 3443629 . - 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_4 AUGUSTUS CDS 3443627 3444281 0.61 - 1 transcript_id "g660.t1"; gene_id "g660"; Scaffold_4 AUGUSTUS CDS 3444722 3445005 0.3 - 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_4 AUGUSTUS start_codon 3445003 3445005 . - 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MTKPLIQMNPTAVDSSGLLQRVQQVVCEVVTPAWVSNPPRNVGLYEAGVLKADHWRTLFLIHLPLAILSLWKDTSPLA # AAGACDMASVVDTTMHLPATQSDSNDADRLTDENSVVTPELMAGNVAPPSLEVTIASSPELTRLIGEDPYESFARIPAAKGDYTIATEKAVGNSYISF # QPAGDYHPGQRWLAGQIRHIFRRRKNSPIQLAVCRSQSIHVPDPFSEFWEDGFEAKLVSSKFSRTLEIVDLKQVAAHSARWAISDDLVVAVNLCSVSD # PTNHSFIVLTLLRTNRCDNVRGTNDSFTYNLHRKLPPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 Scaffold_4 AUGUSTUS gene 3446374 3447757 0.65 - . g661 Scaffold_4 AUGUSTUS transcript 3446374 3447757 0.65 - . g661.t1 Scaffold_4 AUGUSTUS stop_codon 3446374 3446376 . - 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_4 AUGUSTUS CDS 3446374 3447114 0.67 - 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_4 AUGUSTUS CDS 3447201 3447241 0.73 - 2 transcript_id "g661.t1"; gene_id "g661"; Scaffold_4 AUGUSTUS CDS 3447352 3447757 0.97 - 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_4 AUGUSTUS start_codon 3447755 3447757 . - 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MLKDTVASNSSPEEDSLESLLSHDAQGRLQFGDPKKRHKRTMQALTTISAITEATRGLKAQIGAISLSHTSAEINAIL # CTVEDGSEALRRHISSVTRTAVSEEVKEARAMLDLLDQAVSTWRVEYPDSSPVKIDNPLALSPEFLNGQPSEATLAAIPKSIETLEKKFNLDIDCIPY # AVCPKCSYTHPPSYPNDASHPVYPTVCSEIKAVSEEPCGTPLLLHGKPLKTFEYYPFFEWFGKFLSLPGIEDYGDRFCDIVGNHQTIPVDKVDETDGR # FVHEFCAQDGELFVADRGDEGRWFFILNADFFNAEGNRIRGKTSSTGMIAMTCLNLPLQIRNDHAYIYIPGIIRGPHEPNAHDAEHRHFLRPLVDDLS # KGYTRGVRPYATYCARKNNRPYK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 Scaffold_4 AUGUSTUS gene 3450293 3450808 0.64 - . g662 Scaffold_4 AUGUSTUS transcript 3450293 3450808 0.64 - . g662.t1 Scaffold_4 AUGUSTUS stop_codon 3450293 3450295 . - 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_4 AUGUSTUS CDS 3450293 3450808 0.64 - 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_4 AUGUSTUS start_codon 3450806 3450808 . - 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MQSSPLSARSNSIMDPYRNFDLRPLCADHKEMLPPPVVAAAVDHTPIAPSSGPARTSRDTLRVSPYNSPSPEPLQRRP # HTAALPSSSSSSIESLSSELEYDSDRERIARLRNTQRVSHPYSGNHGVPVHRTPWCAKSPTADNAHAASSTTGKATQGVDDNQAEGNLVHERV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 Scaffold_4 AUGUSTUS gene 3458984 3459388 0.89 - . g663 Scaffold_4 AUGUSTUS transcript 3458984 3459388 0.89 - . g663.t1 Scaffold_4 AUGUSTUS stop_codon 3458984 3458986 . - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_4 AUGUSTUS CDS 3458984 3459259 0.89 - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_4 AUGUSTUS CDS 3459359 3459388 0.9 - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_4 AUGUSTUS start_codon 3459386 3459388 . - 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MYKIITVNVKDQEFVRIYIYTDKSVQIRVTRMTEMTYLLTALSAALSSNPLRKFLIDTLLPQATRRTSPSTRPPPRFW # TDWFGGSNLCRLKNTKNLNDFPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 Scaffold_4 AUGUSTUS gene 3460839 3461466 0.31 - . g664 Scaffold_4 AUGUSTUS transcript 3460839 3461466 0.31 - . g664.t1 Scaffold_4 AUGUSTUS stop_codon 3460839 3460841 . - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_4 AUGUSTUS CDS 3460839 3461352 0.85 - 1 transcript_id "g664.t1"; gene_id "g664"; Scaffold_4 AUGUSTUS CDS 3461441 3461466 0.31 - 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_4 AUGUSTUS start_codon 3461464 3461466 . - 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MHKSAFAMHPDDQCRRRRDEAGVAFWSHTLEVTDILQDGSQSDEEDASVDVEIEGVMMKQDVKKVSRLYWRNPDVEDL # YIVADRAPGVEAGIFHRAGAPRIPRIRTDKVSHREPPRGLPRCFFREEYLSALMPYELEELELANYNVEMYDFKNYDPNTENGEGYVPNAENDDLQDM # DTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 Scaffold_4 AUGUSTUS gene 3468602 3469779 0.31 - . g665 Scaffold_4 AUGUSTUS transcript 3468602 3469779 0.31 - . g665.t1 Scaffold_4 AUGUSTUS stop_codon 3468602 3468604 . - 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_4 AUGUSTUS CDS 3468602 3469462 0.32 - 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_4 AUGUSTUS CDS 3469603 3469779 0.31 - 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_4 AUGUSTUS start_codon 3469777 3469779 . - 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVTDASDYAIAAILSIQYADG # EIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSIT # RRWDVYPKEGDIGYAQVNPHNFRLSLLTNKLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDR # IYVLITAIFAFKSFAISMIIHFPAISARTALSKLYVVNTPGPRSETLFVTTLPLALSVVAISPAVTGLTAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 Scaffold_4 AUGUSTUS gene 3471373 3472422 0.33 - . g666 Scaffold_4 AUGUSTUS transcript 3471373 3472422 0.33 - . g666.t1 Scaffold_4 AUGUSTUS stop_codon 3471373 3471375 . - 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_4 AUGUSTUS CDS 3471373 3471701 0.92 - 2 transcript_id "g666.t1"; gene_id "g666"; Scaffold_4 AUGUSTUS CDS 3471784 3472181 0.68 - 1 transcript_id "g666.t1"; gene_id "g666"; Scaffold_4 AUGUSTUS CDS 3472307 3472422 0.44 - 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_4 AUGUSTUS start_codon 3472420 3472422 . - 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPLTALNPRARSRSQSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGV # YDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAASGSS # APFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVV # EEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 Scaffold_4 AUGUSTUS gene 3478334 3478552 0.66 + . g667 Scaffold_4 AUGUSTUS transcript 3478334 3478552 0.66 + . g667.t1 Scaffold_4 AUGUSTUS start_codon 3478334 3478336 . + 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_4 AUGUSTUS CDS 3478334 3478552 0.66 + 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_4 AUGUSTUS stop_codon 3478550 3478552 . + 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MPSNPETQTEDYQLLPTGPQAADEDPQKVDMGLAEQLEKAEGRQGDNFARYAALVRSINHSSLSTKVNETFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 Scaffold_4 AUGUSTUS gene 3491250 3491744 0.98 - . g668 Scaffold_4 AUGUSTUS transcript 3491250 3491744 0.98 - . g668.t1 Scaffold_4 AUGUSTUS stop_codon 3491250 3491252 . - 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_4 AUGUSTUS CDS 3491250 3491744 0.98 - 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_4 AUGUSTUS start_codon 3491742 3491744 . - 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MLLKARKEPLLNVKAKELVESGEKVPIAYTTPKLSSGFPSMNSGVGIQFDTPIIHGPLFAGVAQPSSPDIGKWDTLSF # PEDNFHPSTPSSSGGRRGGPPQRKHGPAPSVKKSPAPGSPEVTGLPKASPAASFSWGPLPTFNRPSSGLPGFDKVISKSPSSVTQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 Scaffold_4 AUGUSTUS gene 3492748 3492975 0.59 + . g669 Scaffold_4 AUGUSTUS transcript 3492748 3492975 0.59 + . g669.t1 Scaffold_4 AUGUSTUS start_codon 3492748 3492750 . + 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_4 AUGUSTUS CDS 3492748 3492975 0.59 + 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_4 AUGUSTUS stop_codon 3492973 3492975 . + 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MPLSTGSGTGVVPEDLMDTAGALGMEGPAGGGGVKGDGSEKRGWGVPGDKIGDVPGWEPAGKGESEGCGLPESSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 Scaffold_4 AUGUSTUS gene 3493148 3496283 0.38 - . g670 Scaffold_4 AUGUSTUS transcript 3493148 3496283 0.38 - . g670.t1 Scaffold_4 AUGUSTUS stop_codon 3493148 3493150 . - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_4 AUGUSTUS CDS 3493148 3494789 1 - 1 transcript_id "g670.t1"; gene_id "g670"; Scaffold_4 AUGUSTUS CDS 3494899 3496283 0.38 - 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_4 AUGUSTUS start_codon 3496281 3496283 . - 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MSCTDLEVIGNIGNEWYQQSQENPLSIPLDKESEDTVLLSLQVDFTDTDPTEGGHPIIYAYLNDGTLQGWYVDHPEKK # PYGGMVGGSATISTSTSASNQPQHNAAFGAQLSSSSAFINAQAPSPGQTSATTAFGQSSFGRTGFVVQPATESTSNYGPSNSSGGFANYSSNSASPFG # PGDFASSASNTSSFGNTTIESSPQITRDASMSDSTPAFVGLSLGDSSESPKPTSTFNGTGNMFGSPSPLPLPPTHPANQPAQTSVFGSGSGNVIKPAT # GFGAFGGPTSGSFGVFGNTGNTTNNAFTGGAFSAQPTKTSAFASNSEQSRPGSGFGQPSFGQSSFGKPSFGQPTFAQLKPAEINPSSGGFSAFSQSPT # SFMSAAPSSPMSKSNAGGDGFASFAGTPSTFASAMSSGKSAFGGVSASGTDNTKEQKSESNSFSAFASKGPSPFGQSENKTPSPFGSQSPVFEQPSAG # SAFGALKSVSSSVFGQPAPSTSQVAFRDRESVPSTHDHEKEHPVSLIKSEPGSPTLPSSPDSDIVKPSTFPVKATTTGNLQTSSSYLKPASGFGAFGN # TMPNSSPFLRDNTDDEKPAVSPFGSLGSAKSVLSTNLSSPSTDPTFGATSQLGFGFGLKASTSSSSPVAASTSSATTTPFSAFSGTPSPFAAVGGTTK # SFGDLLKEGSPKATSEPPKFASSTPPASPSAAAKQIRDGDKTVPGDEEKRKMIEDTNEESVLSTSSSYVEIPRPAKQEDEEEKVPDSDDELEGHLEQH # GHDDDDDDEGDFLSESYDSHSGEEQLGEGESEEVEGKESSDEPSPSSSPEPTEIPLPPSRSRSNTPQAETTRTEPNSPSPSTSEDTESSRLSTIREES # TTPPGTPTKSQTAGSSTIVAPAPINAPLTTLGIGRPSTRPTRSSPLANKPLTGAEEQDDEEEAVEEPKLIAAFKPRPASPKAPFGMIPTQSGSTSPDE # PKLIDGKRPKTPPLLSNFFGSTSTPTTPKPAAASLPGPATQLKPPRAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 Scaffold_4 AUGUSTUS gene 3499925 3500335 0.5 - . g671 Scaffold_4 AUGUSTUS transcript 3499925 3500335 0.5 - . g671.t1 Scaffold_4 AUGUSTUS stop_codon 3499925 3499927 . - 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_4 AUGUSTUS CDS 3499925 3500335 0.5 - 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_4 AUGUSTUS start_codon 3500333 3500335 . - 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MKTAFENGINMFDTAETYATGKSEEEMFVAVTSCTFDIIPYTLNFVQYISGVASSRNWVGAALISSSPLRYSGESVAR # TLTEEGCPENSKLKGLRNGVDYSDIRSNLVSSRDTGKSCALQLDYVDIIFAHRSDPNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 Scaffold_4 AUGUSTUS gene 3501838 3502913 0.75 + . g672 Scaffold_4 AUGUSTUS transcript 3501838 3502913 0.75 + . g672.t1 Scaffold_4 AUGUSTUS start_codon 3501838 3501840 . + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_4 AUGUSTUS CDS 3501838 3502107 0.84 + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_4 AUGUSTUS CDS 3502233 3502329 0.77 + 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_4 AUGUSTUS CDS 3502549 3502913 0.78 + 2 transcript_id "g672.t1"; gene_id "g672"; Scaffold_4 AUGUSTUS stop_codon 3502911 3502913 . + 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MKNDPNFRPPVEYAQQKRSQRPSDKVYIPVKEFPEINFFGLLVGPRGNSLKKMETESGAKISIRGKGSVKEGKARPDQ # YADDAEEDLHCLAASTPEGQNEHKRNQLRQLAALNGKNPLFSVHLGRGGFDSEYAKLMAELGEPGAAAPDMSKPSWAAGPRSGQDITGGGTNIPPWRR # PENWQSNVQPQQQQQFRPQGGYGGGYGASGGGYGGGQWSGQGGYPQQSQDYNYASYYQGQYAQQQTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 Scaffold_4 AUGUSTUS gene 3503558 3503806 0.65 + . g673 Scaffold_4 AUGUSTUS transcript 3503558 3503806 0.65 + . g673.t1 Scaffold_4 AUGUSTUS start_codon 3503558 3503560 . + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_4 AUGUSTUS CDS 3503558 3503806 0.65 + 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_4 AUGUSTUS stop_codon 3503804 3503806 . + 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MSGNDSQKNPERVAAGLRGTLHNDNASDEAKDRATERLREMGDDFENKTSRGSAGTGDAHQNQVLGEFSSTAFVDDVA # DNLM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 Scaffold_4 AUGUSTUS gene 3504288 3504650 0.74 - . g674 Scaffold_4 AUGUSTUS transcript 3504288 3504650 0.74 - . g674.t1 Scaffold_4 AUGUSTUS stop_codon 3504288 3504290 . - 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_4 AUGUSTUS CDS 3504288 3504650 0.74 - 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_4 AUGUSTUS start_codon 3504648 3504650 . - 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MTSSMYPSSRVYGHNPSSSLASISSLPGSNVMPVLRPLDYSSLVSIESTQTELARTIDDLSKCLSVVEIGFTSMLDTV # YADTIEEEQEDTADPIITDSETEQEQDSYFSLYNIKPITFNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 Scaffold_4 AUGUSTUS gene 3504856 3506467 0.41 - . g675 Scaffold_4 AUGUSTUS transcript 3504856 3506467 0.41 - . g675.t1 Scaffold_4 AUGUSTUS stop_codon 3504856 3504858 . - 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_4 AUGUSTUS CDS 3504856 3506328 0.85 - 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_4 AUGUSTUS CDS 3506411 3506467 0.41 - 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_4 AUGUSTUS start_codon 3506465 3506467 . - 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MGQINRQSSSIDFAGVGPTLLLCRIDLGCRLGTDNESIWEFETVRGRPHAPFQDDTNSYYDGLDTEPVNAQATIRPGP # SAPLPSSLRLLFQDESTQQNTFRASTFQQPLTRSLPVEPSPPPPPQPQPPLSTPPFASAQTKRPLPLDMHEDDLAKTREFVFPRPTRSKLNLSSVANS # EEDLISPPSPSSTESYNNGNLDDISPETEKSESSSSTVVGAVRSTATYRDIRSTRGPPDISIPSTFDKMPDLPTHTIPVNSASPSGLSSSSPDISTAS # TTRPLIPRKRSQSTAEGLAGRKESLTPHLDSNHHHPNPSPNPSPNPNLASSTAFQFPANPTKPAATFGSAHARDGLASSTSAKPQPALPAMTSPGSHQ # TTYSLDTSSSTRRNASASATTRSSPSMMRTRSATALPEVQSPPSTSFAAIPSSSLHHPEVFTDGLPLLPPVRPFAEPMRRNRSGSDSSSTSRTVNLGT # PGLKDVLKVRYPFSLNTWLFIATRDLDSLVIFRTPTRSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 Scaffold_4 AUGUSTUS gene 3506524 3507303 0.41 - . g676 Scaffold_4 AUGUSTUS transcript 3506524 3507303 0.41 - . g676.t1 Scaffold_4 AUGUSTUS stop_codon 3506524 3506526 . - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_4 AUGUSTUS CDS 3506524 3507303 0.41 - 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_4 AUGUSTUS start_codon 3507301 3507303 . - 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MAQPSVHQLYKRLETIGKGAYGSVSKGVHIPSGNFVALKIINLDTADDDVDDIQREVALLTQLRDAPNITKYYGCYMD # GPRVWIVMELAQGGSVLSLMKASRDGCLEEKFISVIIREVLVGLSYLHKVPVIHRDMKAANILVTAVGKVMICDFGVSALLATASSKRNTLTGTPYWM # APEVVQAVPAYDTKADIWSLGIMIYEMAKGTPPHSNLDKFKVMDLIPRAKPPRLTDAEAGKDMRDFMSFCLKEAPIEVSVLFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 Scaffold_4 AUGUSTUS gene 3507891 3508914 0.68 + . g677 Scaffold_4 AUGUSTUS transcript 3507891 3508914 0.68 + . g677.t1 Scaffold_4 AUGUSTUS start_codon 3507891 3507893 . + 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_4 AUGUSTUS CDS 3507891 3507914 0.68 + 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_4 AUGUSTUS CDS 3507964 3508914 1 + 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_4 AUGUSTUS stop_codon 3508912 3508914 . + 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MEYLTPPLLVLASFPPPGPNAPPHLPLVMKAFQSLFPSLSPQNLTLSSARRIVLVAYNSELGTLDFRHYIITIKPYGV # SKRVRRVLEGATVKSSTGSVLDLGNEKDVADFVLRKRGEPGPDGGYESAASSAESVAGDDGDAVNLADDYVGRNNKKGQRRAVRLDEVGPRLELRLVK # ITEGVPGKEGGVLYHEFGTIISLFQFFTIFDRFFHSSVKKSKKEIAAQNAVHAAKEKLRKERREEQERNVASKKAEKTKNGKSVHLESNEDEAGNDDD # DVDADAAVDDWDNEEEITDGEESQLDEAEESSDDEEVRRPNKKVKVRGKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 Scaffold_4 AUGUSTUS gene 3514705 3515238 0.74 - . g678 Scaffold_4 AUGUSTUS transcript 3514705 3515238 0.74 - . g678.t1 Scaffold_4 AUGUSTUS stop_codon 3514705 3514707 . - 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_4 AUGUSTUS CDS 3514705 3515238 0.74 - 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_4 AUGUSTUS start_codon 3515236 3515238 . - 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MMPYPYLIPRSGSIAEHIQLPRSLPTSRNPSFDSANAPSLSRRESYSVAVQDVPITPPLSPGQTEPVDIDMEDDADIE # VLDMNADEGRASSNTTEIAVGDNSALSPVPTSAMAPRKSREAIDISRVRENQALSHPMGGPEGHRPLKLLEDEEVHLQKGGVKLTDFEVRGTLGGSGL # E] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 Scaffold_4 AUGUSTUS gene 3516389 3517126 0.99 - . g679 Scaffold_4 AUGUSTUS transcript 3516389 3517126 0.99 - . g679.t1 Scaffold_4 AUGUSTUS stop_codon 3516389 3516391 . - 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_4 AUGUSTUS CDS 3516389 3517126 0.99 - 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_4 AUGUSTUS start_codon 3517124 3517126 . - 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MTFVSYNDYLEEVEDIAFNLINNIDILATEARIAAYKAANAALTSLNLQREEAEALALKEQEDLERREREARAAQLAQ # QEQQERDERQREERELIDKLETSQKDAHKIVAKSRIAAAKRSSARAASSSANSGLLGMSFGADYAKLLKTRTNKVTNNVPDEPHVPFQDDWYAYDDLY # TVRVDGYDDIISEAVRKDREGIMRAGGYKVEEAWNRALLTAVAGLNVVPLSGSDEPKSLGDADVVMDSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 Scaffold_4 AUGUSTUS gene 3517903 3518593 0.34 + . g680 Scaffold_4 AUGUSTUS transcript 3517903 3518593 0.34 + . g680.t1 Scaffold_4 AUGUSTUS start_codon 3517903 3517905 . + 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_4 AUGUSTUS CDS 3517903 3517921 0.94 + 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_4 AUGUSTUS CDS 3518070 3518593 0.34 + 2 transcript_id "g680.t1"; gene_id "g680"; Scaffold_4 AUGUSTUS stop_codon 3518591 3518593 . + 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MFKSGHAVPSNQDEWRAALESLPSTPQKIPAFFFAHGSPALVYARGFSGRSDFEQYQGPNGPLANFLKDFGPTLLQKY # NPKAVVVFSAHWETLGERLGIDLSQLIYLHISITDSIVTDYGDENPLLMDYYGFPQEFYQLKFKSRGDKQLAEQIVGLYKEVRRSFMSSGSSQRSTPH # RQVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 Scaffold_4 AUGUSTUS gene 3522092 3522361 0.24 + . g681 Scaffold_4 AUGUSTUS transcript 3522092 3522361 0.24 + . g681.t1 Scaffold_4 AUGUSTUS start_codon 3522092 3522094 . + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_4 AUGUSTUS CDS 3522092 3522361 0.24 + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_4 AUGUSTUS stop_codon 3522359 3522361 . + 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MNKPIKVNHANSEDNGSDAAWTDGDDNEIEFVEERMQNRSGDIEMKSEVQKVTEKGTKNTNKIDKDISVNEPSYRDVL # KHFRWDTRLLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 Scaffold_4 AUGUSTUS gene 3524047 3525383 0.85 + . g682 Scaffold_4 AUGUSTUS transcript 3524047 3525383 0.85 + . g682.t1 Scaffold_4 AUGUSTUS start_codon 3524047 3524049 . + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_4 AUGUSTUS CDS 3524047 3524265 0.85 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_4 AUGUSTUS CDS 3524322 3525383 1 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_4 AUGUSTUS stop_codon 3525381 3525383 . + 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MNSTVFPSVVNTMFYDALQDWGFDGFIIADDAALIMLQQGHMVSDSPADTLSQWFNAGGMIQYYDFDIETFLNVTSDL # LANDSVPLSTLQSHVIQILKVKYDMGLFANATSKASSEPNSTSLYVPSDIVYQDLTAHHAPLTLEAARASIVLLENRNSTLPIKPNTQNISRIALIGP # FGDILNYGDYSGPWGASPAQNGTTIRQSILKHIKNSSLDVELVTSIGSNTWYYNAQYGIPAYLLSPIVDQTNTSSEEHGLLGTYFADPNFTDACFSQV # DVPNKDWGLYPPLGLPSNNFSVIWEGRLTVPVEGEVKGSIGVAVSPNTTARLFIDGALVAESPLTTAGNILGNIEPLSYDIMNGTMMPPGGAQWTFQQ # GATHHIRIEYQTWNLYQKLANVNSVNAQVAFWWNLVDPDAIAKVQGALFDAADF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 Scaffold_4 AUGUSTUS gene 3544344 3545773 0.08 + . g683 Scaffold_4 AUGUSTUS transcript 3544344 3545773 0.08 + . g683.t1 Scaffold_4 AUGUSTUS start_codon 3544344 3544346 . + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_4 AUGUSTUS CDS 3544344 3544583 0.31 + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_4 AUGUSTUS CDS 3544992 3545138 0.44 + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_4 AUGUSTUS CDS 3545237 3545773 0.68 + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_4 AUGUSTUS stop_codon 3545771 3545773 . + 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MSFVLGKQVVKKRAGGRKKFPEMKDALVDEREDLEQWEGGLNGIIGWEEWKSLIATFERALMWVPNVSSFVFHVFTEN # SSFSDEVGLDVEETLQSNAAVAEADAKETEIEAEAAPASVDGKLIRMAGPADGFAVYKDQAGRLWTGLATYWIKRGEFDRAKETFEKGLDSVLTIRDF # TQIFDAYAEFGESLISAMMESLADEEDEAEAAETEKELDVRMKEFEELMDRRPFLINGVLIRRNPNDVQEWEKLVALHGDDDEKVRYFCVFLNLPSYS # NHLSGSQDLHQGARNRQSSESNRQPPPIICKLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 Scaffold_4 AUGUSTUS gene 3547125 3547349 0.99 + . g684 Scaffold_4 AUGUSTUS transcript 3547125 3547349 0.99 + . g684.t1 Scaffold_4 AUGUSTUS start_codon 3547125 3547127 . + 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_4 AUGUSTUS CDS 3547125 3547349 0.99 + 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_4 AUGUSTUS stop_codon 3547347 3547349 . + 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MAAQQGTRQADNNATEEASDAMAAAEREAGSAPSFVAAKQTALHPQPQPDAAASATATTAANVDEIHISDEEDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 Scaffold_4 AUGUSTUS gene 3549976 3551569 0.13 + . g685 Scaffold_4 AUGUSTUS transcript 3549976 3551569 0.13 + . g685.t1 Scaffold_4 AUGUSTUS start_codon 3549976 3549978 . + 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_4 AUGUSTUS CDS 3549976 3550605 0.52 + 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_4 AUGUSTUS CDS 3550704 3550881 0.41 + 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_4 AUGUSTUS CDS 3550950 3551348 0.52 + 2 transcript_id "g685.t1"; gene_id "g685"; Scaffold_4 AUGUSTUS CDS 3551439 3551569 0.53 + 2 transcript_id "g685.t1"; gene_id "g685"; Scaffold_4 AUGUSTUS stop_codon 3551567 3551569 . + 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MISHHVHSGLSTLRIDVQTYDESPEGNTGTCTLLRHFANRISEDFILLPCDFIPPLSLSLSTILNKHRTESVSDGSVA # TACWFAAQKPDKNSLVEDWGSIPPPVPIVWDDATGTLLQVDTADDLDRNSEELELRMSLLSQYDYFVLYISLVVNRHTSDIRERSFPTAIRIHTYMSV # EDQYWTYCKRRNTLIRSERNSFLGYARCNTNERNDVSLRHSTLRAQAKVYSKSVLHQSDDADASSPFDPESTTDSSSLRVGIVLHPATAGFATPFPNP # IQLLAETTYALPTDPQNRSLIDPKAQISSDTIIGAFTQVSERTTIKKSVIGKHCVLGKMARITGCVLLDHCVIEDGQVFTVTFYFPHLTSILFSAKID # GCILGKNTKVGTKAELTRCVTQAGYEVGSGAGPDESEEDDDDDEEENDDDDDEDDDDEDDDDEDEEEEEEEKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 Scaffold_4 AUGUSTUS gene 3552389 3552796 0.36 - . g686 Scaffold_4 AUGUSTUS transcript 3552389 3552796 0.36 - . g686.t1 Scaffold_4 AUGUSTUS stop_codon 3552389 3552391 . - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_4 AUGUSTUS CDS 3552389 3552670 0.76 - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_4 AUGUSTUS CDS 3552779 3552796 0.36 - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_4 AUGUSTUS start_codon 3552794 3552796 . - 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MKRECVGTKLIPTDFIAPATTHNPIAHSKHHRILLSNFFAQPEALAFGKTEEEVKKELGSGASEALIKSKVFEGNKPS # NSIMFPLLTPATLGEEISAFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 Scaffold_4 AUGUSTUS gene 3552861 3554027 0.74 - . g687 Scaffold_4 AUGUSTUS transcript 3552861 3554027 0.74 - . g687.t1 Scaffold_4 AUGUSTUS stop_codon 3552861 3552863 . - 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_4 AUGUSTUS CDS 3552861 3554027 0.74 - 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_4 AUGUSTUS start_codon 3554025 3554027 . - 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MSGKLASGNTFSSQHNCVLITAPEYDSWKKLQHIYDSERSKLILKDLFAQDPDRFSKFSTDYVSTSGPDVTFLLDYSK # NLITQPILDTLLSLVREAQVESFRNKMFAGEHINTSEDRAVLHVALRNFNDFQIQEAGTDEVASVLEHMKVFSESVRSGEWKGYTGKTINTIVNIGIG # GSDLGPVMVTEALKPYSKRDLTAHFVSNIDGTHIAETLRACDPETTLFIIASKTFTTQETITNAESAKEWFLSSAKDQAHVAKHFVALSTNTKAVTAF # GIAKENMFQFWDWVGGRYSLWSAIGLSIALVIGYDNFEQLLKGAHAMDKHFKETPLEKNLPVLLAVVGIWYNDFYGAQTHALLPYDQYLHKFADYFQQ # VKGLILADPDSTRLMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 Scaffold_4 AUGUSTUS gene 3557327 3558984 0.18 - . g688 Scaffold_4 AUGUSTUS transcript 3557327 3558984 0.18 - . g688.t1 Scaffold_4 AUGUSTUS stop_codon 3557327 3557329 . - 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_4 AUGUSTUS CDS 3557327 3557817 0.71 - 2 transcript_id "g688.t1"; gene_id "g688"; Scaffold_4 AUGUSTUS CDS 3557858 3558252 0.28 - 1 transcript_id "g688.t1"; gene_id "g688"; Scaffold_4 AUGUSTUS CDS 3558371 3558984 0.6 - 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_4 AUGUSTUS start_codon 3558982 3558984 . - 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MFYENHNVVEAATRDTNFDTTAAPQGASVESVQELEYDGEDDDEEDDEEDEEDDDEEDDEEDEEDDSASEGDDLREEL # EEVLEGDFDFKGSYAYSSLFTDAPNPVLDITGVGPIGLPLSPRDAQLIITSATQAPFGHGTETKIDTSVRHTWEIEPARVSFGNAVWQTWMEETVVRG # VATALGVPFSTTPPKCELYKLLLYEQDSHFNSTVKAQNMFATIIVVLPSPYTGGQVHVSHSSSQQVFSFDSNSLLSTAVMAWYTDVQHEVKPITSGYR # LALSYNLVHVTPGVPPPILPDMHSSIISLRRVLKKWRTYKYPDIEPNIMCHILSHKYSPAGLIAQLMPLAAEQEFFVGLANLTYHQTGTADSNGGYGN # YYKRRRGYGRYGYGRYGYYGDSDCDDDDDEEVPGIDEVIDTTLTVDILFDMAGNKPAGSKKISLDLENLVQQDAFEDVDPDEDHYEGYMGNVSCCLCS # TFFQYTDLIPCSILARWNNASLSYKHFRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 Scaffold_4 AUGUSTUS gene 3559929 3560420 0.97 - . g689 Scaffold_4 AUGUSTUS transcript 3559929 3560420 0.97 - . g689.t1 Scaffold_4 AUGUSTUS stop_codon 3559929 3559931 . - 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_4 AUGUSTUS CDS 3559929 3560420 0.97 - 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_4 AUGUSTUS start_codon 3560418 3560420 . - 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MAQQQSLGLPPSFLTTAASSAPAPPSASAPTAQLSSTRRSAPEEISPPPPAKRARSRKSSMSVSSPDTPVDYTASPES # TSATTTPLSASEDKRRRNTAASARFRQKKKEREAALETKAKELQDQVTGLEKECETLRRENNWLKGLVVGVTGAGAAQNSQAATN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 Scaffold_4 AUGUSTUS gene 3561663 3561995 0.16 - . g690 Scaffold_4 AUGUSTUS transcript 3561663 3561995 0.16 - . g690.t1 Scaffold_4 AUGUSTUS stop_codon 3561663 3561665 . - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_4 AUGUSTUS CDS 3561663 3561995 0.16 - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_4 AUGUSTUS start_codon 3561993 3561995 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MGNQGSSYPPPQAVQPQPQWYNHPIAAPQASHPAVPPPPAHPQSQPSPSIPPDQWDEMYLSVLHTQDTNKLKELIAST # DPELIIPLNGTPLVSQAVILTLVHRVSDFSTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 Scaffold_4 AUGUSTUS gene 3564906 3566286 0.72 - . g691 Scaffold_4 AUGUSTUS transcript 3564906 3566286 0.72 - . g691.t1 Scaffold_4 AUGUSTUS stop_codon 3564906 3564908 . - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_4 AUGUSTUS CDS 3564906 3565674 1 - 1 transcript_id "g691.t1"; gene_id "g691"; Scaffold_4 AUGUSTUS CDS 3565802 3566286 0.72 - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_4 AUGUSTUS start_codon 3566284 3566286 . - 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MDNRQNLFSRGSTPPMQQPAQPQQYQLPVQGPHLHHISPGHQIDSLFQQLSSSSPAEHLSADSLSNSMPETSVISLSD # EPVSSGIPTSNITASNSSAADRQSALLNLLSGATGTTATQSNVGNVGTSSQQQPSQPQIPTPPGSAPTHSEAQGKFLLEQLMTGQPTRSSYSGSQQSS # IPDTSSAPPYSGESDFRQYVAHDPAVEHARNVQQPSYQPYQAPYPQPASQPQNRPPSPPKSMFDFVSPFDALTGSGPMKKKSQPAPSVSSANDDSGSW # TAVSGPDPKRQSVDNLLETLARSHIPPPSQPQPHPQIGGQFDPYHEYSYPEQMQIQVPAPPPQQKQAAGSLNRAASPSPSKTQAQRNRAFESPVSQQG # STGNNNANRRDKESSPGPGLTARGSIRGGKGKNIARVNNVNSPGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 Scaffold_4 AUGUSTUS gene 3571207 3571969 0.44 - . g692 Scaffold_4 AUGUSTUS transcript 3571207 3571969 0.44 - . g692.t1 Scaffold_4 AUGUSTUS stop_codon 3571207 3571209 . - 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_4 AUGUSTUS CDS 3571207 3571665 0.92 - 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_4 AUGUSTUS CDS 3571757 3571969 0.49 - 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_4 AUGUSTUS start_codon 3571967 3571969 . - 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MPLYSFDSNPANTTPPSTGNTLSSAQWWATDPGSGSPLTTGPYTIAPPGDAPGWDAAPKKPNTWYTWSEGNLCSPNDL # NTDFTNLTSQWNYDRVPTFTNPFGAVPSATSTNDISLTWNPDTSFMSRQELMSEAQAHDFTSNAFDSANYLQNDIPRSGAYTVEDLDNLFKTRMSLVE # NDPGFPEAEQVSKGQPQFYWARERKRIKKDFCQSITLGMRTGFITML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 Scaffold_4 AUGUSTUS gene 3574571 3575020 0.85 - . g693 Scaffold_4 AUGUSTUS transcript 3574571 3575020 0.85 - . g693.t1 Scaffold_4 AUGUSTUS stop_codon 3574571 3574573 . - 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_4 AUGUSTUS CDS 3574571 3575020 0.85 - 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_4 AUGUSTUS start_codon 3575018 3575020 . - 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MDSLDYSAEKADVNGLSSSKNIQSLLDEASMGSRNKDGLYEVKDWEFEVDNTVSAALKTAEVETMSTNSGTVGTLGSL # FSRLTGSKTLTEQDLKPVLEAMKQHLMKKNVAKEIADKVCEGVGESLIGKKVGGFQSNDGFYVITITSSLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 Scaffold_4 AUGUSTUS gene 3577187 3578068 0.93 + . g694 Scaffold_4 AUGUSTUS transcript 3577187 3578068 0.93 + . g694.t1 Scaffold_4 AUGUSTUS start_codon 3577187 3577189 . + 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_4 AUGUSTUS CDS 3577187 3578068 0.93 + 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_4 AUGUSTUS stop_codon 3578066 3578068 . + 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MSANYGFQVHINDNFAKFSEALFVADRHAREEVRQRSLMQQKLAQKEKASKEENLRMLAQRAREERNGSIPKPTAASQ # AALKSSLAAYGSDSDSDGESGSESVDSAEDEEAKKIRDEMRRDKRREREREMRMSNMGQEQRAKQLARQQNRDISEKVALGLAKPTMSKESMLDSRLF # NQESLSGDFGNDESYNLYDKPLFHGSTAAAAIYKARGNIEQGNEESFGGGTDEGIGKALDNDRFSLGRPQVGFEGASDQEVREGPVQFEKDTSDVFGV # NQFLSEASTGKKRGLDSAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 Scaffold_4 AUGUSTUS gene 3587336 3588436 0.54 - . g695 Scaffold_4 AUGUSTUS transcript 3587336 3588436 0.54 - . g695.t1 Scaffold_4 AUGUSTUS stop_codon 3587336 3587338 . - 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_4 AUGUSTUS CDS 3587336 3588436 0.54 - 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_4 AUGUSTUS start_codon 3588434 3588436 . - 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MRGPGPSRFRSRSPKYPPPKRIKLGSHSIGSPPPVPPSTRSPERIRYRSQSRDSRYRHSRAPSRDQRRNSPGLPTERR # PLRDPDSPRDEGEIREYDTPDRDKLLSQNQRAPSLSREPPSTLPVPEESKTSVLGAKAVTPPTPAKNIVENDVKPHVLPAADPASTALPPSSLPPVPQ # VLPQQSIRSTSPPKHPRNWSESRPTESSLFIPPSIRRGRGRGSGGSYRGGTYRGGGPPDAPRAPRNRGPSQQSTGPDNSEETTVAPSGVNVPSPADTS # NSKAATPPIHPSVEPEESIEQLLKWVNEELIVTDIIQEERRIVDRSKVLRDEVCNLSSCCSLSPFASLSLYPLIKIHFNTNSISPRTNTLTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 Scaffold_4 AUGUSTUS gene 3597169 3597771 0.43 + . g696 Scaffold_4 AUGUSTUS transcript 3597169 3597771 0.43 + . g696.t1 Scaffold_4 AUGUSTUS start_codon 3597169 3597171 . + 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_4 AUGUSTUS CDS 3597169 3597771 0.43 + 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_4 AUGUSTUS stop_codon 3597769 3597771 . + 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MTLLQSIFGGLADPYFTITLGSKLNVNSPSSFTLGQLDRSYATDFSAFFSIPVSKAGANDYTYWKIPLLYVTINSTRL # SLSPSSIQGIQGSQIAVLDTGTTLALGPTRDVQAFWSSVGSAARNDPITGTWQVRCEKALIVGFVFGQGSSYKEFLLDPADISWEEGQSNNGWCLGGV # QANDEVCIPFNVPGTSSSYSDVPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 Scaffold_4 AUGUSTUS gene 3599631 3602320 0.29 + . g697 Scaffold_4 AUGUSTUS transcript 3599631 3602320 0.29 + . g697.t1 Scaffold_4 AUGUSTUS start_codon 3599631 3599633 . + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_4 AUGUSTUS CDS 3599631 3600230 0.33 + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_4 AUGUSTUS CDS 3600327 3600481 0.29 + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_4 AUGUSTUS CDS 3600742 3602320 0.41 + 1 transcript_id "g697.t1"; gene_id "g697"; Scaffold_4 AUGUSTUS stop_codon 3602318 3602320 . + 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MTSHTKIVYRSLSAKVTIFIQVCRELWEFAGDGERYNEKVVHSFLPALFAKWKEAGTNHTVTIVLISRVYYDSNEIEY # AAGPLRRDERGDWYKDFYKVITDLEVIHEWKPTLVSLKNSFWDFQRDILLTHHYHRASLDSSAGGESEQVRLVGRLSYAHDGPILEALNLNLYPSETH # YIDRSLVLTGTTTILITPGTGYFRSPIFSFQGSEPEVRMEKDNGYGVRAMDPLWGGDDEPSGEKTTFWWEPFWVSINKPTVLPTKAEADAFDLDIFAL # KAESKSLAAAKRPPVDTDKNALDNSSTRVSQRSSTMTQINTIEESPVRTSHLLPDVDNALIASPSVLKVPLTSSPRSTSSRRSIRSSTSSMRRIRVED # SSPSRSTLTSKLTPSWIFKPFRSGPVEPQITTESASASVANLSSSASSSSTAALSASVSSRATNPSLFASPSKISIAQASIAQASTGSSSAIATPMAI # KRTISRGGTSRVLDDETILNATRNGLWRRSPLNTPPREEQTFGGKRRSVIGSLTGPFSSSSSSSPSSRPNPSQPQTTLSYSQASLAARWQHTFPVPPS # KHDIKWGSIVTPFCLPLTVEYFPSSAELETSYDVFSYDFVVDPPEMRSFLVLLPSDKKGSSEGQRRAWALVVMRGMAAVRLAQGFQFVIQPPKSGSSK # AAAIIPFRRTQSFLNADEEMSPKPMGAAEVLQNTNDPVYLSMSNEIHRISYTGEAIQVRRLCGVCLQHSLLITQCLIWPKSEWVIQNTRRHSHLMDLR # TTDGTGSWIVNNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 Scaffold_4 AUGUSTUS gene 3605470 3605772 0.75 - . g698 Scaffold_4 AUGUSTUS transcript 3605470 3605772 0.75 - . g698.t1 Scaffold_4 AUGUSTUS stop_codon 3605470 3605472 . - 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_4 AUGUSTUS CDS 3605470 3605772 0.75 - 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_4 AUGUSTUS start_codon 3605770 3605772 . - 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MVSSSTKSKIGVAGYTPQNADSVRGNYGSNFVVFDRMLIHNLQEDLSTFLKEFRPDLPSTLNFITELYDGATNVQDGT # QAGLEAVRISALYDVFPLLSTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 Scaffold_4 AUGUSTUS gene 3613323 3614188 0.94 - . g699 Scaffold_4 AUGUSTUS transcript 3613323 3614188 0.94 - . g699.t1 Scaffold_4 AUGUSTUS stop_codon 3613323 3613325 . - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_4 AUGUSTUS CDS 3613323 3614077 0.94 - 2 transcript_id "g699.t1"; gene_id "g699"; Scaffold_4 AUGUSTUS CDS 3614182 3614188 0.94 - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_4 AUGUSTUS start_codon 3614186 3614188 . - 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MQRLLPILDADEGTRICLAAIAEMQWAFSKSEEREEAIRIIWEDNKLKKQRQDQQHFNAVVGHHNIPSLPELELRYQP # HHQQISSSYMIHGQQNGLSPLSLTSPTHSAPNSAPVTACTADGSGANGWPSYTPPGTSSSSNGTPLSTQGSPVFTTNITTIPNSYKNDDNFYHVVGVS # DMDHFSFNAPATPVDPTSMMTAYQRNTTHVSGNNGVVHNGSGYLEYAGGTSATPVLGHAESDGCPAHFVEDVHGFYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 Scaffold_4 AUGUSTUS gene 3615566 3615904 0.65 - . g700 Scaffold_4 AUGUSTUS transcript 3615566 3615904 0.65 - . g700.t1 Scaffold_4 AUGUSTUS stop_codon 3615566 3615568 . - 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_4 AUGUSTUS CDS 3615566 3615904 0.65 - 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_4 AUGUSTUS start_codon 3615902 3615904 . - 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MVLVVWAASFGLDERGIPSDESSGQCDSDSLRSNNRKGGMDMIPTVRSKPNEPDPSAVDEINVRRVRKERSEAMLREV # LELVDIHAIMRRPTWDGVKVLMLILPLLEGEDPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 Scaffold_4 AUGUSTUS gene 3625483 3626199 0.71 + . g701 Scaffold_4 AUGUSTUS transcript 3625483 3626199 0.71 + . g701.t1 Scaffold_4 AUGUSTUS start_codon 3625483 3625485 . + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_4 AUGUSTUS CDS 3625483 3626199 0.71 + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_4 AUGUSTUS stop_codon 3626197 3626199 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MHNVPLIDGEAYAWKTTARKAEEQSLIHERSSTVGADLSPRPSQPQFWQVHNVDDVTDNMHDAPIPRSVPGVGNTPVV # SNISSGKTPGEKSRNATSTINLIPVPEKDFRDYRVGNASASSSKAGSQSPYSSNDSTKGTTEKDGYSTVKGGSTLHDSPGPSAWKEKEGLKQTYDIPV # SDSRSQRSTRRLSESEANDLALAAREEVTDLRRRVELLKQENAELTRRNSGDSSERLPAYNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 Scaffold_4 AUGUSTUS gene 3631773 3632066 0.85 + . g702 Scaffold_4 AUGUSTUS transcript 3631773 3632066 0.85 + . g702.t1 Scaffold_4 AUGUSTUS start_codon 3631773 3631775 . + 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_4 AUGUSTUS CDS 3631773 3632066 0.85 + 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_4 AUGUSTUS stop_codon 3632064 3632066 . + 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MKLAQGEYVAVEKIENTYSSSAAVAQLFVHGDSLQSYLVGVVIPDPLHLSAIASRLSSSKVTPDDVKSLGEACKQPEV # VKEFVNILDKEAKKGGLKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 Scaffold_4 AUGUSTUS gene 3635584 3635970 0.63 + . g703 Scaffold_4 AUGUSTUS transcript 3635584 3635970 0.63 + . g703.t1 Scaffold_4 AUGUSTUS start_codon 3635584 3635586 . + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_4 AUGUSTUS CDS 3635584 3635970 0.63 + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_4 AUGUSTUS stop_codon 3635968 3635970 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MFTGLSYSQITGVSLALVSRLIPKANFATAESQAELVEGLLNTTVITPRIIILVTAPSSYPGDNTTSVTEAWRSSLYH # VTAVSSWNWNATKEDKKTAYTQASASIDNLRRITPDAAYQVIMFSVCFDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 Scaffold_4 AUGUSTUS gene 3641945 3642568 0.91 + . g704 Scaffold_4 AUGUSTUS transcript 3641945 3642568 0.91 + . g704.t1 Scaffold_4 AUGUSTUS start_codon 3641945 3641947 . + 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_4 AUGUSTUS CDS 3641945 3642568 0.91 + 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_4 AUGUSTUS stop_codon 3642566 3642568 . + 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MADEQDTDTLLALVSSLTHKGHSTEVMLDALVQAEGNPELASQILISGHLGSEVPAGKKRKRASGLDSWLKGPNHAKP # VSRHASSSSSAGPSSNPPIRKVNRGVDLMAVLKQPPPSKKTAPRKPTLILTSPQMVTEHTPCTMHLSVLPLQLASKLFYSLEQSSRDWQRNKWWLFDR # LVESPHRTAFFVRKTDGVSDDETWHESAQYW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 Scaffold_4 AUGUSTUS gene 3646965 3647529 0.3 + . g705 Scaffold_4 AUGUSTUS transcript 3646965 3647529 0.3 + . g705.t1 Scaffold_4 AUGUSTUS start_codon 3646965 3646967 . + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_4 AUGUSTUS CDS 3646965 3647120 0.38 + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_4 AUGUSTUS CDS 3647209 3647529 0.69 + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_4 AUGUSTUS stop_codon 3647527 3647529 . + 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MYRRKELVIKGETEKNAFQGLTAALAYMHSRGLGALFSFDIEGDVGVDPNHLEYYEEEDVRIVYQSVIEKLLFAVSEE # EEKVLLQRSFETSPVLIKQDSIWPPWPWPPWGGDDGDDDGDNGGKKPVNKTKRVQKLAKEVVKFESEIAHASLDLWAFSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 Scaffold_4 AUGUSTUS gene 3654698 3655315 0.53 + . g706 Scaffold_4 AUGUSTUS transcript 3654698 3655315 0.53 + . g706.t1 Scaffold_4 AUGUSTUS start_codon 3654698 3654700 . + 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_4 AUGUSTUS CDS 3654698 3655315 0.53 + 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_4 AUGUSTUS stop_codon 3655313 3655315 . + 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MQIEEKRPLYTPNVYTPQTPAAIPPLKWTRSSLARYGVPSYTTPYSYQVSLSGLQVDNYADVHPLFEETLDPYSDVFF # FFAPGFGFPSPSYKNEAGEAVLQISSPTEWGPVLPMLLASKCPIFVTGFSPADVERDVRSLSTAPGVAGEFEWVVTPGPNPFGSEKWEVADFDPRIMV # KTNWGIWAIRGKSRDIQERSFFKSLFSNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # command line: # augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000006