# This output was generated with AUGUSTUS (version 3.4.0).
# AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de),
# O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Sources of extrinsic information: M RM 
# Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ...
# saccharomyces version. Using default transition matrix.
# Looks like split/input_1/input_1.fa_chunk_0000005 is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 1678028, name = Scaffold_9) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
Scaffold_9	AUGUSTUS	gene	8897	9178	0.63	-	.	g1
Scaffold_9	AUGUSTUS	transcript	8897	9178	0.63	-	.	g1.t1
Scaffold_9	AUGUSTUS	stop_codon	8897	8899	.	-	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_9	AUGUSTUS	CDS	8897	9178	0.63	-	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_9	AUGUSTUS	start_codon	9176	9178	.	-	0	transcript_id "g1.t1"; gene_id "g1";
# protein sequence = [MPPPDDPAYSGRSKTSATKGPSQSRPWFPHQQSSQGVSYQSGGIPTFNDSQAGGSGNSASEELESHNQWETRYGTRVD
# MLSAFAYILGPLSGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1
###
# start gene g2
Scaffold_9	AUGUSTUS	gene	15700	16125	0.66	-	.	g2
Scaffold_9	AUGUSTUS	transcript	15700	16125	0.66	-	.	g2.t1
Scaffold_9	AUGUSTUS	stop_codon	15700	15702	.	-	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_9	AUGUSTUS	CDS	15700	16125	0.66	-	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_9	AUGUSTUS	start_codon	16123	16125	.	-	0	transcript_id "g2.t1"; gene_id "g2";
# protein sequence = [MSMVNPSYGDGYAYTPTLNGAGNGTRGAVAGFAAPATPAASYNNAPTTPGLTPRTAISNVVNRAAVRCTFVPNLPDEL
# TVLNGEVLNVLQEYDDGWVFCSNGKGETGMVPLECLAYETSSDFWGERLMAGSRRVSSISGRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g2
###
# start gene g3
Scaffold_9	AUGUSTUS	gene	19026	19709	0.68	-	.	g3
Scaffold_9	AUGUSTUS	transcript	19026	19709	0.68	-	.	g3.t1
Scaffold_9	AUGUSTUS	stop_codon	19026	19028	.	-	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_9	AUGUSTUS	CDS	19026	19709	0.68	-	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_9	AUGUSTUS	start_codon	19707	19709	.	-	0	transcript_id "g3.t1"; gene_id "g3";
# protein sequence = [MVSAVQEFFPESGILDDNGAVTPGVLHRQQSNSSIHDVQRLIPLQRVQTGISSIVGSDNGSRPGGFILVIDGAALGDV
# SRFLLLVALAKNFALISPLCLQAFADENNKDLLLRLAMLCEGVICCRVSPLQKALVVKLVKDGLGAMTLAIGDGANDVSMIQVSPQIASMFHVMRSMH
# VSQAADVGVGISGEEGLQAVNSSDYAIAQVNNQYEHVILNCCPKILHSSVF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g3
###
# start gene g4
Scaffold_9	AUGUSTUS	gene	19802	20811	0.19	-	.	g4
Scaffold_9	AUGUSTUS	transcript	19802	20811	0.19	-	.	g4.t1
Scaffold_9	AUGUSTUS	stop_codon	19802	19804	.	-	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_9	AUGUSTUS	CDS	19802	20711	0.48	-	1	transcript_id "g4.t1"; gene_id "g4";
Scaffold_9	AUGUSTUS	CDS	20807	20811	0.19	-	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_9	AUGUSTUS	start_codon	20809	20811	.	-	0	transcript_id "g4.t1"; gene_id "g4";
# protein sequence = [MVFDIRGRSGPSDQETAAATGKQPFFHSNKLSKDISTILHSDSTSPNAALARALNGFFTVLALCHTVLTSVDPDTGKI
# EYKAQSPDEAALVKAAADVGYVFRGREREILYLQTPFTNDKDHLADQKDKYEKYELLNILEFNSTRKRMSVVLRRLDGDDGRVFLLMKGADNVVFDRL
# KAGVDQPLKDQTEMHLSEFANEGLRTLTLAYKIVSDQEYEAWSHRYHEATVALDNREEKIDAVSDELEQNLRLLGATAIEDKLQEGVAETIADLKRAG
# IKIWVATGDKLETAIGMYQLLPDLLSLTLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g4
###
# start gene g5
Scaffold_9	AUGUSTUS	gene	21309	22046	0.3	-	.	g5
Scaffold_9	AUGUSTUS	transcript	21309	22046	0.3	-	.	g5.t1
Scaffold_9	AUGUSTUS	stop_codon	21309	21311	.	-	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_9	AUGUSTUS	CDS	21309	22046	0.3	-	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_9	AUGUSTUS	start_codon	22044	22046	.	-	0	transcript_id "g5.t1"; gene_id "g5";
# protein sequence = [MQPKSRTFVRGLIPKRLRPQAVKPNTVNVERTGGVSDGSNQDQLAMFPEDVEFDEEIPEHERRFSFHSHHVKRPHWKT
# IIWEDVCVGDIVKIRDNESFPADILICATSEDENVAFVETKNLDGETNLKSRTSVPELIHMRTAAACANKENAFSIELDRPDNNMFRLNSTVNIAHAT
# PSRVSADMSNILLRGTVLRNTSWVIGVVLFTGEDTKIVQNSGGTPSKQSKVERQMNPQVYVSFMYDCPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g5
###
# start gene g6
Scaffold_9	AUGUSTUS	gene	24948	26477	0.22	-	.	g6
Scaffold_9	AUGUSTUS	transcript	24948	26477	0.22	-	.	g6.t1
Scaffold_9	AUGUSTUS	stop_codon	24948	24950	.	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_9	AUGUSTUS	CDS	24948	25653	0.59	-	1	transcript_id "g6.t1"; gene_id "g6";
Scaffold_9	AUGUSTUS	CDS	25827	25850	0.63	-	1	transcript_id "g6.t1"; gene_id "g6";
Scaffold_9	AUGUSTUS	CDS	25927	26141	0.33	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_9	AUGUSTUS	CDS	26227	26367	0.38	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_9	AUGUSTUS	CDS	26472	26477	0.47	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_9	AUGUSTUS	start_codon	26475	26477	.	-	0	transcript_id "g6.t1"; gene_id "g6";
# protein sequence = [MISPVDSEQAALITSSGVHISAHRMMMVRRILRSRRTFSVCTSILLNAWKSWIGMHDVVPVWSQISSAVENREGVPDQ
# RNNEGIILLPHEPRSLSSYPHTTICFDAELQHRWRRRDISRVTLSGFCWTQYPGPILVAIPHVSHLSKRLMFFLTLSCPAAFALSSGTVGAAMSSSLS
# KIRSIAISYGTVTHPTPTTYFEPAHILGANIIEHLWHTWGSDEFGLKNNEVDLYNVNIPLIEPILSNEGLKIYWTTMWRTSYGRLFKPISGDSPQSSK
# VNPAGPDTSTSPAEQIQSSTPTESLVFKWSPAMEGLIRPDHSSLVVGSDGWALHHGAVSVTPLRASFAEPVEGIHQFANIEDRIWKVRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g6
###
# start gene g7
Scaffold_9	AUGUSTUS	gene	29355	30320	0.91	-	.	g7
Scaffold_9	AUGUSTUS	transcript	29355	30320	0.91	-	.	g7.t1
Scaffold_9	AUGUSTUS	stop_codon	29355	29357	.	-	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_9	AUGUSTUS	CDS	29355	30320	0.91	-	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_9	AUGUSTUS	start_codon	30318	30320	.	-	0	transcript_id "g7.t1"; gene_id "g7";
# protein sequence = [MIRHLQAIVDDASTLSTKDVAQRAMGVLSTENRKIWSKLRATISSDRHNASCLEIVDRALFIVCLDDGLPMKDDLPQL
# CSNFLCGTYGLEEGIQVGTCTNRWYDKLQIIVCSDGAAGINFEHTGVDGHTVLRCVLNLGPAQPMCINDSLHRFAADIFTECLMLLARSINPAAPTLF
# HAQLSPHAKSYKPPRNAKTTVPEGEPIDTTPKKLEWDLTSELRVGIRFAETRISDLICQNDCQALEFKGYGKNFITSHGFSPDAFVQMALQAAYFGLY
# GRIECVYEPAMTKAFLHGRTEAIRSVQSESIEFTKVDFIFHYILDIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g7
###
# start gene g8
Scaffold_9	AUGUSTUS	gene	33357	33677	0.78	+	.	g8
Scaffold_9	AUGUSTUS	transcript	33357	33677	0.78	+	.	g8.t1
Scaffold_9	AUGUSTUS	start_codon	33357	33359	.	+	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_9	AUGUSTUS	CDS	33357	33677	0.78	+	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_9	AUGUSTUS	stop_codon	33675	33677	.	+	0	transcript_id "g8.t1"; gene_id "g8";
# protein sequence = [MTTLVAPGTPSSNWAYSEDIPGSRCGPDDGPGWPRSYAFLQEEEIWRELRFLAKPQSTQFDAAKGWRADSVNFQPSPT
# TKTQDRYVVKQLEINGKLWTLSGVFDGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g8
###
# start gene g9
Scaffold_9	AUGUSTUS	gene	34003	34969	0.5	+	.	g9
Scaffold_9	AUGUSTUS	transcript	34003	34969	0.5	+	.	g9.t1
Scaffold_9	AUGUSTUS	start_codon	34003	34005	.	+	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_9	AUGUSTUS	CDS	34003	34087	0.79	+	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_9	AUGUSTUS	CDS	34139	34275	0.59	+	2	transcript_id "g9.t1"; gene_id "g9";
Scaffold_9	AUGUSTUS	CDS	34382	34969	0.85	+	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_9	AUGUSTUS	stop_codon	34967	34969	.	+	0	transcript_id "g9.t1"; gene_id "g9";
# protein sequence = [MYGSTALVALVDDTHENLWVANVGDCQAILVSPKGSDDWDIQILTEAHNGDNEAEVERVRREHANEPECVIDRRPPEF
# TRRILYNLLPGFHDTSPWEEFLVRNRTPPYISAQPEITHVLLNDIDPRSTVPGGESLRSSSSPSLPRFLILSSDGFTDLCSTEGQQRIISDWAHGVIS
# TQSMMDEDDSSVDRSNINNILPMSPTVSSFSQTSLSSSPTSSPSTPGYESRNMALRLLRRALGGDDQASVSRVLTLDMDIAWIDDTSIVVQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g9
###
# start gene g10
Scaffold_9	AUGUSTUS	gene	35620	36051	0.97	-	.	g10
Scaffold_9	AUGUSTUS	transcript	35620	36051	0.97	-	.	g10.t1
Scaffold_9	AUGUSTUS	stop_codon	35620	35622	.	-	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_9	AUGUSTUS	CDS	35620	36051	0.97	-	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_9	AUGUSTUS	start_codon	36049	36051	.	-	0	transcript_id "g10.t1"; gene_id "g10";
# protein sequence = [MKFFSLFVPAIVAAFVAADTLQYDPIYDQGSESLDVVACSDGANGLLTKGFTTFNSLPTFPNIGAFGAVTGWNSPECG
# TCWQIVYTNSNGAQTTLNAIAVDHAGAGLINLSEEAMNTLTNGNAVQFGAVPVTATQVASSVCGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g10
###
# start gene g11
Scaffold_9	AUGUSTUS	gene	37425	38561	0.42	-	.	g11
Scaffold_9	AUGUSTUS	transcript	37425	38561	0.42	-	.	g11.t1
Scaffold_9	AUGUSTUS	stop_codon	37425	37427	.	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_9	AUGUSTUS	CDS	37425	37968	0.82	-	1	transcript_id "g11.t1"; gene_id "g11";
Scaffold_9	AUGUSTUS	CDS	38149	38561	0.45	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_9	AUGUSTUS	start_codon	38559	38561	.	-	0	transcript_id "g11.t1"; gene_id "g11";
# protein sequence = [MRSFWLLPLLSLPSALSNSATEQIVFSNGYHPIDQSVVKNVVDQFLSDAKKAILKGKRTCRIGFMMEESISNRMIFFV
# RVPSRILNSFNSNVPPDELVSHPAFGSHQLGSRNQTLCDPSVKQYSGYLDTQEDKHLFFCSSTGLLFELGPCRISDEGRNTTVNPHSWNTHANIIFLD
# QPVEVGYSYSSSGNSVDTSPVAGKDVYAFLELFFVRFPEYSSLPFHIAAESYGGTYAPNIANVIYKQNKELSLATSGSSQLKIINLASVVLANGLTNP
# YVQMGSIADWACEGPYAVYDDPSGPQCEALRTKIPTCQRSDSEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g11
###
# start gene g12
Scaffold_9	AUGUSTUS	gene	40116	41435	0.16	-	.	g12
Scaffold_9	AUGUSTUS	transcript	40116	41435	0.16	-	.	g12.t1
Scaffold_9	AUGUSTUS	stop_codon	40116	40118	.	-	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_9	AUGUSTUS	CDS	40116	40825	0.64	-	2	transcript_id "g12.t1"; gene_id "g12";
Scaffold_9	AUGUSTUS	CDS	41180	41435	0.16	-	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_9	AUGUSTUS	start_codon	41433	41435	.	-	0	transcript_id "g12.t1"; gene_id "g12";
# protein sequence = [MSRVFGWEPPSQQGREDVLCPGSGQGFITFSIDPDSSTGYSPSPTSKIEEAVSRDPPRKGDPGYVPRPPNSFFVFRKE
# YSRLNARGEERVTGSLRRARSHVLDIQPPLPAPSEADSSEWYEYPGTLEVNFSHGSEHQEYLPETQQPPSVSGYGSEPSSNTLTLPAEYPLFTTGLSS
# LAGWNGEPIAPSLTRIPSSTLSTSPLSSWSASSSPYNSYHEAYQYNQSDEQYTGFMPGVNQFGIHESAPAVYWCPQVEHEPRYDLKGGYDSFSSYGND
# FMMQQNALTNFNLGLANEVSAPGNFMPFDMSYVDEQRVFNEYHNTQF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g12
###
# start gene g13
Scaffold_9	AUGUSTUS	gene	44295	45402	0.25	-	.	g13
Scaffold_9	AUGUSTUS	transcript	44295	45402	0.25	-	.	g13.t1
Scaffold_9	AUGUSTUS	stop_codon	44295	44297	.	-	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_9	AUGUSTUS	CDS	44295	44515	0.74	-	2	transcript_id "g13.t1"; gene_id "g13";
Scaffold_9	AUGUSTUS	CDS	44596	45045	0.5	-	2	transcript_id "g13.t1"; gene_id "g13";
Scaffold_9	AUGUSTUS	CDS	45126	45402	0.38	-	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_9	AUGUSTUS	start_codon	45400	45402	.	-	0	transcript_id "g13.t1"; gene_id "g13";
# protein sequence = [MESLDGDELTTDNILSKERAIDKELVVLIQGACKEDNSPSGGVDEIAPQPSDFRYCGKIADFYHLVGFKEKVTVLKRI
# RENSEDRFEAAREKPFQDFGPPPAIYRPGLTRATPSVEGTKFSSSTSQPPSEDTWSDPLAPSTNAPSSEKRKRIDFEDVEMESQSDIGVPMPPPKQSK
# FDKPSRCYSMNTYASRPETNPFARKPAAETNKNPFARKAGNKTILQSESFFEKVDAAETTPAKAKKKKKEGPRQQTLFGLFGANQNEGAKKGSTKRKT
# GLTPPPDEPESQASDITMADASQIETQPDGWEETQLIDDEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g13
###
# start gene g14
Scaffold_9	AUGUSTUS	gene	56161	56505	1	-	.	g14
Scaffold_9	AUGUSTUS	transcript	56161	56505	1	-	.	g14.t1
Scaffold_9	AUGUSTUS	stop_codon	56161	56163	.	-	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_9	AUGUSTUS	CDS	56161	56505	1	-	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_9	AUGUSTUS	start_codon	56503	56505	.	-	0	transcript_id "g14.t1"; gene_id "g14";
# protein sequence = [MSELNSGLELVALFYTFQMAEDEAEHLIHHVACVNSAQLNAATLPGIALEAFSSELDLINSFIDIVIDLDPDIITGWD
# VQNSSWGYLAARARSFGKSRKSLEIRRPVSIMHSRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g14
###
# start gene g15
Scaffold_9	AUGUSTUS	gene	56751	57161	0.8	-	.	g15
Scaffold_9	AUGUSTUS	transcript	56751	57161	0.8	-	.	g15.t1
Scaffold_9	AUGUSTUS	stop_codon	56751	56753	.	-	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_9	AUGUSTUS	CDS	56751	57161	0.8	-	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_9	AUGUSTUS	start_codon	57159	57161	.	-	0	transcript_id "g15.t1"; gene_id "g15";
# protein sequence = [MYSNPPPTTSQLLSTIEDFGLKGRIYRAPYYSNEKDAPLRPREYAGLVYNLKGGEGIALLDDWVSEFSSQETSNSTFS
# YFLQGDLSAGGWEYAGAPPSVKEVRTWLRSFEGQLKQQLPKLPSRTQVSSSTNTLGAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g15
###
# start gene g16
Scaffold_9	AUGUSTUS	gene	57780	58184	0.39	-	.	g16
Scaffold_9	AUGUSTUS	transcript	57780	58184	0.39	-	.	g16.t1
Scaffold_9	AUGUSTUS	stop_codon	57780	57782	.	-	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_9	AUGUSTUS	CDS	57780	58184	0.39	-	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_9	AUGUSTUS	start_codon	58182	58184	.	-	0	transcript_id "g16.t1"; gene_id "g16";
# protein sequence = [MTHDIEDAQSWEGAVMTTFESIEALWEEEYKTWKPRKVEHDKATHSETEVTATVDLLPGEDSVEDDLNIDVDVSFLSV
# EEPPTDDMENVDEDEYLDRPEYNQPEDEFDDGVDDDAVSQNGARSPEGEEDEEISE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g16
###
# start gene g17
Scaffold_9	AUGUSTUS	gene	59444	60456	0.44	-	.	g17
Scaffold_9	AUGUSTUS	transcript	59444	60456	0.44	-	.	g17.t1
Scaffold_9	AUGUSTUS	stop_codon	59444	59446	.	-	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_9	AUGUSTUS	CDS	59444	59902	0.9	-	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_9	AUGUSTUS	CDS	60000	60336	0.46	-	1	transcript_id "g17.t1"; gene_id "g17";
Scaffold_9	AUGUSTUS	CDS	60446	60456	0.77	-	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_9	AUGUSTUS	start_codon	60454	60456	.	-	0	transcript_id "g17.t1"; gene_id "g17";
# protein sequence = [MIIAQNQKPVATEIWRLYFGNDGLWAQTVEKEGEEGHWIGQEAQRNGPNDRVTEIGHIDFDSHNLKKDVLHKFIGFKA
# VSNLEFIKHVLDTIGTMHGVNVRSDWEKWNGLYHDMAEIMIKRIGHEFSPGLDMPKEKEITAPQTAEEVQTPVHLLEVWQIFFGENKGFWAQDHPNGK
# WLGEVAPGICRDAIVIGTVASKSVESWDKVLKKLVGMEASSNLDFIDNVLGDLDTDEQKEKGVTVKLNGKWNGLRQEMIQQGGAQGYPSFLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g17
###
# start gene g18
Scaffold_9	AUGUSTUS	gene	61962	62738	0.79	+	.	g18
Scaffold_9	AUGUSTUS	transcript	61962	62738	0.79	+	.	g18.t1
Scaffold_9	AUGUSTUS	start_codon	61962	61964	.	+	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_9	AUGUSTUS	CDS	61962	62738	0.79	+	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_9	AUGUSTUS	stop_codon	62736	62738	.	+	0	transcript_id "g18.t1"; gene_id "g18";
# protein sequence = [MSSFEDLFTSLELDVIVPESSITYPPSTNTDEWLDQLNIIDRKEAFFDEHLQTLFTLRVPQSELPQNLDTDPPEPSRN
# LLDFLAHVQILLEASYISPIAPNDDSSEYTVSASPLPSSRLNPNIPSSPPPRTSSIKKPTHLNLSGLLSPNSGFGSTSHHPSILPPSTPNPMPASAAV
# DQRYLQAEGVVLTSRIWGQDVSGSGTGLLDRKDQKDTDSEGTEQEREGFYLLWSKRDRAWIAVYMTVLDIGKSVQVYSYFLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g18
###
# start gene g19
Scaffold_9	AUGUSTUS	gene	62903	63958	0.8	+	.	g19
Scaffold_9	AUGUSTUS	transcript	62903	63958	0.8	+	.	g19.t1
Scaffold_9	AUGUSTUS	start_codon	62903	62905	.	+	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_9	AUGUSTUS	CDS	62903	63958	0.8	+	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_9	AUGUSTUS	stop_codon	63956	63958	.	+	0	transcript_id "g19.t1"; gene_id "g19";
# protein sequence = [MSPTSPSTPVNANNNDNEINPTPETDTEISGPPEINLLAGLYAGPTFAPASSLGRRPPSTNNSTPTGTPITTTSKVKA
# GASSESEDDELTLPSTRLGPISRAKLFALPPIEPETPTSSAMITPTPLPGQSALPSAPLSTTGHNRQHTIGGRGKPVLRKSFRKILETASGFKVRMRT
# VFVPAVLLDEGGEENEEDFEDVELGNEGDSGDEGNGNQDDEEENSENYGEDEDPDRLTSGASERTVVLCVEIETEGDPFYRPADAPDFIVEKVDISIT
# GNAAGGGKEEGATARLIGWDTANALARKGGAKRKKKKKQHSSSESQASFPLYLAPHEQHNLLYTLSHSCTHHRKMLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g19
###
# start gene g20
Scaffold_9	AUGUSTUS	gene	64129	66065	0.53	+	.	g20
Scaffold_9	AUGUSTUS	transcript	64129	66065	0.53	+	.	g20.t1
Scaffold_9	AUGUSTUS	start_codon	64129	64131	.	+	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_9	AUGUSTUS	CDS	64129	65308	0.53	+	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_9	AUGUSTUS	CDS	65377	66065	0.99	+	2	transcript_id "g20.t1"; gene_id "g20";
Scaffold_9	AUGUSTUS	stop_codon	66063	66065	.	+	0	transcript_id "g20.t1"; gene_id "g20";
# protein sequence = [MLIVIPLTVPAGTGEQSNKYHYPTPTFVSRWNCVLDLSLSQQVPRRRDDFGNDDYDHTPLPTINALPEPPSPFPVPVS
# ANMGLSPSTSAASSNFPASSSFPSIASVVSPNERRALGSLGFGLDLGLGSGSGNRKSSLGLLAFPSASGPATTSMATTEKRHTLPDLPRILPSHVQSA
# GPGLGYNLGHNLGSTIERPGSALGPSRERRDSAKGGVQGRQRRDSLPISSPGASTSKYTPPSVSAAITAQNLRSPTTYEAPPPPPFKDRGGGGGGLSV
# TIPPSIDQAMGLTPPDAAAMNAPPMTPAYPAFPNNINGAHGALQSHHNAAATVPPSPLSQGPLIPHGGNLPPNSGNVSGVGYVGPSVEVKRERGMGVG
# MGFGGGYGGYGGYGGMGSALGSRRGGPGTGKVFDGDVQGGGGHDEYGGKIDIDGGNGSQSIVVSVGILPQQNIHPPKTSFESSTPLPSSRPSSPSEFP
# ENPSKGDNLNADTLNFSKHTTSTKPELIYPLSTFILDIFVFNRSTWTRRFEISCPDLRSRRKRREVETLTAASRGPGKRRSENVRAGMMKDLSTRIPD
# PGVLPLENRVRIGPLLPSACQSVRMKFLAVSPGVHSIDTLTLTDVESGLAMNLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g20
###
# start gene g21
Scaffold_9	AUGUSTUS	gene	67174	68295	0.73	+	.	g21
Scaffold_9	AUGUSTUS	transcript	67174	68295	0.73	+	.	g21.t1
Scaffold_9	AUGUSTUS	start_codon	67174	67176	.	+	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_9	AUGUSTUS	CDS	67174	68295	0.73	+	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_9	AUGUSTUS	stop_codon	68293	68295	.	+	0	transcript_id "g21.t1"; gene_id "g21";
# protein sequence = [MSTGSMVNIPRLPDEKQLIDEDNWRPFKREILFAVQSRGLTGYMDGTIPKPTPTTENYPRSIYQVVPTPAYSVTPYPE
# EWEVRDRLVAGVIVSNIIDPIGLGVDKTKRASEIWQSLIKRFEKHDEQRIHLAETSLRHKVFDPLTDTMEAHEKKMRNLLRKVHDLGGTMTDAQFRQI
# TIFSMPPDWRQDVRTVPGTSSTEAFTYLQTLWYQREEERKEEERDTKRVKALMAAHAYPQMTHGQPRDQPRQEADPSIICHNCNKAGHIAKKCWAKGG
# GMEGQGPRQNAKPRVNTNSNATITDKTEFTSPMATYVMSVKANSEQSTSETHQCPVPDADPMNRQAHTVLKGGDQRKETGNGIEDVHSYSMVSSKDCT
# I]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g21
###
# start gene g22
Scaffold_9	AUGUSTUS	gene	72059	72832	0.62	-	.	g22
Scaffold_9	AUGUSTUS	transcript	72059	72832	0.62	-	.	g22.t1
Scaffold_9	AUGUSTUS	stop_codon	72059	72061	.	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_9	AUGUSTUS	CDS	72059	72832	0.62	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_9	AUGUSTUS	start_codon	72830	72832	.	-	0	transcript_id "g22.t1"; gene_id "g22";
# protein sequence = [MNFALEPGMPDPPANPVVDYCDDFLLSTDEWTYSELLPGSSSRLNTRVELKPKPASSWNRQVRFINDSDTECDDDINL
# ETSAVPVPFDALKTRYTGGGGDIQLRIWIAGVEANSLRRRLASPYYPDESSPNSETGGPSPALFNGSEQFSINGGAFNAVGGDIHETKNSGNTSFFNC
# IFNSKLSSDPRKQSSSTTTPQNSKSQEKKRKRRWSITKSTHIFHHVYYHYLQPAVIYYPMSWMMYYVPWFVPWCQKCAVVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g22
###
# start gene g23
Scaffold_9	AUGUSTUS	gene	74835	75164	0.98	-	.	g23
Scaffold_9	AUGUSTUS	transcript	74835	75164	0.98	-	.	g23.t1
Scaffold_9	AUGUSTUS	stop_codon	74835	74837	.	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_9	AUGUSTUS	CDS	74835	75164	0.98	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_9	AUGUSTUS	start_codon	75162	75164	.	-	0	transcript_id "g23.t1"; gene_id "g23";
# protein sequence = [MTTVPSPPPVPHLEPSSAAEPARQRLIPKSRFPFSISLPNLRAPPLSKLKWKGKQKETDVEQDLSAAAAADDENAEDP
# STIKLSAPRLTDDDEYQDKYEWAVLYENQRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g23
###
# start gene g24
Scaffold_9	AUGUSTUS	gene	77149	80284	0.4	+	.	g24
Scaffold_9	AUGUSTUS	transcript	77149	80284	0.4	+	.	g24.t1
Scaffold_9	AUGUSTUS	start_codon	77149	77151	.	+	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_9	AUGUSTUS	CDS	77149	79558	0.4	+	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_9	AUGUSTUS	CDS	79674	80284	0.89	+	2	transcript_id "g24.t1"; gene_id "g24";
Scaffold_9	AUGUSTUS	stop_codon	80282	80284	.	+	0	transcript_id "g24.t1"; gene_id "g24";
# protein sequence = [MGIATSKKTSLQRCYLDVVHYLEQCDPQLWKDFKEKASTGYTQIQRVNMHLTHDLQARIRDLIVDLRSSELYKNRPAL
# ASGTISDSITAMGTRYRVPNRSILSEKSQELRERQKQYNEDPSLERMRATRASLPVHSRSEQILSAIEANDVTVLMAATGSGKTTQVPQLLLDSFIEK
# GRGAQCNILCTQPRRLAALSVAHRVSNERGEQLGRSVGYVVRFEAKPPEPHGSINFCTIGVFLKMLQNALSQGQGQMDSITHVVVDEVHERDVDTDLL
# LVVLKRLLDDRKARNKPLKIILMSATIDPTLFRNYFPDDNNLPAPVIEVPGRTFPVQRHFLEDFLQNVSNGPSNWLFNEDNVVKYVIRELGIQALPPY
# VPLQKFDPVRINAESESEVEIPYPLIAATIAHVLSNSDSGHVLTFLAGWDDISAVQKILLNPPGPLSINFNDPKYSIHLLHSSVPLAEQQVIFDPPKE
# GVRRIILATNIAETSVTIPDVVYVVDSARLKEQRFDPEKHISSLVSAWVGSSNLNQRAGRAGRHRPGEYYGVLSQKHAESLQPYQTVEMSRVDLSNVV
# MHIKALNFPGMSVEEVLKATIEPPQTDRVAAAMKTLQMVGAIDEHKNLTSLGRVLLQIPVDVQVGRLVLMGSFFRCLDQALTLAALLTNRDPFISPMH
# MKEVAAAAKNKWCPPGIKSDPLTALRAYNVWEEMQSTRQYQSANRFTVDNFLSKPTLVLIQKLKTHLLQSLYSAGVIDISAGGGLGDGSRYEIPPELN
# QNGDSMMLLASLIAISCQPKFAVRASDRIWRTQTEKVSSFAFVEKRRNVSAGSASSTFLVGTTRLEPLLFALFGAHKMEKEEQGLMLDNWLNLLGNLD
# SLDDIYDLRKYLDSCMSRVFEGIVMGGRKHRNLKVLPREEEEVSESGDDTIDDSRDYSLSKTEVKELDLLSRDLVNILNQYSSERGVDSVPATRPGTP
# LTRPGTPRFSGSGYPGSGYTTPFGHSHSQFNSRASTPTGRAWRRLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g24
###
# start gene g25
Scaffold_9	AUGUSTUS	gene	82467	83438	0.74	+	.	g25
Scaffold_9	AUGUSTUS	transcript	82467	83438	0.74	+	.	g25.t1
Scaffold_9	AUGUSTUS	start_codon	82467	82469	.	+	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_9	AUGUSTUS	CDS	82467	83438	0.74	+	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_9	AUGUSTUS	stop_codon	83436	83438	.	+	0	transcript_id "g25.t1"; gene_id "g25";
# protein sequence = [MNTGYILGEYGHLIANEPGYSPLEQFHILHSKSQFCMAATRSLLLSTYIKWVNVFPEIKPQLVLIFERYRHVLDSELQ
# QRASEFYALAQRPEEDELLQNVCEEMPPFPPRSSALLGRLNKDQGDTEDKRTWIHGGKDANVDRELTRRKTLIQANGSTASHIAIGAPSTQDVMGSLV
# GLDLRHTEVANSSERPNLAVGPNIDRWYEKLMFSSEGVLFEDVQIQIGIKSRYQGHIGQLAIYIGNKVPTPLTSFITAVHVDDPDALSVTFAKLPPNV
# IAPRTQTQQLLHIECKKSIFHTPNPYSVVFGRLTSNNLDTTAYRTHQIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g25
###
# start gene g26
Scaffold_9	AUGUSTUS	gene	83951	86186	0.42	-	.	g26
Scaffold_9	AUGUSTUS	transcript	83951	86186	0.42	-	.	g26.t1
Scaffold_9	AUGUSTUS	stop_codon	83951	83953	.	-	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_9	AUGUSTUS	CDS	83951	84733	0.61	-	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_9	AUGUSTUS	CDS	85344	85497	0.44	-	1	transcript_id "g26.t1"; gene_id "g26";
Scaffold_9	AUGUSTUS	CDS	86047	86186	0.48	-	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_9	AUGUSTUS	start_codon	86184	86186	.	-	0	transcript_id "g26.t1"; gene_id "g26";
# protein sequence = [MWRQVDLTVIQGRNLGNSKPFETLDDDDNDSASEPDPIDLDVYCDILFKRLLTEKWMARNHVSRSSGNNNPIPNDVYV
# LVCAPAHTTLFRGNTILTKINVQKEEFMRGVKGFLADSVPAMVDYIVVVSTPVKDTRTGKTPDWHERSNVINALKLRVSSMPILYRESIPTLPHTLDV
# PRHLALVTSAVIRHSRTYFTEDRPSAEDKDLHEFCARCFEVEEQALLRVSQLAAQLSANQQRRHYSFPYPSTNPIYAHPSSPGPSSPSGRSGRPSTAP
# DAEHSRTRLLPDSPEVTPSGPSSPMTFQPRNKLLHFKSSSTDSIGSRFAKDAPSLPSVLVSTSSSIDVDDAKRKRGLLRGIWRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g26
###
# start gene g27
Scaffold_9	AUGUSTUS	gene	93189	93989	0.67	+	.	g27
Scaffold_9	AUGUSTUS	transcript	93189	93989	0.67	+	.	g27.t1
Scaffold_9	AUGUSTUS	start_codon	93189	93191	.	+	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_9	AUGUSTUS	CDS	93189	93989	0.67	+	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_9	AUGUSTUS	stop_codon	93987	93989	.	+	0	transcript_id "g27.t1"; gene_id "g27";
# protein sequence = [MHQSSSFPKSESSVVCEGTELIRIRSVTTVNCRHLIIDAGHIAIESELADKDTIRAVHLKRSQKYSDEDYKRLEDLMY
# DKMSLRLKSAQVRNRTIVVMPLLMTDFTQFVIGNDLGSCREALKADSHDTLHLLERISIDLQIQNSIVPAALNLARFKISGKLPSLQVNLSDTKYKSL
# MRLVDVCVPKFNDEVESSSRPTEGLEITHFPLVAGTLFSQAEHEYNIDEDDDGDRNAANTSGSQEGEEEFFEADDGVAEVGGLLAFKKYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g27
###
# start gene g28
Scaffold_9	AUGUSTUS	gene	94250	94660	0.33	+	.	g28
Scaffold_9	AUGUSTUS	transcript	94250	94660	0.33	+	.	g28.t1
Scaffold_9	AUGUSTUS	start_codon	94250	94252	.	+	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_9	AUGUSTUS	CDS	94250	94660	0.33	+	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_9	AUGUSTUS	stop_codon	94658	94660	.	+	0	transcript_id "g28.t1"; gene_id "g28";
# protein sequence = [MSMDLVQGESGTMKFMSTESHEEKDLLSVAYVRVQQESPEFAIVYGGIEQSVDVKISTFIFHAAPEPVLMLYDFIMTT
# FVPESDNSSPQLDPQVSSSESNLSAQLTSENERKIKVSVNLASVRGSLNLSCMILIRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g28
###
# start gene g29
Scaffold_9	AUGUSTUS	gene	94806	96269	0.37	+	.	g29
Scaffold_9	AUGUSTUS	transcript	94806	96269	0.37	+	.	g29.t1
Scaffold_9	AUGUSTUS	start_codon	94806	94808	.	+	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_9	AUGUSTUS	CDS	94806	95174	0.51	+	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_9	AUGUSTUS	CDS	95269	95316	0.64	+	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_9	AUGUSTUS	CDS	95424	96269	1	+	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_9	AUGUSTUS	stop_codon	96267	96269	.	+	0	transcript_id "g29.t1"; gene_id "g29";
# protein sequence = [MHSIRTDFDQLMSIEGHNFAEFRYETYDPDDANYAGIKSSISLDAGSVKLHFLERPLHDIYLFLAKLSKLKGLYDAAT
# HAAVQSASDMDTELLQFNISIKSPIVVFPSDPMRSSDMMVMRLGENVFALKIIDDINVTADVSIHISDIKLHLTQIQYGLLIKLSQSISRVLAGAPEG
# ASRAEAAVGFESQPQLAEKERRETLVDVAPEDAPKSWPTLDLVVDVDTVKLHLYDEFATEELNLKEHGIARFALNHNNLRLKLLSAGGGEVQVILKSF
# TINNTRPGNTKFREIIPAASHTRNQFMILYTMAGDADFSSLALLTIDSPRIIFAVDLVFGLIDFFTSASTSDTSEHEIEKVDIARSNQFEAEAGKSSL
# DFRVDLHDVSISVLENDSDLDSQSIQLSIKQILLSQQVTIIAKLIYVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g29
###
# start gene g30
Scaffold_9	AUGUSTUS	gene	102351	103590	0.28	-	.	g30
Scaffold_9	AUGUSTUS	transcript	102351	103590	0.28	-	.	g30.t1
Scaffold_9	AUGUSTUS	stop_codon	102351	102353	.	-	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_9	AUGUSTUS	CDS	102351	103058	1	-	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_9	AUGUSTUS	CDS	103114	103590	0.28	-	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_9	AUGUSTUS	start_codon	103588	103590	.	-	0	transcript_id "g30.t1"; gene_id "g30";
# protein sequence = [MKDAMDTMELERADMIAEVEAQIERALASMAVGVDDSDYGSRPSSRLSNASSAPRSRRPSDAAKSRHLRSFGTESTLA
# DSYEGGEFRGPILAPTERANGTIQEDQEEDEDGADTAEIKRKKRFSASEVDAPQDGMVAVDQGITEKSDKIAQKVFEIQAKLENALSADRRTAKWRGN
# VSNQESEGEFEDSESVPLAPPPRPPRAHRKTKSGEKKTRKRSDTASSTQTSHSTTTTQADDDGISTPPASISRKPLSVKTSGTSTPTHLATSNREQAS
# VRKIASGASLSATRPLSPIQGTPSTPALSPGLPGTTDESDTDFQSAYSVSPRGSYHEYDQHSISEEEQHVMSASGLPVEFGKHAPVFVKPHRDRFSST
# STATATGNDLPSPTHSEATIST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g30
###
# start gene g31
Scaffold_9	AUGUSTUS	gene	104859	105941	0.8	-	.	g31
Scaffold_9	AUGUSTUS	transcript	104859	105941	0.8	-	.	g31.t1
Scaffold_9	AUGUSTUS	stop_codon	104859	104861	.	-	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_9	AUGUSTUS	CDS	104859	105941	0.8	-	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_9	AUGUSTUS	start_codon	105939	105941	.	-	0	transcript_id "g31.t1"; gene_id "g31";
# protein sequence = [MSPNSIHFVFSKLSFCREVEVIASTLQPASTVHTFTFTLPAPNTPLGPTPSGDLLRASVLSDNRSSVTPSFSHPYYGD
# PFARPSTTYLGGPRPGSSATETPDMSSSGGTITYHGVCLLLWSHADAERSTAIRRTLEASRSRKESNQSSLVTSRLKNLRSDALDHSDPTSLARKSAR
# KSARGPWADAETDAETEAEGGISESEYEVASTVGHGPGESTLFLPGDTVFWLPYALTLVSRYPVYDLMRDYLTLSWARFSKDVQSHTLQISKILAHPA
# PRAGELIRLDASPGGDSGSDNSLEVIARFPGGLDFGRGLVDINFTMFPLFKCLNIENILTICEVSDRGSLWLHCRCHKLIFLFRLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g31
###
# start gene g32
Scaffold_9	AUGUSTUS	gene	107482	108135	0.26	-	.	g32
Scaffold_9	AUGUSTUS	transcript	107482	108135	0.26	-	.	g32.t1
Scaffold_9	AUGUSTUS	stop_codon	107482	107484	.	-	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_9	AUGUSTUS	CDS	107482	108135	0.26	-	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_9	AUGUSTUS	start_codon	108133	108135	.	-	0	transcript_id "g32.t1"; gene_id "g32";
# protein sequence = [MPPNTALSIYDNTYALPERGSIDDWIRQMQNSISPSQPGLVADLYSQNRSNSSTNFTSNSPFTIPLRAEGLDLRDPPS
# GVLYPNESADPSVLFGRSRSFDDLLSTYSTFDTSIPLDLSLFNGSNSNPDILSTSNWSLESLQDVATMSDGLDLAGLYRSRSASEVSSEASGQNQNTS
# LDTFSDLGEMSSMSMFYHHNGTGAGGGRSSVKSLPDTLGYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g32
###
# start gene g33
Scaffold_9	AUGUSTUS	gene	110106	111006	0.34	-	.	g33
Scaffold_9	AUGUSTUS	transcript	110106	111006	0.34	-	.	g33.t1
Scaffold_9	AUGUSTUS	stop_codon	110106	110108	.	-	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_9	AUGUSTUS	CDS	110106	110845	0.99	-	2	transcript_id "g33.t1"; gene_id "g33";
Scaffold_9	AUGUSTUS	CDS	110900	110923	1	-	2	transcript_id "g33.t1"; gene_id "g33";
Scaffold_9	AUGUSTUS	CDS	110988	111006	0.35	-	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_9	AUGUSTUS	start_codon	111004	111006	.	-	0	transcript_id "g33.t1"; gene_id "g33";
# protein sequence = [MAIVDITDPTLVCPSAFCFYNLSSIVNGLVYFDQFSLISPLHLGLVALGIVVLLIGVWVVSIQAGGEGTLDVPWVEGC
# ALDEDLAVESFENEDVQSPGEIESGTNVKYGRHEGRSPSMQWGTRSEPTRGIAQSPLDLGRPMSPSSTSSRSPLSPESSEHSSSNIRSSRRRPTTVID
# TRHIRTLSNTQYHTLTNNSNHQHSRPPLSPTLPTVSTLAGTGFQIGLSPFSPGFSVMPLEQKERLAAISGQACLLALVLQIQVQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g33
###
# start gene g34
Scaffold_9	AUGUSTUS	gene	112243	112863	0.99	+	.	g34
Scaffold_9	AUGUSTUS	transcript	112243	112863	0.99	+	.	g34.t1
Scaffold_9	AUGUSTUS	start_codon	112243	112245	.	+	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_9	AUGUSTUS	CDS	112243	112863	0.99	+	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_9	AUGUSTUS	stop_codon	112861	112863	.	+	0	transcript_id "g34.t1"; gene_id "g34";
# protein sequence = [MTSNFDFTDKTQQTLANAIQCAKDYSHAQGMYRSVDLVASTNASFSVHPAHLAFSLLNEDGSLLASVIEKAGGEPSIV
# KRALQKTIVRLPSQSPPPDDTTLSSASLKVLREAQSIQKTMHDSYIAQDHILLALLKDSTISSILKEASLTEATLKTAIEQTRAIVEWNRKPQRKDSM
# RVSEISHYHGTPSNFIPTLQLTSTLSILLH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g34
###
# start gene g35
Scaffold_9	AUGUSTUS	gene	112969	113911	0.52	+	.	g35
Scaffold_9	AUGUSTUS	transcript	112969	113911	0.52	+	.	g35.t1
Scaffold_9	AUGUSTUS	start_codon	112969	112971	.	+	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_9	AUGUSTUS	CDS	112969	113344	0.55	+	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_9	AUGUSTUS	CDS	113397	113911	0.82	+	2	transcript_id "g35.t1"; gene_id "g35";
Scaffold_9	AUGUSTUS	stop_codon	113909	113911	.	+	0	transcript_id "g35.t1"; gene_id "g35";
# protein sequence = [MLLPSYTDNSRCRTKNNPVLIGEPGVGKTSIAEGLAQRIVKRDVPASLFCRLYSLDMGALMAGAKYKGEYEERIKAVL
# NEVEKAAEDGGPGVILFIDELHLIMAGRGASGGGMDAANLFKPLLARGKLRCIGATTLAEYRQYIETDTALERRFAQVVVNEPTVPETISILRGIREK
# YEVHHGVKILDGSLISAAQLAHRYLTSRRLPDAAIDWLMRLVQGELCSFQRDSCDLLKSTSSSVRVTRETEPEAIDKLQRKKLELEVEIHALERRKIM
# QAKSGSNLHGKPSLTSKTSCSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g35
###
# start gene g36
Scaffold_9	AUGUSTUS	gene	113999	115358	0.3	+	.	g36
Scaffold_9	AUGUSTUS	transcript	113999	115358	0.3	+	.	g36.t1
Scaffold_9	AUGUSTUS	start_codon	113999	114001	.	+	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_9	AUGUSTUS	CDS	113999	114011	0.66	+	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_9	AUGUSTUS	CDS	114084	114255	0.36	+	2	transcript_id "g36.t1"; gene_id "g36";
Scaffold_9	AUGUSTUS	CDS	115118	115358	0.45	+	1	transcript_id "g36.t1"; gene_id "g36";
Scaffold_9	AUGUSTUS	stop_codon	115356	115358	.	+	0	transcript_id "g36.t1"; gene_id "g36";
# protein sequence = [MLNETSDLKYYAIPELQARLESLEKKKAAEDAEQGGGADTVTPEQIAEIVARWTSIPVTRLISIGYSPTYGARPLNRA
# IQQELLNPLSVMILANRVQDGETVRVTFDGPHNRLAIIPNHEGNPSDEYMDIDDDDIEIEEMD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g36
###
# start gene g37
Scaffold_9	AUGUSTUS	gene	116086	118302	0.75	+	.	g37
Scaffold_9	AUGUSTUS	transcript	116086	118302	0.75	+	.	g37.t1
Scaffold_9	AUGUSTUS	start_codon	116086	116088	.	+	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_9	AUGUSTUS	CDS	116086	118302	0.75	+	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_9	AUGUSTUS	stop_codon	118300	118302	.	+	0	transcript_id "g37.t1"; gene_id "g37";
# protein sequence = [MNHPRDLSNVLQPADTAQLQQSPLLQLPETRTTITLIYSDVEPRPCPSPVVRVDVPEASGDNPSAPVELSMIAEDDEP
# AERSRLSNLPSQPSPPSGSRISSDTLILDRLADTTEATTYPIHPVDMSTLSSANTFHSISLDSSPILTRLSNAHSAQTNVASSFVADTGTQGVEASAH
# PSHDATATAVELRRSVSRGASPVREETLPLRDEDMIVDSSQHPPPAFPALPGPMLLRKSIRVPRDPSAGLSMATATPGAPVGKRTSWLMKAREVKALE
# NKPTNVVGPSHEISSAKRKSSIMLGDTHSQSQREEEERQPKASKQAVADVAPVNANTSQERQVVVEEGPEVFSEETEPSSTVQLGVLDQFKKTVQGLG
# IGKGKGKSLGGAAAAGALAEAKALAEAKVAERIQMGEEEITRTLEPPTPTEALFAPLLKENSIPVLKRKSNSDRLSISELVLDKNVKGKEKVQEGETS
# SRQKDVILTQVFVPPSGPVFNKPPPVFVPPSPVIKSVPKTNDPPLLPSKYSKPASMAVGLSPSLRLSPVNRPPVVSVQPTLESIHSDRSEMIFDSQDA
# PAWLPSTQETEYEDSQPQTYLNQLDEDDSWPLDEKLPEGVHWNFGGDSTNTWSSSEPNHTDKLFPEHTSTQTMPLESLNRQPSPGTVPGAFEMDIDDI
# DDEFTAADLSIDPGKPTVSLVQVSAHFFYTMRLPRINSLAETGQKPESIVDDIYIVLTVERRSVQSSNKVCE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g37
###
# start gene g38
Scaffold_9	AUGUSTUS	gene	118478	118899	0.33	+	.	g38
Scaffold_9	AUGUSTUS	transcript	118478	118899	0.33	+	.	g38.t1
Scaffold_9	AUGUSTUS	start_codon	118478	118480	.	+	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_9	AUGUSTUS	CDS	118478	118577	0.33	+	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_9	AUGUSTUS	CDS	118688	118899	0.59	+	2	transcript_id "g38.t1"; gene_id "g38";
Scaffold_9	AUGUSTUS	stop_codon	118897	118899	.	+	0	transcript_id "g38.t1"; gene_id "g38";
# protein sequence = [MEIRRQQAIQRKAEEERNKQLEEEKKLKEEVERQSQDEDSTFKRKLPEVKKAPSKMVPAQSSKTAFKPTQKAHGLNSS
# TSTNPLQSSAIAGPSNKAPPAVAKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g38
###
# start gene g39
Scaffold_9	AUGUSTUS	gene	118973	119335	0.97	+	.	g39
Scaffold_9	AUGUSTUS	transcript	118973	119335	0.97	+	.	g39.t1
Scaffold_9	AUGUSTUS	start_codon	118973	118975	.	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_9	AUGUSTUS	CDS	118973	119335	0.97	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_9	AUGUSTUS	stop_codon	119333	119335	.	+	0	transcript_id "g39.t1"; gene_id "g39";
# protein sequence = [MAARVKAQLEAARPEPAIPSESIELPEVDSEYSDSDDEDRVKKFDPPHWAQSPELRQALVDQSSINPDNIFGPIRPLR
# MEEIFRSRNNRFRARTSSANWVGTDQLTLEEEREYARRMGFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g39
###
# start gene g40
Scaffold_9	AUGUSTUS	gene	124326	125263	0.28	+	.	g40
Scaffold_9	AUGUSTUS	transcript	124326	125263	0.28	+	.	g40.t1
Scaffold_9	AUGUSTUS	start_codon	124326	124328	.	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_9	AUGUSTUS	CDS	124326	124474	0.28	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_9	AUGUSTUS	CDS	124534	125263	1	+	1	transcript_id "g40.t1"; gene_id "g40";
Scaffold_9	AUGUSTUS	stop_codon	125261	125263	.	+	0	transcript_id "g40.t1"; gene_id "g40";
# protein sequence = [MPSLVEPARFGGGDGGNIPPPRGARFEASQGLSMGAFPGIVESGWGVRPGTPHPRQQVPPGWDYQAPPPPHSAPGAFY
# HPNLPHPSQMPAHYNNMHSPWAHAHGQGQSTFTPREDGFSSLAWRPPDYDMDRASYVEYGGGAYANGYGRGPPPGSAPPRIGLGLGFEAGGGSENPYT
# DQPMNSGGYFANAGRHHRSHSRNHSRSRQRQEPREDEYGWGAEPAGAWGEDQLDEEDEEEEGMRRARADLMRSMDRGHENATSGSADWDLIDSFSGMG
# IQDGPTRPLETSGSFALS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g40
###
# start gene g41
Scaffold_9	AUGUSTUS	gene	125322	126410	0.39	+	.	g41
Scaffold_9	AUGUSTUS	transcript	125322	126410	0.39	+	.	g41.t1
Scaffold_9	AUGUSTUS	start_codon	125322	125324	.	+	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_9	AUGUSTUS	CDS	125322	126410	0.39	+	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_9	AUGUSTUS	stop_codon	126408	126410	.	+	0	transcript_id "g41.t1"; gene_id "g41";
# protein sequence = [MAPQASTNFNMEPHRSRERMDRLAWPSQNSPYGSNNRLIENQIYGPQDRVRRPRDWRAEYSVKPNIFTRFSPRQWHSS
# DVIEMNDPVKRVPNSLLHRTSSSHPPTFIDLRIPIQTQMQLHAEQRTHFGYGSGGIFPYLNRPPNSIDFAQMACEPASPHMRLYHPRLPWYIDLMSAS
# AIAASRAGAGPSTPGFGVGYGVIGLTVWEVIEGVWRELQKQITSRDFYNEEMGTVMTGGRTRSTSLTSHSPFSSHMPLTPLSSNSALPLSPGHGYDMY
# GQPQPQPTQTARDLVSMAFRSRCKFVGQELFGDSKRAKLDFGHFGEGEAREMSKGVRRVDWLGMEEEWVWTGIVRKSSGMWEIKTRKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g41
###
# start gene g42
Scaffold_9	AUGUSTUS	gene	129541	129906	0.91	-	.	g42
Scaffold_9	AUGUSTUS	transcript	129541	129906	0.91	-	.	g42.t1
Scaffold_9	AUGUSTUS	stop_codon	129541	129543	.	-	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_9	AUGUSTUS	CDS	129541	129906	0.91	-	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_9	AUGUSTUS	start_codon	129904	129906	.	-	0	transcript_id "g42.t1"; gene_id "g42";
# protein sequence = [MHVSFVPGIKFGRRNPTIHGNSGTARRMQKLAGSFIIDNFQITEKEISWKNAYSNEQDLEHVRFRLENVVGGIRSFAI
# AIVDAQSPGSGDAVHGVYKPTVSKTDGNFEELLETFWKKYLKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g42
###
# start gene g43
Scaffold_9	AUGUSTUS	gene	133083	133247	0.48	-	.	g43
Scaffold_9	AUGUSTUS	transcript	133083	133247	0.48	-	.	g43.t1
Scaffold_9	AUGUSTUS	stop_codon	133083	133085	.	-	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_9	AUGUSTUS	CDS	133083	133247	0.48	-	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_9	AUGUSTUS	start_codon	133245	133247	.	-	0	transcript_id "g43.t1"; gene_id "g43";
# protein sequence = [METFAIAIVDTTEFKGGNVLGVFKATGNAEDGDFDGLLKTFKQTYPASAAAGRM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g43
###
# start gene g44
Scaffold_9	AUGUSTUS	gene	134514	135605	0.9	-	.	g44
Scaffold_9	AUGUSTUS	transcript	134514	135605	0.9	-	.	g44.t1
Scaffold_9	AUGUSTUS	stop_codon	134514	134516	.	-	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_9	AUGUSTUS	CDS	134514	135605	0.9	-	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_9	AUGUSTUS	start_codon	135603	135605	.	-	0	transcript_id "g44.t1"; gene_id "g44";
# protein sequence = [MLRAPYMSGTKRKRKTGDRRLRTCVLRPLHNVLAFCKGVPEETVVSVDFSNRGRDGKEAKETRDGKAPPPSSATSSTM
# PSAAASASSASPSLSVPSPVSPNNAHKRESTGKTSGTSGSDEEDWDRLEEYPDGINTHHAHNHASNYSSNTSTTIRGRSPYSHHDGSLPPVPPLPTNA
# LQASGSQTSLSLSSGLGLSGTSVGVPGVPARATRLSNVEENEHPEYPSDSQNDHPDNHRASKTSLLNRTRSGSGTSSPVQSAQSRTITWGNKNLTGSV
# RSMPPQMPQALAPDSDALTTTRSRFSYNPQFSHNSEGVPHITSGASTQQHTKLAMTPENIKPLLENANEVYARLGECIGEIRGLVGGLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g44
###
# start gene g45
Scaffold_9	AUGUSTUS	gene	135794	137165	0.44	-	.	g45
Scaffold_9	AUGUSTUS	transcript	135794	137165	0.44	-	.	g45.t1
Scaffold_9	AUGUSTUS	stop_codon	135794	135796	.	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_9	AUGUSTUS	CDS	135794	136592	0.82	-	1	transcript_id "g45.t1"; gene_id "g45";
Scaffold_9	AUGUSTUS	CDS	136666	137165	0.56	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_9	AUGUSTUS	start_codon	137163	137165	.	-	0	transcript_id "g45.t1"; gene_id "g45";
# protein sequence = [MGTLDPTPTRHHEDTSNANTDRGDSYKHLAAAFYTINSRYKIAWECAELLIELGGGPVGENGSSSGGSGDGNVGGKSG
# AESVPNSPPPHGSGGAGFPGSQGQGHPSTSISAPVALAFGTSQLVQGSQAKKSRERAITLSGDEASSKPGTPTPGIGMGERNYTGSYSSSTYTTYSST
# ATSAPSMTTHITTHAIASTVPTPNMAWRASTGRHDLNQRQLLLLREMLNNEGGSGFVSGGEGFSGGTMQPGGGTVHPSQLGQHPRFDDTHHPNYPSSY
# QTSREQSQHSSPVVTTPPALPTSTTYTHTPHTHTHTHPSVPALEEEQQVNREWRWGDGNHGMNNTNNSTITLPSAPSEESSSMPSSGFGLGGARRVRG
# IGEGSGDAVNKKRKSSRLRGMSGLRDMLRSLTRSQNQVSQYDEWHGCGPQWNGATLNDVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g45
###
# start gene g46
Scaffold_9	AUGUSTUS	gene	139023	139486	0.15	-	.	g46
Scaffold_9	AUGUSTUS	transcript	139023	139486	0.15	-	.	g46.t1
Scaffold_9	AUGUSTUS	stop_codon	139023	139025	.	-	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_9	AUGUSTUS	CDS	139023	139411	0.69	-	2	transcript_id "g46.t1"; gene_id "g46";
Scaffold_9	AUGUSTUS	CDS	139480	139486	0.23	-	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_9	AUGUSTUS	start_codon	139484	139486	.	-	0	transcript_id "g46.t1"; gene_id "g46";
# protein sequence = [MEEDQHQQQQPSSSRANWFFRATSGNGSANTNTNSNSKIMEDEYSTKYDAHQTPKASRTNVYNTSSINPLDIPPSMPS
# TPATPTTPSKLMKRKSFGFVQLRPRNKPINDVDTGNVVGILEVGVPAMLLRCF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g46
###
# start gene g47
Scaffold_9	AUGUSTUS	gene	143422	145428	0.87	-	.	g47
Scaffold_9	AUGUSTUS	transcript	143422	145428	0.87	-	.	g47.t1
Scaffold_9	AUGUSTUS	stop_codon	143422	143424	.	-	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_9	AUGUSTUS	CDS	143422	145428	0.87	-	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_9	AUGUSTUS	start_codon	145426	145428	.	-	0	transcript_id "g47.t1"; gene_id "g47";
# protein sequence = [MDWRDSNPPGERSTKLRRMDLDDDVSSVVSSSTDVHSTGRSSISRMSQLSQMSAISFASVGTVDTFNTFNTIGSSNTV
# DSVGSDPGPSRPSRSRPGIRNRPSLLGLNRVTSAGASLRPSFDNFTTTAPAPPVPPLPTNFPPNFPFSHSYSPHLHTHTPSQHSHNSYHSYRSTHTHS
# PSTPSARSSNSFNNAPSSIDGQLVHDFRNLASMDQEHLTVAESPPQSISPPPMQLLSLSSPSRSQTRSHSHSHSQSQSRPSLSPLRPPSPSLSPSPMP
# ISPQSQYNGSLQVPQISNQRTESLSSRRGQAPPPYLNVSLQQRSTSYSPRSVSGSDTTPNTYEPEREYGIHGVQYGGQREFSGNTALDEEAYERGRER
# SEEYYGRSGPDPGGGATGPGYTDYHHTYTNHSPNPKPNDPHLNLNPPTQPMRNKRSADEIYSNSYVTTINPNTNDEMINPIFKVVSYSYTSWDVDMGG
# LTVKPESPTSSSTTTTTTTSPTTTSPSSATSSSMKFVAYYDDDNGVYGDDEKPPLSTPPLPTPTSANPTEDSFDSVDTMDTRETRHSIDSMDTFDSGA
# SYDSTMEYTFHINPTYFGNGASNGTLHNNAYSGNGNGVAYNNTYERSPSASLAPSLAPSLPPFAELDAVAGGGGYEYPPLSPMSFTSPSEVVEEARAV
# EN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g47
###
# start gene g48
Scaffold_9	AUGUSTUS	gene	155199	155486	0.43	-	.	g48
Scaffold_9	AUGUSTUS	transcript	155199	155486	0.43	-	.	g48.t1
Scaffold_9	AUGUSTUS	stop_codon	155199	155201	.	-	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_9	AUGUSTUS	CDS	155199	155486	0.43	-	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_9	AUGUSTUS	start_codon	155484	155486	.	-	0	transcript_id "g48.t1"; gene_id "g48";
# protein sequence = [MARKFDVKNADLWKNEYSVHSPDSGHVRFQVAYADGGNSHGGGHCGNAMFQWIGVVDRDNPSDHDSIRCTVMDATHAD
# GGFEGLLRVHRARFPSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g48
###
# start gene g49
Scaffold_9	AUGUSTUS	gene	160155	160726	0.68	-	.	g49
Scaffold_9	AUGUSTUS	transcript	160155	160726	0.68	-	.	g49.t1
Scaffold_9	AUGUSTUS	stop_codon	160155	160157	.	-	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_9	AUGUSTUS	CDS	160155	160581	0.82	-	1	transcript_id "g49.t1"; gene_id "g49";
Scaffold_9	AUGUSTUS	CDS	160704	160726	0.68	-	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_9	AUGUSTUS	start_codon	160724	160726	.	-	0	transcript_id "g49.t1"; gene_id "g49";
# protein sequence = [MSQARTSREYVLKDAAFDEMQVVRFFMEGTVSSHKAGFEFVATNNGNKIERVEYPASSGQHSLESFMLRVDQVQLGNF
# ACVDNMFNIEFLQRVTNKPIDSDLIFVLTILRSIGLGYSPVWRGLYEEMIRVRNAWFARHSHILLGNTPYA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g49
###
# start gene g50
Scaffold_9	AUGUSTUS	gene	163657	164004	0.82	+	.	g50
Scaffold_9	AUGUSTUS	transcript	163657	164004	0.82	+	.	g50.t1
Scaffold_9	AUGUSTUS	start_codon	163657	163659	.	+	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_9	AUGUSTUS	CDS	163657	164004	0.82	+	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_9	AUGUSTUS	stop_codon	164002	164004	.	+	0	transcript_id "g50.t1"; gene_id "g50";
# protein sequence = [MELKQRRKQVDKANELGEEISLRLSTSSFGLKEIWRISRIFTKSNRNKSTQKSNTGLDKPDDGVDDPTVLDNTRESQK
# ETDVKRAVLLAMNDVADLHERIKKFVPSVFHDLQRLC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g50
###
# start gene g51
Scaffold_9	AUGUSTUS	gene	164274	164711	0.69	+	.	g51
Scaffold_9	AUGUSTUS	transcript	164274	164711	0.69	+	.	g51.t1
Scaffold_9	AUGUSTUS	start_codon	164274	164276	.	+	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_9	AUGUSTUS	CDS	164274	164711	0.69	+	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_9	AUGUSTUS	stop_codon	164709	164711	.	+	0	transcript_id "g51.t1"; gene_id "g51";
# protein sequence = [MNCVLRYSRQERIPPAFQDVPTDAEFAMEIISRRIAAGLDVNPSKRSSQKSRPSPVALGEIKTEDATSSSTPTTPGGS
# KPEKGKDVDWKKWGERAAIGKAWMVDKKLVSKKPDVSVSHGIFPLSLTCLEIDFRYFSCSITTYFVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g51
###
# start gene g52
Scaffold_9	AUGUSTUS	gene	172786	173298	0.54	-	.	g52
Scaffold_9	AUGUSTUS	transcript	172786	173298	0.54	-	.	g52.t1
Scaffold_9	AUGUSTUS	stop_codon	172786	172788	.	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_9	AUGUSTUS	CDS	172786	173298	0.54	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_9	AUGUSTUS	start_codon	173296	173298	.	-	0	transcript_id "g52.t1"; gene_id "g52";
# protein sequence = [MQQYYGSYPTQSNYYSQPYDGAGPYNGYTPYTPQPQAPVWGSTPYAPNAGLPPPMQMQSGAPPPTPTAHRSSHRRRTT
# MPSRNTSHPLKSALKPSNSIQMPTPSSPAPLHRKRAMSNPKRDYQNMGMPNAADYTTPFSNQGFHLPEDESSSFLVSYFFPHFIIGCPDIDP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g52
###
# start gene g53
Scaffold_9	AUGUSTUS	gene	174846	175274	0.52	+	.	g53
Scaffold_9	AUGUSTUS	transcript	174846	175274	0.52	+	.	g53.t1
Scaffold_9	AUGUSTUS	start_codon	174846	174848	.	+	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_9	AUGUSTUS	CDS	174846	175274	0.52	+	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_9	AUGUSTUS	stop_codon	175272	175274	.	+	0	transcript_id "g53.t1"; gene_id "g53";
# protein sequence = [MTSRPRVPQPVEYGDPTSNNFWVEYPHGLVDLSRSTHLKDLKISAEKQLDIDTTKEPGAQNILFAGSNTITPTLLPGQ
# LDVQVTGERTVRLDTEKTAVIIIDMQNFFLHKDIRDHPKGLACVDPLMRVVPFFREKNIKILWV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g53
###
# start gene g54
Scaffold_9	AUGUSTUS	gene	178738	179383	0.46	-	.	g54
Scaffold_9	AUGUSTUS	transcript	178738	179383	0.46	-	.	g54.t1
Scaffold_9	AUGUSTUS	stop_codon	178738	178740	.	-	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_9	AUGUSTUS	CDS	178738	179012	0.99	-	2	transcript_id "g54.t1"; gene_id "g54";
Scaffold_9	AUGUSTUS	CDS	179164	179383	0.47	-	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_9	AUGUSTUS	start_codon	179381	179383	.	-	0	transcript_id "g54.t1"; gene_id "g54";
# protein sequence = [MPKSIKPAPPQQSNLHEMWKKPAKKEASLQEQCSAVENATHDLLIGAEGEGSSTRRDSMQDPESSKRKHVGGTVLCFS
# QFPTECYGKLVASSPKSPKTRSLPLSPSPKSKGKAKAKPEQESVHVEEAGVSSAEEDPDEELEEEVEAKDAAAASSKRFHYFFGPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g54
###
# start gene g55
Scaffold_9	AUGUSTUS	gene	188458	189125	0.19	-	.	g55
Scaffold_9	AUGUSTUS	transcript	188458	189125	0.19	-	.	g55.t1
Scaffold_9	AUGUSTUS	stop_codon	188458	188460	.	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_9	AUGUSTUS	CDS	188458	188777	0.62	-	2	transcript_id "g55.t1"; gene_id "g55";
Scaffold_9	AUGUSTUS	CDS	188860	189017	0.49	-	1	transcript_id "g55.t1"; gene_id "g55";
Scaffold_9	AUGUSTUS	CDS	189112	189125	0.49	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_9	AUGUSTUS	start_codon	189123	189125	.	-	0	transcript_id "g55.t1"; gene_id "g55";
# protein sequence = [MSAQPDNPFFQVTYTHGEKSLTLEPLKGQINPDACDYTVGKVKVEVRLAKVAQGRWGALANSASTSTPTPARSQKKNW
# DALTTDILSAEKEKSMEEDPNVGGDSAVNPFFQKLFADADDDTKRAMMKSYSESGGTTLSTNWDEVSKGHVDVKPPEGQEWKKWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g55
###
# start gene g56
Scaffold_9	AUGUSTUS	gene	192386	193766	0.24	+	.	g56
Scaffold_9	AUGUSTUS	transcript	192386	193766	0.24	+	.	g56.t1
Scaffold_9	AUGUSTUS	start_codon	192386	192388	.	+	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_9	AUGUSTUS	CDS	192386	193002	0.45	+	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_9	AUGUSTUS	CDS	193115	193766	0.6	+	1	transcript_id "g56.t1"; gene_id "g56";
Scaffold_9	AUGUSTUS	stop_codon	193764	193766	.	+	0	transcript_id "g56.t1"; gene_id "g56";
# protein sequence = [MNAGKSHTYFSWASINAWVPPVYMKTPVPPPLFSYSNASRPPPPLASHDPSDAWQDLSSPQPQAWVRPDFVVKVDDDA
# FVMLAELEARLRLEMHAKPPVDGSSSPRNTIHRRSDTPPRHNNGSYRKLLNVQTNTYSTFQDQDPLIYWGYLVTNRLHRFMAGELYALSWSLVDWVAR
# DPSVKELTRGAEDKQTAKWMKMHPQAEKVRYGHGFLFPSEVRRVRKSMSSALKHLLQFEASSSLPSSLSWDTETQAIALPSSDSEQFDTNELLTPYGR
# TPASWAQSSVSTFHVRYTPPVSDLGTLESIEALVEGSEMSSIQPDTTSSLSTTSTQDAVSRAWANREGRNARYEGKRVGGTIVVHFIKQNTWFLETAL
# ALLEGRIIPRRNLRNRIFWRIATLMRLKISSMVNGLSVLWICHSLPMLKQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g56
###
# start gene g57
Scaffold_9	AUGUSTUS	gene	194271	194758	0.43	+	.	g57
Scaffold_9	AUGUSTUS	transcript	194271	194758	0.43	+	.	g57.t1
Scaffold_9	AUGUSTUS	start_codon	194271	194273	.	+	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_9	AUGUSTUS	CDS	194271	194317	0.43	+	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_9	AUGUSTUS	CDS	194467	194758	0.92	+	1	transcript_id "g57.t1"; gene_id "g57";
Scaffold_9	AUGUSTUS	stop_codon	194756	194758	.	+	0	transcript_id "g57.t1"; gene_id "g57";
# protein sequence = [MSPAERTTPWTLSRLFNYLLVSLPEVAKAGTYLGSSCARNTLVDIKPEALAKATIVGYAISYILTRLNKLSIPITAVT
# TARLDSWGVLLLYQVATSTDGADACHAYPVMSSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g57
###
# start gene g58
Scaffold_9	AUGUSTUS	gene	200083	200784	0.51	-	.	g58
Scaffold_9	AUGUSTUS	transcript	200083	200784	0.51	-	.	g58.t1
Scaffold_9	AUGUSTUS	stop_codon	200083	200085	.	-	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_9	AUGUSTUS	CDS	200083	200374	0.52	-	1	transcript_id "g58.t1"; gene_id "g58";
Scaffold_9	AUGUSTUS	CDS	200424	200611	0.76	-	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_9	AUGUSTUS	CDS	200665	200784	0.75	-	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_9	AUGUSTUS	start_codon	200782	200784	.	-	0	transcript_id "g58.t1"; gene_id "g58";
# protein sequence = [MDIDNGPISGDDLPEQGDKSPAVYKRHPLYYFEDANLFLKAQDSGFIYAVYKGMMAKFSETFEACFTFPQPQGKEEGT
# IFDNPILLPIDAAAFDVLCSFIFHLGWKSQSNRSTDELLALGRISQFLQCPDALKFAIAGLRFHSYDFNGGKKMFYASTFGVPKWGYSATREILTSVY
# GVGGCCSGVLSEFTSMSKLILPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g58
###
# start gene g59
Scaffold_9	AUGUSTUS	gene	202364	202891	0.69	+	.	g59
Scaffold_9	AUGUSTUS	transcript	202364	202891	0.69	+	.	g59.t1
Scaffold_9	AUGUSTUS	start_codon	202364	202366	.	+	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_9	AUGUSTUS	CDS	202364	202891	0.69	+	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_9	AUGUSTUS	stop_codon	202889	202891	.	+	0	transcript_id "g59.t1"; gene_id "g59";
# protein sequence = [MDDCEGLDTDTIEHLYGTDGPEVLRPPGHTGAGYLNDEGESTPSNASSDSEGDNDSDVEGFDTRIDNVAQASSRQFLP
# KPVKTPRHICPLTNEEMAIFNEALQLAVAQGIVPVGYGICPEEWKDNHYPSIEIIQTGRKGAKEISVQLPDFIWRPRAHLWTLGLNILEHIVENRTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g59
###
# start gene g60
Scaffold_9	AUGUSTUS	gene	202911	203249	0.86	-	.	g60
Scaffold_9	AUGUSTUS	transcript	202911	203249	0.86	-	.	g60.t1
Scaffold_9	AUGUSTUS	stop_codon	202911	202913	.	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_9	AUGUSTUS	CDS	202911	203249	0.86	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_9	AUGUSTUS	start_codon	203247	203249	.	-	0	transcript_id "g60.t1"; gene_id "g60";
# protein sequence = [MTAKDFDSLYPSSGKKRAHSPASDDESSEDESTSQAPPPRKKSQRLSAKKDVSPPVFDIAWHDNDVEEAGAVEVDNTS
# GDDYGSPRPSSPILASVPTNVWDLNRKLEYFTTD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g60
###
# start gene g61
Scaffold_9	AUGUSTUS	gene	208152	210567	0.19	+	.	g61
Scaffold_9	AUGUSTUS	transcript	208152	210567	0.19	+	.	g61.t1
Scaffold_9	AUGUSTUS	start_codon	208152	208154	.	+	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_9	AUGUSTUS	CDS	208152	208297	0.19	+	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_9	AUGUSTUS	CDS	209655	210567	0.78	+	1	transcript_id "g61.t1"; gene_id "g61";
Scaffold_9	AUGUSTUS	stop_codon	210565	210567	.	+	0	transcript_id "g61.t1"; gene_id "g61";
# protein sequence = [MDTSSVPRALPLNDASNSRTSPTLDPLSSREFGFKESPTAVQPPARSSSTHNYAQDSLTQGTLPKALDQGKAKDGALL
# GHPFYYEHSEADYEPQEDPGLANENPFPSDQHREDSADPDSLLEALLDELLNDRKLDDRKLGEREWDDCERDNSEPSERDNSEPSERDNRERDDRKWD
# DRKLDDHEWDDRELDDRELDDPDFDTRRACDSHQKEDAIFLSDLDPLILSLSEEEQRGPLVNSTAGQPGSRTDPVSSHFATAHEDPASRKRRRLRESL
# GEEVPARVAVPGVADARPDCNRNGASASRKRLRVNHRTNPASGERGRRRRRILDSSFFMKPAFTPALHPKRLPMHLWG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g61
###
# start gene g62
Scaffold_9	AUGUSTUS	gene	215840	216811	0.14	+	.	g62
Scaffold_9	AUGUSTUS	transcript	215840	216811	0.14	+	.	g62.t1
Scaffold_9	AUGUSTUS	start_codon	215840	215842	.	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_9	AUGUSTUS	CDS	215840	215858	0.57	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_9	AUGUSTUS	CDS	215977	216306	0.96	+	2	transcript_id "g62.t1"; gene_id "g62";
Scaffold_9	AUGUSTUS	CDS	216365	216492	0.24	+	2	transcript_id "g62.t1"; gene_id "g62";
Scaffold_9	AUGUSTUS	CDS	216599	216811	0.35	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_9	AUGUSTUS	stop_codon	216809	216811	.	+	0	transcript_id "g62.t1"; gene_id "g62";
# protein sequence = [MSGTSFFSISVVATLETIPTSTQRLWRTATIFSREQAIDPVVALERLKAQDETAKKDRKGKGKALFFLASDSGSSESS
# NELEPESPAALSSTQKLKRKRSSVDDEALEERNSKRPKTKEYIEISDLDENSAKVRFTDSEDEEESSEGVNDHGTVHFSFGALRKLKVKLFDSGKSET
# RELISYVVSLKDESRRSSSSSGSSTASSEQDAGKDRVDEDDDDEEEDSWDNWT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g62
###
# start gene g63
Scaffold_9	AUGUSTUS	gene	223226	223950	0.72	+	.	g63
Scaffold_9	AUGUSTUS	transcript	223226	223950	0.72	+	.	g63.t1
Scaffold_9	AUGUSTUS	start_codon	223226	223228	.	+	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_9	AUGUSTUS	CDS	223226	223634	0.72	+	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_9	AUGUSTUS	CDS	223697	223950	0.87	+	2	transcript_id "g63.t1"; gene_id "g63";
Scaffold_9	AUGUSTUS	stop_codon	223948	223950	.	+	0	transcript_id "g63.t1"; gene_id "g63";
# protein sequence = [MSSSSASVTSTTTGSGDDSAPTNISNSSTSSASSTTTATATTSSERLSSLSSSAPSNPTSSSQSDLPSSSRTSAGSST
# QAANGILVPSTSSSTSNSSSKGPSSTPPVPSGQSQSSVDGGQVAANSAGSIGTAGSTSVEVVTTQTFPSSTVTSTITGHPDSTLSTPSGITVSSNGRL
# STTFPALITVVSTSTNANGAETVWTSIVANPTNEVSGDVADAHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g63
###
# start gene g64
Scaffold_9	AUGUSTUS	gene	224197	225144	0.83	+	.	g64
Scaffold_9	AUGUSTUS	transcript	224197	225144	0.83	+	.	g64.t1
Scaffold_9	AUGUSTUS	start_codon	224197	224199	.	+	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_9	AUGUSTUS	CDS	224197	225144	0.83	+	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_9	AUGUSTUS	stop_codon	225142	225144	.	+	0	transcript_id "g64.t1"; gene_id "g64";
# protein sequence = [MRSMSQTSRNEQHYHFQSPSPTTAQPFFHSGNPWDIDEEFRSPPGGIVQSNSLGLTSIDATRMSPFSDSQYPHQEHIG
# LAVTTSSPPAHQSRPSLAQSSPSIYPPSIPLPNDNASVYEDIDLMGQSNEPTVTIPNPYIYPSEAVAGPPSPISPGDGPFDDLYSIKPLVPTPVAGYP
# PPPVASPGPRASTAPLRPTRSALREASKVRENHQTLATPPPSLSGHENSAPDVTGRDADSPSPSATSGLSSTEAVTPGPQYSSSTQTNQKQRPRSASK
# SIEDIVMRRTLLDVSCLEMYDSHANNTNNDYLPFAGSSSKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g64
###
# start gene g65
Scaffold_9	AUGUSTUS	gene	226067	226754	0.14	-	.	g65
Scaffold_9	AUGUSTUS	transcript	226067	226754	0.14	-	.	g65.t1
Scaffold_9	AUGUSTUS	stop_codon	226067	226069	.	-	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_9	AUGUSTUS	CDS	226067	226508	0.74	-	1	transcript_id "g65.t1"; gene_id "g65";
Scaffold_9	AUGUSTUS	CDS	226660	226754	0.14	-	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_9	AUGUSTUS	start_codon	226752	226754	.	-	0	transcript_id "g65.t1"; gene_id "g65";
# protein sequence = [METNELRYDMAKTYVGAGCAGVEAAAMGEETKSCGCRVEVVEVLVVDVELEVEVDEEVVVVEVESVVLLSVVVLLDIE
# VAVDELVSWLVPELVSDCVLDIEETVEVEVGVGVGVEVRVSEELVTVVAVEARDSEVLVTAEVEISDVLISVEVEDSTVLVTEVEASDAESEVLVGAA
# SN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g65
###
# start gene g66
Scaffold_9	AUGUSTUS	gene	227824	228524	0.64	+	.	g66
Scaffold_9	AUGUSTUS	transcript	227824	228524	0.64	+	.	g66.t1
Scaffold_9	AUGUSTUS	start_codon	227824	227826	.	+	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_9	AUGUSTUS	CDS	227824	227934	0.87	+	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_9	AUGUSTUS	CDS	228012	228524	0.67	+	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_9	AUGUSTUS	stop_codon	228522	228524	.	+	0	transcript_id "g66.t1"; gene_id "g66";
# protein sequence = [MGPPTSPPGHPPSSYVPPGASSGPGYIPVANGERGSPCRQLRASSGTWWASQGQTQSENPTKDEPPVAAAENNQRGSH
# ESGAPPPPPRNPRRLIDSPADPGTPSPLPPAAGHRNKPSEDLLGLGALSSGGTWGAQRKTNGSGVKDDSSSVYSNDDDNHLDVGKTLLNRAKSRAQGP
# AKRGGKGLRMRVFLGTTKITLSASEAAVFLE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g66
###
# start gene g67
Scaffold_9	AUGUSTUS	gene	230299	230616	0.83	-	.	g67
Scaffold_9	AUGUSTUS	transcript	230299	230616	0.83	-	.	g67.t1
Scaffold_9	AUGUSTUS	stop_codon	230299	230301	.	-	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_9	AUGUSTUS	CDS	230299	230616	0.83	-	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_9	AUGUSTUS	start_codon	230614	230616	.	-	0	transcript_id "g67.t1"; gene_id "g67";
# protein sequence = [MQSRSVLLKNMFDPEECVSRFDLCLVTAQLFASRESEKDWDKDLADDVKSECEEKYGPVEAIKSRKETQVCWCMDYNK
# RRLNSFFRVKSTSSSTLLKAPRRLFRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g67
###
# start gene g68
Scaffold_9	AUGUSTUS	gene	231512	232472	0.33	-	.	g68
Scaffold_9	AUGUSTUS	transcript	231512	232472	0.33	-	.	g68.t1
Scaffold_9	AUGUSTUS	stop_codon	231512	231514	.	-	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_9	AUGUSTUS	CDS	231512	232355	0.83	-	1	transcript_id "g68.t1"; gene_id "g68";
Scaffold_9	AUGUSTUS	CDS	232420	232472	0.38	-	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_9	AUGUSTUS	start_codon	232470	232472	.	-	0	transcript_id "g68.t1"; gene_id "g68";
# protein sequence = [MSTSPNGKMDVDKSPNPNSRNHSTDTRHTRRSLRSTSRERSDRKDRRRDDRKRPSPDRERYERDRSRERYRERDRERD
# RDRRRGERDYDRHRSDRHRERGESRHSSHRDDRDKEDRRRKRVDDDEVDASERPKKKKTDDDDSVKSAGSPRSSDRRRRPPRDPRDEFDDGPRYGRDR
# YRDDRRNPPPPPRRSPSPPIRRVSLCDVSELISNCKFFRRPSPTYETPVDEPYNPDEPKEDDSEARSVFVSQLAARLTARDLGYFFEEKLGENTVMDS
# RIVTDRLSRRSKGCVSPSHSSLQV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g68
###
# start gene g69
Scaffold_9	AUGUSTUS	gene	234596	235051	0.48	+	.	g69
Scaffold_9	AUGUSTUS	transcript	234596	235051	0.48	+	.	g69.t1
Scaffold_9	AUGUSTUS	start_codon	234596	234598	.	+	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_9	AUGUSTUS	CDS	234596	235051	0.48	+	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_9	AUGUSTUS	stop_codon	235049	235051	.	+	0	transcript_id "g69.t1"; gene_id "g69";
# protein sequence = [MDSLPSDIAVHIANKALKQLSKDAVEPLQIDTSTTSHELHGVFSNGTISTILTAFGSTPKHKLAESLRDYYLSPGALL
# LASPRACRTNEDLHILVEGKPSPPPRLKYSMSLPSTREAVVGGYFMMSSANRAIVQRSWGLLGEISLFSHPSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g69
###
# start gene g70
Scaffold_9	AUGUSTUS	gene	239960	241022	0.83	+	.	g70
Scaffold_9	AUGUSTUS	transcript	239960	241022	0.83	+	.	g70.t1
Scaffold_9	AUGUSTUS	start_codon	239960	239962	.	+	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_9	AUGUSTUS	CDS	239960	239972	0.83	+	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_9	AUGUSTUS	CDS	240082	241022	1	+	2	transcript_id "g70.t1"; gene_id "g70";
Scaffold_9	AUGUSTUS	stop_codon	241020	241022	.	+	0	transcript_id "g70.t1"; gene_id "g70";
# protein sequence = [MTASSRVDKYGRPVSDDHDQENLRRFYRLENEESVESQPSALDYARGEVLLESSDEEEEQNDSDEEDTFVTVGQDSSR
# PISIRNDEAEIDLNESNFEDLDAQAAAYNESNLETDTIPEASRTNRLAIVNLDWDHVRAVHLYKICSSLVSPTASVVSSSSKTSFGSEKRQRNVKSSA
# TTVVRGRVLSVKIYPSQFGKERLAREEKEGPPPEIFKRKQVTDDEEVTDQNIIQVGDENEFDEDALRKYQLERLRYADKYHFTQVVAYTLKRYYYAIL
# TCDTVDAASHIYDELEGTELERSANVFDLSFVPTDMTFEDEPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g70
###
# start gene g71
Scaffold_9	AUGUSTUS	gene	241157	241990	0.77	+	.	g71
Scaffold_9	AUGUSTUS	transcript	241157	241990	0.77	+	.	g71.t1
Scaffold_9	AUGUSTUS	start_codon	241157	241159	.	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_9	AUGUSTUS	CDS	241157	241990	0.77	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_9	AUGUSTUS	stop_codon	241988	241990	.	+	0	transcript_id "g71.t1"; gene_id "g71";
# protein sequence = [MNLTFGFAQALRHSKVKLTWDDDDPTRNQMTRRKISRKELEEADFKAYLASSSSESESDGEDKKKSGSRERLRSLLLG
# GGNDLPEGWNDGDGGGDDGDVDMEVTFAPGLSTTNEDKEETTLEKYQRKMKEKKKEKKEHGSAKATEDEKQVVGADDFFAAASDDDGEINSSDKKSGK
# VKVKKSKTQDVATENELSLLVGSSNVEPQHFNLKSVIKAEKLKGKKLKRGKKKEVDEAELQEDFSIDVNDDRFKAVHENHDFAIDPSNPQYVSFSRLM
# SSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g71
###
# start gene g72
Scaffold_9	AUGUSTUS	gene	246874	247605	0.87	-	.	g72
Scaffold_9	AUGUSTUS	transcript	246874	247605	0.87	-	.	g72.t1
Scaffold_9	AUGUSTUS	stop_codon	246874	246876	.	-	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_9	AUGUSTUS	CDS	246874	247605	0.87	-	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_9	AUGUSTUS	start_codon	247603	247605	.	-	0	transcript_id "g72.t1"; gene_id "g72";
# protein sequence = [MAHEQDASLPSVLSSDQGASAPSPLPLATVPAPSPARFIRHPPRSGTSKPVLSDPYASATTNFTTITKNNHYELTTLD
# ITDSIPRSDTLVSNGSEDAGDGAEDLESQSLLLLEEHSLSHSISPKPSISSTSTLVGSSSHNPVPATQVFARNALPLHLPKLDAYLASLPKPPFSGEK
# TSSKPRMFPPMDKLANSNQSLEDMEMNSKIPPFWRNRKTLLGAAVSLFMGLTVSNTQSICVALSTKH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g72
###
# start gene g73
Scaffold_9	AUGUSTUS	gene	247743	248432	0.95	-	.	g73
Scaffold_9	AUGUSTUS	transcript	247743	248432	0.95	-	.	g73.t1
Scaffold_9	AUGUSTUS	stop_codon	247743	247745	.	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_9	AUGUSTUS	CDS	247743	248432	0.95	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_9	AUGUSTUS	start_codon	248430	248432	.	-	0	transcript_id "g73.t1"; gene_id "g73";
# protein sequence = [MILASPIPKVGGGYKDHDLADISLTWMVVRNILKVDIHTGISDLFNDYKAHVNDSLAMDMKYLGGLLDPMAPWELKSR
# TSAYKKPYPPSHSIVLIKYISPETGIFALSIRAQRPLPTKTDDITHEKIHPSVLHQKDLYPALAQDIRDHPELIGILLPLEKKLSRNWPFNPTVAAAT
# LKSEVPDKGPGPHPLHEHRSLSGKLAHGFAKATSSVLHKVSGDDEEEKNHKSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g73
###
# start gene g74
Scaffold_9	AUGUSTUS	gene	255256	255495	0.93	-	.	g74
Scaffold_9	AUGUSTUS	transcript	255256	255495	0.93	-	.	g74.t1
Scaffold_9	AUGUSTUS	stop_codon	255256	255258	.	-	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_9	AUGUSTUS	CDS	255256	255495	0.93	-	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_9	AUGUSTUS	start_codon	255493	255495	.	-	0	transcript_id "g74.t1"; gene_id "g74";
# protein sequence = [MPSKSPAQILLEKADKKANSSGGWFSSATAKYEEAGDLYQQAANSFKLEKLFKEAGDCFAGEAECRENCKETNEAANA
# W]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g74
###
# start gene g75
Scaffold_9	AUGUSTUS	gene	262119	263447	0.3	+	.	g75
Scaffold_9	AUGUSTUS	transcript	262119	263447	0.3	+	.	g75.t1
Scaffold_9	AUGUSTUS	start_codon	262119	262121	.	+	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_9	AUGUSTUS	CDS	262119	262581	0.44	+	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_9	AUGUSTUS	CDS	262727	262765	0.6	+	2	transcript_id "g75.t1"; gene_id "g75";
Scaffold_9	AUGUSTUS	CDS	262852	262885	0.79	+	2	transcript_id "g75.t1"; gene_id "g75";
Scaffold_9	AUGUSTUS	CDS	263069	263073	0.71	+	1	transcript_id "g75.t1"; gene_id "g75";
Scaffold_9	AUGUSTUS	CDS	263167	263447	0.89	+	2	transcript_id "g75.t1"; gene_id "g75";
Scaffold_9	AUGUSTUS	stop_codon	263445	263447	.	+	0	transcript_id "g75.t1"; gene_id "g75";
# protein sequence = [MLFRATSRTLSKLSNFSRGYLDSSLTRVLDVHPEVLDALASKKPVVALETTLVTHGFPYPTNYDLSNSLESIVRSTGA
# IPATIGIIEGRIKIGLEMAEVERLANPEKPGSVVKISRRDIAPAVALRSSGGTTISATLIFAALAGIKVFATGGLVTMDISADLQELARSDEVATGPW
# SIWSHTQSQLRMNNGALFAVPIPGKFEAAGAEIQLAVDQAVAESEANGISKRGKEATPWLLKRVSELSKGSSLASNIALLENNVRIGKYTFMYFEVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g75
###
# start gene g76
Scaffold_9	AUGUSTUS	gene	263565	265053	0.29	+	.	g76
Scaffold_9	AUGUSTUS	transcript	263565	265053	0.29	+	.	g76.t1
Scaffold_9	AUGUSTUS	start_codon	263565	263567	.	+	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_9	AUGUSTUS	CDS	263565	264103	0.39	+	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_9	AUGUSTUS	CDS	264282	265053	0.54	+	1	transcript_id "g76.t1"; gene_id "g76";
Scaffold_9	AUGUSTUS	stop_codon	265051	265053	.	+	0	transcript_id "g76.t1"; gene_id "g76";
# protein sequence = [MKKSCSSDYVTVGFSATSEQSSRPQPLASKKEPLTIENDHASLLVFGAAAVDISANAFEMAPNFASGSTVPGTIAVSL
# GGVARNIAEASHRVSPKGSVLLVAPIGNDAFGHLLTEGTANFGMRTDGLLLQKNQRTAVCNMIMDSHGGLTTGIADMAILEIEQFQTEVRRINPIRRW
# ILNILFVSQSIHIAYSSTEKSLSFASEPTSVVKSTRILQAVENVSSSASPIDFISPNLIELREIFESANEKSLSSKPDYWTALDNFSLTSRYRMDLEH
# LSRVNVTDKDPSKGTLSFLLDQGAAQMAVRLPFFRHIVIKCGDKGVLVAMRQSPTSQWRSEQSNIQRHQIVNHSDSDTVVLSHFSALPVESLANVTGA
# GDSFVGALASCLVKRPNAFDSSETLTQAIGIAQRAAALTLGSPYAVSPELSILEEAIKNLQYPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g76
###
# start gene g77
Scaffold_9	AUGUSTUS	gene	267981	268457	0.47	+	.	g77
Scaffold_9	AUGUSTUS	transcript	267981	268457	0.47	+	.	g77.t1
Scaffold_9	AUGUSTUS	start_codon	267981	267983	.	+	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_9	AUGUSTUS	CDS	267981	268457	0.47	+	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_9	AUGUSTUS	stop_codon	268455	268457	.	+	0	transcript_id "g77.t1"; gene_id "g77";
# protein sequence = [MVPTAEQVLEDMKLLLDDPDPAMKALALEEAAELDQKLSTILNHTFPSLLVPPSTTANLSAFVELKSGVGGTESSLFL
# ETLLRMYTRFSQSQSWKANVVVSNENEGGGIKDAIIEIKGSNSYDTLRWESGVHRVQRVPATESGGRVHTSTVAVIVCIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g77
###
# start gene g78
Scaffold_9	AUGUSTUS	gene	270404	271799	0.46	-	.	g78
Scaffold_9	AUGUSTUS	transcript	270404	271799	0.46	-	.	g78.t1
Scaffold_9	AUGUSTUS	stop_codon	270404	270406	.	-	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_9	AUGUSTUS	CDS	270404	271286	0.85	-	1	transcript_id "g78.t1"; gene_id "g78";
Scaffold_9	AUGUSTUS	CDS	271378	271799	0.46	-	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_9	AUGUSTUS	start_codon	271797	271799	.	-	0	transcript_id "g78.t1"; gene_id "g78";
# protein sequence = [MLGTSTLKRKVIPEEDEELNQPTRKRPLQASRTATNLSKSSLTAPKHLTQPRAPKLGTSKSTSRITRGTSAPPQSTVP
# KPFSSQTIATRPTGSGRAGPSRTSSDQRLDDLNTRITSMEEARAADTARVAADMDEERAKRIDDELENSRKKHAREIADLEFDLQKKDRLLREANEDL
# RACRNDLEQERETVSSLKSALNAQSNAHLTLTAENRSFQTQFTALQAQYDELLRTNANLILDLEAERQEKIEMRKEATENEAVRRKLHNMVQELKGNI
# RVFCRVRPVLPSDITPSSGYQPTNSPNPSPNEELELIRQELKADISFPDRRDHREINIWSSSESATGQERKESYQFMFDKVNCSFYCSIVNSLDRCIG
# VRTRMHSGRSLRGNFDACSELCGWIQCCIFAYGQTGSGKSFTMEGGAVRVIVILEAYTDPLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g78
###
# start gene g79
Scaffold_9	AUGUSTUS	gene	272103	272918	0.39	-	.	g79
Scaffold_9	AUGUSTUS	transcript	272103	272918	0.39	-	.	g79.t1
Scaffold_9	AUGUSTUS	stop_codon	272103	272105	.	-	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_9	AUGUSTUS	CDS	272103	272918	0.39	-	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_9	AUGUSTUS	start_codon	272916	272918	.	-	0	transcript_id "g79.t1"; gene_id "g79";
# protein sequence = [MSTFPSSLRFVESILKECPDSVEDVMVEADGEWHTSDNTYGSPNWKIKHPPKRSDPPSRKPPSLPKPPLTNGNTASSS
# TIPNGVPKKFDVVTIEDSDDEDEGRVKRELSPSFGNISSASGSQPSVPISRSQTGDVIDLTIDSDDDESPPPPPNAGKRKAPETISPTEPIWKKTKTN
# DYSLLNNGSSRVFSDEYSRIAQHSSRPSASTGASPSIHLSSYNQPSTSASSSPSLPPFHESFPGRPPSANGAPQLPPINGYSSRGSGGSTSRWVQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g79
###
# start gene g80
Scaffold_9	AUGUSTUS	gene	274924	276171	0.22	+	.	g80
Scaffold_9	AUGUSTUS	transcript	274924	276171	0.22	+	.	g80.t1
Scaffold_9	AUGUSTUS	start_codon	274924	274926	.	+	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_9	AUGUSTUS	CDS	274924	275064	0.63	+	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_9	AUGUSTUS	CDS	275953	276171	0.42	+	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_9	AUGUSTUS	stop_codon	276169	276171	.	+	0	transcript_id "g80.t1"; gene_id "g80";
# protein sequence = [MNETSSEPEDEDEVDYDAPRVAQWVDEDILDEDATEAEYSQAPKNNLKELLVRARYDSIAEQGGQRAVKKVIEKKRKK
# IEQKEKKTRPFEKGGFTQGVSSKRPFDNGYDRNREKRRKLE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g80
###
# start gene g81
Scaffold_9	AUGUSTUS	gene	276283	277203	1	+	.	g81
Scaffold_9	AUGUSTUS	transcript	276283	277203	1	+	.	g81.t1
Scaffold_9	AUGUSTUS	start_codon	276283	276285	.	+	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_9	AUGUSTUS	CDS	276283	277203	1	+	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_9	AUGUSTUS	stop_codon	277201	277203	.	+	0	transcript_id "g81.t1"; gene_id "g81";
# protein sequence = [MQHSPERPPVKPLPSFEDGRDTPSQIHDTIRNNIQETESDDIYRGSHPHSPHSYSPDSEDESSSSSSSSSWSLFNGRL
# GAFTNLVSTLEQAISGWRGNSSSTSSSSSHPSLATVTRSQLSRRRKRRASTLDLKHQQSERDFTARISLIKAREESRIVPRQFSLYLAPALRSAGEAL
# LQRPGGVDDHPQRVLLTSSLDSVLSQLDAALKKTTKTRRNRKDLTPSRNFPGITADTHQHLMLPENLKAPSRAASFTDLAALRKSKKGKTREAIEVLS
# ETEKFVHAYNPWFLDVASPTSEDMRAIGKVSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g81
###
# start gene g82
Scaffold_9	AUGUSTUS	gene	284688	285101	0.52	-	.	g82
Scaffold_9	AUGUSTUS	transcript	284688	285101	0.52	-	.	g82.t1
Scaffold_9	AUGUSTUS	stop_codon	284688	284690	.	-	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_9	AUGUSTUS	CDS	284688	285101	0.52	-	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_9	AUGUSTUS	start_codon	285099	285101	.	-	0	transcript_id "g82.t1"; gene_id "g82";
# protein sequence = [MLVIANPPTSTEGQASTQSSDSSSTMQYDQDEPGSLTLWKWLSIKRFFPLGWDKAASRQQVLRGFGSDYQESGIFGSN
# DDIRDYLRDSSVVQDALQLLLPSTDKPIYNTDVIFQSRKRSTFRRLLISEYSTSQYREH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g82
###
# start gene g83
Scaffold_9	AUGUSTUS	gene	287705	289179	1	-	.	g83
Scaffold_9	AUGUSTUS	transcript	287705	289179	1	-	.	g83.t1
Scaffold_9	AUGUSTUS	stop_codon	287705	287707	.	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_9	AUGUSTUS	CDS	287705	288409	1	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_9	AUGUSTUS	CDS	288505	289179	1	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_9	AUGUSTUS	start_codon	289177	289179	.	-	0	transcript_id "g83.t1"; gene_id "g83";
# protein sequence = [MRRPDPRSGPLGTPDIPSTFQFNPTAGVIPFLPQSHTSSNTPTSSRGTTAEPAFVARQQQDGQSPYPHTPQITPSPSF
# QAPSFMQTGAMMPSAFSLNPHLLQMVPNQFQDQNFFMALADVYRANMMNLAALSQFHQPQQPSYSFPEAPPDTTPAPVPAPASSKAKSTESHSGSSMA
# SSSLPSKELSRNDKGKQKASPFPSSSSTRSFSEPQTPIFTRNGKSVMFFKNGGAISNELDKADYAILSSRSKTFATLFRTSTASGTPAVISSFVHDCV
# RKGRVLSHDPKYLVEAPRRQGRPPSDDVGSSKKSEADDVRKGKASHDDIGPSKKRKVEFARKEKVQDTPYAKKKLKAEAEPRGTAFQDIPSAKKSKAE
# VERVSNEREQVKKREISAVDKISESKQRIPSPPPPPESTRVFSNNGGYAYPPLEREYVETYAKVLFERDHLISNAKIAQKLYQKVCA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g83
###
# start gene g84
Scaffold_9	AUGUSTUS	gene	292214	292996	0.48	-	.	g84
Scaffold_9	AUGUSTUS	transcript	292214	292996	0.48	-	.	g84.t1
Scaffold_9	AUGUSTUS	stop_codon	292214	292216	.	-	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_9	AUGUSTUS	CDS	292214	292839	0.76	-	2	transcript_id "g84.t1"; gene_id "g84";
Scaffold_9	AUGUSTUS	CDS	292912	292996	0.57	-	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_9	AUGUSTUS	start_codon	292994	292996	.	-	0	transcript_id "g84.t1"; gene_id "g84";
# protein sequence = [MVVRKASPGPIDASSLRSFSVGLGMHWSRHITNHFSSANGLSRVRTLRLHNFVIDVVHAPDAPLWSALNAVARVELSG
# VSRFSDLLAAKTETGDNEVYFPNLTNIFCDSYESLREIVEITRSRSAVGLSRVEVPSHFEFLPQQEVATKLNAANIELVFVNDKDATKTIVHYDSEDE
# DEDEEDEENLDFDELSWSDDDNYDYDDYDDYDDHDDHDDHDDLFERFGLLEGSDINGWDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g84
###
# start gene g85
Scaffold_9	AUGUSTUS	gene	295390	296220	0.99	-	.	g85
Scaffold_9	AUGUSTUS	transcript	295390	296220	0.99	-	.	g85.t1
Scaffold_9	AUGUSTUS	stop_codon	295390	295392	.	-	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_9	AUGUSTUS	CDS	295390	296220	0.99	-	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_9	AUGUSTUS	start_codon	296218	296220	.	-	0	transcript_id "g85.t1"; gene_id "g85";
# protein sequence = [MLGIRGKTLGIVGYGHIGSQLSVLAEAFGMRVIFFDVVNLMPLGSARQLESLDALLSDADFVTLHVPELPETINMISR
# DQLALMKKGAYLINNARGKVVDIPALIDSLKSGHLAGAALDVFPSEPGSNGSPFDDQVNSWASTLRSLPNVILTPHIGGSTEEAQRMIGQEVSQALLR
# YIGLGSTIGAVNFPEVDLRAITAEEGDHVRVCYVHKNQPGVLKLVNETFAPYNVEKQYSDSKGEVAYLMADIANVSPMDVTRLQESIRRTDANILTRF
# LA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g85
###
# start gene g86
Scaffold_9	AUGUSTUS	gene	297300	298637	0.98	+	.	g86
Scaffold_9	AUGUSTUS	transcript	297300	298637	0.98	+	.	g86.t1
Scaffold_9	AUGUSTUS	start_codon	297300	297302	.	+	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_9	AUGUSTUS	CDS	297300	298637	0.98	+	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_9	AUGUSTUS	stop_codon	298635	298637	.	+	0	transcript_id "g86.t1"; gene_id "g86";
# protein sequence = [MQILFQASEESPNFHGLGVVPTTIDRFDDSAKTVPHMGWNSADLVQSPDVEPAFYYFVHSYCAKYCPADRPDAASWAY
# TTTQYGGEIFISSVRRGNVFGTQFHPEKSGAAGLALIDNWLRTPEAEISASKPESLCSPPTLSLKPRDNLSKRIIACMDVRSDDDGNLIVTKGDQYDV
# REKVPSGHSMQVKTGGAVRNLGKPVTLASKYYAAGADEICLLNITSFRHSPLQDQPMLAVVRAAAECVFVPLTIGGGIKDTIDPDKTKRSALEVASEY
# FRAGADKVSIGSDAVYAAEKLLGSGQKLGDGTSSIETIAHTYGRQAVVVSIDPRRVYVDPTTYDGPHQDELILGSLDSAFESDRGRSWWYACTVSGGR
# ETRSISVCQLARAVETLGAGEILVNSIDRDGTGLGFDSDLLRLIKGCVKVPVVASSGAGRKRTFSRCFRANRC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g86
###
# start gene g87
Scaffold_9	AUGUSTUS	gene	298790	299209	0.49	-	.	g87
Scaffold_9	AUGUSTUS	transcript	298790	299209	0.49	-	.	g87.t1
Scaffold_9	AUGUSTUS	stop_codon	298790	298792	.	-	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_9	AUGUSTUS	CDS	298790	299209	0.49	-	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_9	AUGUSTUS	start_codon	299207	299209	.	-	0	transcript_id "g87.t1"; gene_id "g87";
# protein sequence = [MSTDDLGPVESFPDRQLRTTMDVKCPEKWGFIHGGLHLQVAHHLFPRLPRHNLNKASLMVKEFAKEENLTYVEFGFVS
# ANREVIGVLREVAGLVSSLGQQVKLVAEVASTEAKEAVNKKIAQQEAAFTRSRSGISPSNI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g87
###
# start gene g88
Scaffold_9	AUGUSTUS	gene	300757	301778	0.38	+	.	g88
Scaffold_9	AUGUSTUS	transcript	300757	301778	0.38	+	.	g88.t1
Scaffold_9	AUGUSTUS	start_codon	300757	300759	.	+	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_9	AUGUSTUS	CDS	300757	300914	0.83	+	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_9	AUGUSTUS	CDS	300975	301135	0.46	+	1	transcript_id "g88.t1"; gene_id "g88";
Scaffold_9	AUGUSTUS	CDS	301312	301778	0.95	+	2	transcript_id "g88.t1"; gene_id "g88";
Scaffold_9	AUGUSTUS	stop_codon	301776	301778	.	+	0	transcript_id "g88.t1"; gene_id "g88";
# protein sequence = [MSPQSSNPFSDPPQPPPKNRQHRMPSRPADLENAVVDTVTINGRRMGRSNTAALPPSKAPQLGPRSQSTDSTPSDKQK
# LATPKTKKKGSQHEDAIDRLDITGFGPANSPYPSPRKDLYPTAYYEPPKNKVDAIAEAWGIHEPEPFEEFFAGGGARGDTPASSIYNGRDSHSKRKDG
# REAREAREAYREYLNDQEARSRPTRRRDIPPPQPIFVADASTPSADIPPMGTSPSSPGLPKRSKVLNAPIRKMRDNPNVPVGSEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g88
###
# start gene g89
Scaffold_9	AUGUSTUS	gene	311352	312961	0.94	-	.	g89
Scaffold_9	AUGUSTUS	transcript	311352	312961	0.94	-	.	g89.t1
Scaffold_9	AUGUSTUS	stop_codon	311352	311354	.	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_9	AUGUSTUS	CDS	311352	312176	0.96	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_9	AUGUSTUS	CDS	312383	312961	0.96	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_9	AUGUSTUS	start_codon	312959	312961	.	-	0	transcript_id "g89.t1"; gene_id "g89";
# protein sequence = [MDNIKKLSLRSGWTRSSRDTHEHRAALKLHSYSRKPNGACQGTLPLLHLILLALLSPSQTQENAPSGADVDRLVLQYL
# RAKGHNVAEKAFLSEIEGSSSDAQSARPETINAEELVKTLAVFTQDSSRPGDNALKDSSTVLSELSAINPPALQTLISNISSVGSEEILTENPSDKPE
# GFRELVAWVEGSLDMYRLEAAHSATLHHLSTLLLPAHVQNDELAQRFRDEKYFIRISRSGFGLLLGWLTEGMGGEAMGAGHGFYGEKGKRGRVAVMQV
# VNNHLRFDGNYILMYALIRLKFTWNAVTSSNSASLPPHIWEESTGLTSSLIPHVNGTRSKIYNPQAFNLSKGELKLGPAPIPEDLRTETERVAREKAV
# LEGLPSTQYDISLARPQILPGMVAPTESDMLPLPPNFKSADIEREVNAIRDARKRIRLDPTTLHGLDLTSPQASSVRARALPSICAYTLHDVPEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g89
###
# start gene g90
Scaffold_9	AUGUSTUS	gene	315192	315680	0.19	+	.	g90
Scaffold_9	AUGUSTUS	transcript	315192	315680	0.19	+	.	g90.t1
Scaffold_9	AUGUSTUS	start_codon	315192	315194	.	+	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_9	AUGUSTUS	CDS	315192	315299	0.2	+	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_9	AUGUSTUS	CDS	315354	315680	0.97	+	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_9	AUGUSTUS	stop_codon	315678	315680	.	+	0	transcript_id "g90.t1"; gene_id "g90";
# protein sequence = [MELRIVKPSFKYVAGQWLFIQVPEISKFQWHPVSEAFTITSAPEDPYVSVHIRQVGDFTRALGDRLGAGPSVVAAMTQ
# AAMKGAEKDEKTGMTRGDFVELDSSNLSLPSVRIDGPYGAPAEDVFNVEVAVLIGAGIGKSRQVCV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g90
###
# start gene g91
Scaffold_9	AUGUSTUS	gene	316946	317941	0.42	-	.	g91
Scaffold_9	AUGUSTUS	transcript	316946	317941	0.42	-	.	g91.t1
Scaffold_9	AUGUSTUS	stop_codon	316946	316948	.	-	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_9	AUGUSTUS	CDS	316946	317941	0.42	-	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_9	AUGUSTUS	start_codon	317939	317941	.	-	0	transcript_id "g91.t1"; gene_id "g91";
# protein sequence = [MLRSHPYLVMKPGWIFKPAYTEGLADSRGTLSTIQHAKSYSAIPDNTIRRIGSDKTLPPVPTPTLPYNSTRSVYPNTS
# SPLPPTRTPTDLPGPPIVFITPSPARSKPPQLHIHDDNISSPSTTSSSKWSNRPKRLFHVTNPDDPDVDEDWKPFVYHPPPLPDPNWLPQSQSIAPIH
# NHSPRRTPSTPVLRTQTTSSSMITRSRHASSTVEVPVFYSHGEDEVDTGSFARQRAPQSPQDKRTSAWARPYVEDIYEHLQQFFPHHDIDQPIVNEES
# TLSYSQDERKTGTLQPKKSIRMVAEQRVKRSPSSARNSRRATKLWGSHLEELGGTKF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g91
###
# start gene g92
Scaffold_9	AUGUSTUS	gene	322367	323786	0.12	+	.	g92
Scaffold_9	AUGUSTUS	transcript	322367	323786	0.12	+	.	g92.t1
Scaffold_9	AUGUSTUS	start_codon	322367	322369	.	+	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_9	AUGUSTUS	CDS	322367	323057	0.39	+	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_9	AUGUSTUS	CDS	323130	323246	0.48	+	2	transcript_id "g92.t1"; gene_id "g92";
Scaffold_9	AUGUSTUS	CDS	323297	323402	0.95	+	2	transcript_id "g92.t1"; gene_id "g92";
Scaffold_9	AUGUSTUS	CDS	323453	323786	0.5	+	1	transcript_id "g92.t1"; gene_id "g92";
Scaffold_9	AUGUSTUS	stop_codon	323784	323786	.	+	0	transcript_id "g92.t1"; gene_id "g92";
# protein sequence = [MQTLGMRTLQLSHVRLPPSNLIHPDEQENPHRPAPAIPFGAVQGQPPRQSRPYIVSAIDSSCYVDGLTVAAQPGDVDT
# VDYLLCLSPDLTRIGSLDQLNLPQPAPQPTYSIYSSQNVSSRPPMTEYATLLSIPGRTWAMAPVPQMPIAADVAGINVLNELGTQVSEHPRQFMILTN
# VGVTFLVKRRSLDYLKAVIEELQSEGNVQPIIEFRDRYVCSFPSRISSPIIVSHNPASNTISLGNADLAAVAKQAFYDFGEKPIWSERTVYGKSEHQG
# TAIFSGRREGLALYFSRLVKPIWKIKLVVAGPTNLQLAVQEARLITIQKNLYALKDLLDKNPHLFHSSPGDSAASRAPAMEQEAWKVSFHLRYIETHC
# SSVMIQAEQASIAQLLSLLTRTIEALSFVLLLNDYHFADIMTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g92
###
# start gene g93
Scaffold_9	AUGUSTUS	gene	333964	335041	0.53	-	.	g93
Scaffold_9	AUGUSTUS	transcript	333964	335041	0.53	-	.	g93.t1
Scaffold_9	AUGUSTUS	stop_codon	333964	333966	.	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_9	AUGUSTUS	CDS	333964	334664	0.68	-	2	transcript_id "g93.t1"; gene_id "g93";
Scaffold_9	AUGUSTUS	CDS	334723	335041	0.53	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_9	AUGUSTUS	start_codon	335039	335041	.	-	0	transcript_id "g93.t1"; gene_id "g93";
# protein sequence = [MSSQSWTTSPFQSTQASTLNQLASTSLFTNATHRPQKRRHEPEESENYRQDEVMDRSPTPERPKRAAPKRLRTIPSDS
# ASKEDGTSTDSSSRHATEDKDIDIGVLLATLPPQSLLPILTSLIRSQPSLKSAILPLIPHPTVETATQALAESSKKLREAYPYSNNNSFSTSTSLGFG
# FGTGSGSSGMSESYIQSRLRPHINEFVSTFTSYLPYFTYRSAASSPSTLSTQNKPHPTEVFFFLSNVTGHILSQPQLAQNGIEPLLLSKLSEEWNAWV
# ARVDVVVNREGGMFGSDTVHGWVQRLDEFAAKDSQIGHVMRGVRDQWIGRVGWLVGRTHQHPMES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g93
###
# start gene g94
Scaffold_9	AUGUSTUS	gene	340644	340991	0.96	-	.	g94
Scaffold_9	AUGUSTUS	transcript	340644	340991	0.96	-	.	g94.t1
Scaffold_9	AUGUSTUS	stop_codon	340644	340646	.	-	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_9	AUGUSTUS	CDS	340644	340991	0.96	-	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_9	AUGUSTUS	start_codon	340989	340991	.	-	0	transcript_id "g94.t1"; gene_id "g94";
# protein sequence = [MILPDGASETLQVKDEGFDHDNIISRGSSPGLVRGTSTSRPKSQVGYSGARRPAYPEDEDHEQFYDEAYTKRQTSDAS
# LIHNAVVPAGQSKGYYQDLGEILVFRIQTDVLLKSLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g94
###
# start gene g95
Scaffold_9	AUGUSTUS	gene	341242	341907	0.97	-	.	g95
Scaffold_9	AUGUSTUS	transcript	341242	341907	0.97	-	.	g95.t1
Scaffold_9	AUGUSTUS	stop_codon	341242	341244	.	-	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_9	AUGUSTUS	CDS	341242	341907	0.97	-	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_9	AUGUSTUS	start_codon	341905	341907	.	-	0	transcript_id "g95.t1"; gene_id "g95";
# protein sequence = [MNDRDHDGSVSSSMPNESPESGNSSILSTGSTDALAAQEAIDLLFDQGTEKSNWEPAQPPQVLGELLDSRYMLPLIFP
# SDPRMLSARPGKIPVHEDDKRSPLPTPDPTRSASRASNGSRGAMTWHSRSHKVRDISSGALKWIDGAVSASRWGRLVPDEEVGDVGDVEHHERSETSE
# EEHAAESENGLRVDTRITPLTRKRSARKARASLGGGETTPVELQI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g95
###
# start gene g96
Scaffold_9	AUGUSTUS	gene	344488	344985	1	+	.	g96
Scaffold_9	AUGUSTUS	transcript	344488	344985	1	+	.	g96.t1
Scaffold_9	AUGUSTUS	start_codon	344488	344490	.	+	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_9	AUGUSTUS	CDS	344488	344985	1	+	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_9	AUGUSTUS	stop_codon	344983	344985	.	+	0	transcript_id "g96.t1"; gene_id "g96";
# protein sequence = [MISSSLKRKNNPVTDYADHSEDEQSIGHSVEASDRSEEESIADQDEELDSADEIEGMKPQKSRQTKKRKIRATHASAF
# GATLQTLLNTEAPSSAPLSLKPSIARKRNDEKLEMKAKKVLQVEKKEKEDRGRIRDVIGGWGGESERALRKVAQRGGKSQCFCVRLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g96
###
# start gene g97
Scaffold_9	AUGUSTUS	gene	349466	352187	0.6	+	.	g97
Scaffold_9	AUGUSTUS	transcript	349466	352187	0.6	+	.	g97.t1
Scaffold_9	AUGUSTUS	start_codon	349466	349468	.	+	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_9	AUGUSTUS	CDS	349466	349965	0.6	+	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_9	AUGUSTUS	CDS	350027	352187	0.83	+	1	transcript_id "g97.t1"; gene_id "g97";
Scaffold_9	AUGUSTUS	stop_codon	352185	352187	.	+	0	transcript_id "g97.t1"; gene_id "g97";
# protein sequence = [MRPPTQQMLNTIANAVPPSPITSRRSGAPLPSRPTSPPPPPTPPPIIDRYGNVLPTPPPPPPLSPNRATFPINDDNSL
# TPPARHHIRSGSDAASERERMLQHGQHHHSAKQEFSLGLGERRRQRFEFDDRSSNPESWVFIQKGESIEPETQAHPPSSPAPSQEQARQPIKVDSAYQ
# LFPPAPRGTPPVPTSSGDSRLPQPARTAGQPVPTSWAVNWKGETKTSAEAKPLPSTSSQRRNLKSAQSVDSLRAAFQGGGNVVNHPPNLRPGKGGHNA
# TSSSSRTNSNMTFMSGPYKDGSPIHTLSRPVRPLPIYGGGSQDFPPSSSSAHSRSSPYMISPSSSNILSPEDPFPRPRSAMGDSAFPKRQIPAQSPTR
# GVESAASSMWPYHRPMSPTSRYTRSAATKRSESQTQTQTPPRSPTSPHSPRSFSKRLSDGFGPFSSDTGTMNSNGSGESDATLRKDDNPWLTNLFDDM
# NRIGNSSNGEATLMPPPRQLPDPSSASSTSTTSISPPRSIPTSASSTLSSSSPIVSKSISATTSTSTTPGQPSSLPSFHAFPNEKFNLSAIGTYDASS
# ATILSTGTFDDSDSDDLWNKPLGPVPPVPPLPADLQDLNVMSSFPSKRPPLTVQIENIAGVVKPVSVPSAPGSTPDSSGLAVNGPPQSSSTATPHRQP
# SINDATKESSTKGGKKSRDARQSTFLAASDSEGWWAPRPPPEDMYEKLDQYFPEHDLDKPVIEAASGGTSPTATTTDVGLGPGVPPVPPIPSEKDLPH
# FVRDGRVRDRERISGERERSRIRAKKSIRIVAQEHKKKIDRTSIASHFAPHSDMDTASQNFNHAANMSRKRSTKLWGSKLEEVTTENERYGRSSAGTP
# ESPSGSGPSEHLNLLSLIPNSDTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g97
###
# start gene g98
Scaffold_9	AUGUSTUS	gene	361013	361243	0.6	+	.	g98
Scaffold_9	AUGUSTUS	transcript	361013	361243	0.6	+	.	g98.t1
Scaffold_9	AUGUSTUS	start_codon	361013	361015	.	+	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_9	AUGUSTUS	CDS	361013	361243	0.6	+	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_9	AUGUSTUS	stop_codon	361241	361243	.	+	0	transcript_id "g98.t1"; gene_id "g98";
# protein sequence = [MEAEMKMVFQQKVQEKEAKLKQSEEELYARHKEMKEALEKQRLDLEDKKRKIETGRPITPEKNAVWPGSPLLVIGD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g98
###
# start gene g99
Scaffold_9	AUGUSTUS	gene	362881	363869	0.29	+	.	g99
Scaffold_9	AUGUSTUS	transcript	362881	363869	0.29	+	.	g99.t1
Scaffold_9	AUGUSTUS	start_codon	362881	362883	.	+	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_9	AUGUSTUS	CDS	362881	363507	0.29	+	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_9	AUGUSTUS	CDS	363612	363869	0.99	+	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_9	AUGUSTUS	stop_codon	363867	363869	.	+	0	transcript_id "g99.t1"; gene_id "g99";
# protein sequence = [MLIVRHTETFYPIVEALAECTAYSDLDIVPITFQFWSRLAQVIGKKSSVPPLFAQAYRSVMTVIIKHLQFPPDDMPLS
# GQEAEDFRAFRHVMGDTLKDCCDVLEAEPCLLATYEMISSALSRNQGTLSWQEIEAPLFALRSMGAVVDPKDDNAVPKILQLIPQLPLHPRVRYAALL
# IISRYTEWINIHPNFIQPQLQYISAGFEVADLDHLVEVLPTLRNFLHAVASNLLQDDRRKIYEAIAHVISAMPMEKAAESLKTFSLDILAIIHAVANK
# NSQVTKQELQAASGENFIIW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g99
###
# start gene g100
Scaffold_9	AUGUSTUS	gene	369190	371766	0.69	-	.	g100
Scaffold_9	AUGUSTUS	transcript	369190	371766	0.69	-	.	g100.t1
Scaffold_9	AUGUSTUS	stop_codon	369190	369192	.	-	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_9	AUGUSTUS	CDS	369190	370113	0.97	-	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_9	AUGUSTUS	CDS	371386	371766	0.96	-	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_9	AUGUSTUS	start_codon	371764	371766	.	-	0	transcript_id "g100.t1"; gene_id "g100";
# protein sequence = [MKVIGWSPNLTPERAEAQGVEFIASKQELLGRSDIVSLHLVLSERTTKIINAADLASMKMSAYLINTSRGPLIDEPAL
# VDALKDKKIAGAGLDVFEQEPLPLDHPLRFLDNVTLSPHNGYVNQSNYEISPALTVLTKLIYSLDDEILIDACWAISYLSDGSNDKIQAVIESGVCRR
# LVELLMHNSTSVQTPALRSVGNIVTGDDLQTQVVIASGALPALLALLSSPKDGIRKEACWTISNITAGSPPQIQNVIDANIIPPLINILQNADFKTRK
# EACWAISNATSGGLQEPSQIRYLVSQGCIKPLCDLLTMMDNKVIQVALDGLDNILKVGEMDKAAAGPGGINQYATYVEEAGGMITIHNLQQHDNLDIY
# KKAFNIMDKYFPDDEEVDTAIAAPSVDAQGQFAVSFDVTGINGFRLIFQFSSTPMSLHPRRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g100
###
# start gene g101
Scaffold_9	AUGUSTUS	gene	374142	374783	0.32	-	.	g101
Scaffold_9	AUGUSTUS	transcript	374142	374783	0.32	-	.	g101.t1
Scaffold_9	AUGUSTUS	stop_codon	374142	374144	.	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_9	AUGUSTUS	CDS	374142	374783	0.32	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_9	AUGUSTUS	start_codon	374781	374783	.	-	0	transcript_id "g101.t1"; gene_id "g101";
# protein sequence = [MHSGTTSDLFLRENLEWLGLASNWSKFSATAGLGVIHKGYYEQGMTILGPYLPQNGNESSVPGAAYSEGGALYALGLI
# NAGCGTEVSGYLREALRSAQGEVVQHGAALGLGIAAMGSKNMETFEDLKNILFMDSAVAGEASGYAMGLIMLGTAAEEPVREMLSYARETQHEKIIRG
# LAIGIAFVFYGRQEEANQTVKELLAETVSCRFSPWLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g101
###
# start gene g102
Scaffold_9	AUGUSTUS	gene	379228	379581	0.93	+	.	g102
Scaffold_9	AUGUSTUS	transcript	379228	379581	0.93	+	.	g102.t1
Scaffold_9	AUGUSTUS	start_codon	379228	379230	.	+	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_9	AUGUSTUS	CDS	379228	379581	0.93	+	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_9	AUGUSTUS	stop_codon	379579	379581	.	+	0	transcript_id "g102.t1"; gene_id "g102";
# protein sequence = [MGPDSYCVSPALEAAVASEAAMVNSWPPNEVTVFAAEPNAEPAKVIASPPSEVTIVTTLAPTAKEWMKTNESLYGNSK
# KEVKDSTGDSFEYPIAEACCVRENTSCIACPYTKSTRGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g102
###
# start gene g103
Scaffold_9	AUGUSTUS	gene	386231	387404	0.47	-	.	g103
Scaffold_9	AUGUSTUS	transcript	386231	387404	0.47	-	.	g103.t1
Scaffold_9	AUGUSTUS	stop_codon	386231	386233	.	-	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_9	AUGUSTUS	CDS	386231	386961	1	-	2	transcript_id "g103.t1"; gene_id "g103";
Scaffold_9	AUGUSTUS	CDS	387011	387404	0.47	-	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_9	AUGUSTUS	start_codon	387402	387404	.	-	0	transcript_id "g103.t1"; gene_id "g103";
# protein sequence = [MVNLPIGPQPVTYGCEIVLSDTQSGISTSPLVIRKVDKGRVSADDGGPVSQMQKIALQRVNPDGSRHYLSAAGPIPGT
# TGVVAPPAPGMSTQAGTHPLLFQTPRVREEIKDGIRMLSDEVDDYLCWTIVGISKFQYTFFDSTGKNSQIPDQPITPFPTLFTAPVYRQANNTIELTV
# SNFFYEDPKTRQQATLDVFLGNLGPLPHRVYQTSPSGPMASMPFVQPIPGLPEGVPLDPPGSPTRYIPSGPLHTIVMVEMPPIGDIIKALEEDALPPN
# AEHPDGHSAEVSHPGSRNGSGPPPSIAGRSLPLLFIRSADGVGYHSGRTIACENVFQGIDITGQPPHPGANIDTGWLAAAHNVQTENGLQGLQSWTLR
# IM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g103
###
# start gene g104
Scaffold_9	AUGUSTUS	gene	387435	390453	0.09	-	.	g104
Scaffold_9	AUGUSTUS	transcript	387435	390453	0.09	-	.	g104.t1
Scaffold_9	AUGUSTUS	stop_codon	387435	387437	.	-	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_9	AUGUSTUS	CDS	387435	388130	0.82	-	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_9	AUGUSTUS	CDS	388177	388332	0.76	-	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_9	AUGUSTUS	CDS	389122	390453	0.17	-	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_9	AUGUSTUS	start_codon	390451	390453	.	-	0	transcript_id "g104.t1"; gene_id "g104";
# protein sequence = [MQIELGLIGAVALMGIAVQLRILKVLQRKLNEISQEQKKRDEEAELAVAGGFAHVMREREEWEKEHLNKHGRQESGYS
# SMPLMKDQDGSSSPGLTAEHRSDYTHVAADGRPRYNSGVSEFLAAPTPNDELKRATSRGLQSPGVLPALDLGLGIKDDVPDGFMAKDELSRKVTVADR
# EAEQKRLELMEEINTIRRSIDVLKNGSPEPSSASAAGSRRPSLTSRRTLSMDANSALLPTPSHVRPPREKDPRSRVHSMDLISHNSIGESLGRPTSAP
# LRDNDWDAYIQDRKLLQPPAGVSPPIATTPMTSSHTRIHMPHAVSEALQQRKRRENALGLTGEYSSNNNSSEDIPLTHLDHHRTTSSTGMNNIPVTIL
# PPQKPIIAPTPQRPVASRTRTFEELNERHREKMKVIQSPLTNAENEHAQIQAAKERWERSKALEKEAVTRRLATTSGTPGNQSGPSPSLQAILAASHK
# DGPSNGHIPSWNPSMAVPEVPLPIPNPGKRKLEDVDNEDPQNKMRRVIRDAGPPQDMATRVVPMTTVICLHAAVAQKSYGSEKRFLCPPPVVHIEGPM
# WHMHAQQLSMAVVSETGERSFEQKAPLDNNMTSSFKFLHVTGTAKAKSFQLSLDIAEPHPSAAHNPDSDGLPGRVWASFDSAPVTIISKPSKKTAKTR
# NISSCILAGGPVSLFNRINSQTVRTKYMTIDHAQLCASNVAWSAFNVNVIRRPTEAPNIGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g104
###
# start gene g105
Scaffold_9	AUGUSTUS	gene	391961	393770	0.58	-	.	g105
Scaffold_9	AUGUSTUS	transcript	391961	393770	0.58	-	.	g105.t1
Scaffold_9	AUGUSTUS	stop_codon	391961	391963	.	-	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_9	AUGUSTUS	CDS	391961	393428	0.58	-	1	transcript_id "g105.t1"; gene_id "g105";
Scaffold_9	AUGUSTUS	CDS	393484	393770	0.59	-	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_9	AUGUSTUS	start_codon	393768	393770	.	-	0	transcript_id "g105.t1"; gene_id "g105";
# protein sequence = [MKPFLSTSIFRERRWTRLPTLQKIRLISKAAEIYQHNSPSKPVFSFEDAGLRPPLAQAVYAAFPNVKSPTEIQSTLIS
# SVLEGKDIILQDETGSGKSFGLILALLNKPRMIFTDDPSADRTSDRPAITSLVLVPHRDLAFQMMHWIDLIAQASSDNPPSLASIAQVLVREGRRHIT
# EGLPLIRNEPPHVLIATPASVVEVLREDPNAFRLTELSTVVLDEVDYMIETLPLNNNPSKQHIQKMNKLQMHPGPARALLDEIYEARVKLNAKTRQAL
# GDAPYHSPQLILSSATIRRQLKHYFFSEKQLLNRDVVKIRRSVMRLHGQDELATDEHAIHSVISHHVVVASENGITNIPSAVSAEEKHTHPFRFEEAN
# NGPSNAVSSSSFDRTVDSTAAASRSIGTELYRISVLFAIDGSIFTEFAMTPSPLNQNLLEAVAAVFALDVPSVALLVIPPNASVHRAVYDLREIGVNA
# FGMDVLVQDRGRSYLLQAGGEKKADPKLLVCTTSSIRGIDFPSLTHVFILGFNALIAKDNWTLTLDTYIHLCGRVGRFKKPGKVITVVDERDVSGIDK
# VLHTLDVTPVRLNLLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g105
###
# start gene g106
Scaffold_9	AUGUSTUS	gene	397292	399484	1	-	.	g106
Scaffold_9	AUGUSTUS	transcript	397292	399484	1	-	.	g106.t1
Scaffold_9	AUGUSTUS	stop_codon	397292	397294	.	-	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_9	AUGUSTUS	CDS	397292	399484	1	-	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_9	AUGUSTUS	start_codon	399482	399484	.	-	0	transcript_id "g106.t1"; gene_id "g106";
# protein sequence = [MILRSVSSKSLVLFDFAPNLAIRGLSSSANLAFGKRSGQSRNKPPVIPSSVLKNIRENVTQQLRTRDSVVSDQQADIY
# NHALVQIKEALGKGDAESVRQLWIKLKQLNLAHILDPKLMSMISSLLIKAFLPAPSEPWDSLSQNIVEEVAVAATSCDAEGVATCMLYHIKRNNPDAA
# LSLYGRCTHIMNNREAWDVDETQEGLFEQGELAFGHAELSQSVMQPIRGRVFLLLAAVTAHAMLDTFQEALTICKDTDVRFHNYTTREFLQNLQHDSS
# LRNKVDLYSRRLHLARLISRPTSLSRQIMNLGDTRALTSLRKLYEGIVEGILGPDPFIAADESYLSSEKTVAMTVVGWTSFLTAFLKCSSKESAAQVW
# DDIPRLGLRHDTSMWNALITGQTQSFTDATTTFELMKSRNVTLDALTYRALISSLFNGRRPNLAMERFQEFRAAKITDTPENIMSVYNTVINGLLVTN
# RIEAASSLFQEMQLKGPNPDIVSHNTFLGHYARRNDIRGLGMFISKMGESGVTGDVFTFSTILSALLKMGRQDATEVVFRLMNKQGIKPNTATYSALI
# DHQMREQDEAHLSGALRLLSQMEADPTTAPNIITYTSILAGIHRGPAWLTRQKEEDFTRAILKRMKQHNVKLNTRAYNILIKACLNGNRLDQALSYYE
# EMKRTRMPIFHETWYVLLEGLSGMQEWDVAMEVIKEMSGLYGVRPLGPLHSLVQRVTVSARSKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g106
###
# start gene g107
Scaffold_9	AUGUSTUS	gene	408770	409099	0.83	-	.	g107
Scaffold_9	AUGUSTUS	transcript	408770	409099	0.83	-	.	g107.t1
Scaffold_9	AUGUSTUS	stop_codon	408770	408772	.	-	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_9	AUGUSTUS	CDS	408770	409099	0.83	-	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_9	AUGUSTUS	start_codon	409097	409099	.	-	0	transcript_id "g107.t1"; gene_id "g107";
# protein sequence = [MITQELIKNASPNGDEMLLNGKAPLPGQIVKLPNLARTFREVAENGKDGFYKGRVAEAIVDLIQSKGGVMELEDLAKH
# ETSIVEPIHYTYASELKIYEARLYLERLLII]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g107
###
# start gene g108
Scaffold_9	AUGUSTUS	gene	413339	413602	0.88	+	.	g108
Scaffold_9	AUGUSTUS	transcript	413339	413602	0.88	+	.	g108.t1
Scaffold_9	AUGUSTUS	start_codon	413339	413341	.	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_9	AUGUSTUS	CDS	413339	413602	0.88	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_9	AUGUSTUS	stop_codon	413600	413602	.	+	0	transcript_id "g108.t1"; gene_id "g108";
# protein sequence = [MEEDKYLRSTNSRIEEDSAHPTQYPATKSEIVRVTTSSDNPNSSTNASAIPEATENHYEFPREDYVDDTNVQNSRMWH
# SIQAFLQEM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g108
###
# start gene g109
Scaffold_9	AUGUSTUS	gene	423646	425261	0.37	+	.	g109
Scaffold_9	AUGUSTUS	transcript	423646	425261	0.37	+	.	g109.t1
Scaffold_9	AUGUSTUS	start_codon	423646	423648	.	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_9	AUGUSTUS	CDS	423646	424750	0.4	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_9	AUGUSTUS	CDS	424855	425261	0.69	+	2	transcript_id "g109.t1"; gene_id "g109";
Scaffold_9	AUGUSTUS	stop_codon	425259	425261	.	+	0	transcript_id "g109.t1"; gene_id "g109";
# protein sequence = [MQKQKLKKKTEEEEHGNKESSDKKSSKEPPPPEGGNNGFNTAINWITGLAIAQFIYSNSGSSSSREITWQEFRTAFLD
# KGLVDKLIVINGHKVRVKLHSNATGTMYPGSSIGSGDYYFSIGSVEAFERRLDEAQQELGIPSHERIPVAFTDEVSTFRVLLELAPTVAVIGFLYWLS
# KRGSGSSGSGIFSIGKSRAKLFDKDTEVKVKFKDVAGMDEAKEEIMEFVQFLKEPSKYERLGAKIPRGAILSGPPGTGKTLLAKATAGEASVPFLSVS
# GSEFVEMFVGVGSSRVRDLFASARKHAPCIIFVDEIDAIGKAREKGRSMGGNDERESTLNQLLVEMDGFGTHEHIVVLAGTNRPDVLDPALMRPDLAN
# LAQKLAVLTPGFSGADIANVCNEAALRAARKGSDSVESRHFDDAIERVIVGLEKKSRVLSPLEKKTVAYHEAGHAVAGWFLENADPVLKVSIIPRGNG
# ALGYAQVCYSPTPLPSLSYTCVIVSSSGSLPSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g109
###
# start gene g110
Scaffold_9	AUGUSTUS	gene	428806	429384	0.46	-	.	g110
Scaffold_9	AUGUSTUS	transcript	428806	429384	0.46	-	.	g110.t1
Scaffold_9	AUGUSTUS	stop_codon	428806	428808	.	-	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_9	AUGUSTUS	CDS	428806	429384	0.46	-	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_9	AUGUSTUS	start_codon	429382	429384	.	-	0	transcript_id "g110.t1"; gene_id "g110";
# protein sequence = [MDFTISSNGGLFLLPDPVTCFRSASYNQIQTFHASKDASLVVLDWVTSGRKSLGEDWVLSRYYSVNEVIIAEKRVAKD
# VMLLENNESDSRLNRALAESLAPFSCYATLILRGPMVEETIAQIAARYECISVMQRKAPEELLWSLSPIGSNNENGVVIRVAGKETEIVKNWLKDTLS
# SLEQHIGVDVYRRAFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g110
###
# start gene g111
Scaffold_9	AUGUSTUS	gene	430778	432840	1	-	.	g111
Scaffold_9	AUGUSTUS	transcript	430778	432840	1	-	.	g111.t1
Scaffold_9	AUGUSTUS	stop_codon	430778	430780	.	-	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_9	AUGUSTUS	CDS	430778	431424	1	-	2	transcript_id "g111.t1"; gene_id "g111";
Scaffold_9	AUGUSTUS	CDS	431529	432840	1	-	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_9	AUGUSTUS	start_codon	432838	432840	.	-	0	transcript_id "g111.t1"; gene_id "g111";
# protein sequence = [MNTVPAPSLATDREEWPDADFDLPEGQPLQADTDKDDGDEEDWDLEMDLGKTGGANIVVRAQAIDMEGSSYPQMVTIR
# PAQNQQGTDDEEDDDGVSTIKVAEGVSTIKFAALPKPVPKATQAPIDEDFEDGFALPSDLTQLSLAPLSLNHRSSKNSIEWGDKDHTSSSQSSDAYST
# LGFANASPSSNSTSSVSLPDTETEDEDEDDHMDGLVIPSGLFESRNAGSKLTHILELRQKAVLASDSIKVASPDPEEDFEMGLVIDDDADFSPSRLLY
# SAQQMRHANRSQSMPNSRPKQLKLASTRVKSIDRAKSPVNPPVSSSRQFQKLRLSPSPPLNPPSRSQTFQTLSSIPSPPPSSSFLAPKPGSLRGQKSH
# SVLKPPTPPASTRKLTRKASLSSLLENGSSQASGSGPSAGPSKARYEEPTVASRAKSQRSTSRLRALSSVFNNGAPSSPGVQPTSFRTASPVPPRPPS
# NLSNRASRIVLQPSAPKVMKRPKRQRTFGDGTELDGFEDLPTDRDKESRFRVQPKGYGNRIPGGTFSSKPSGDKHSEKNTEKNTIRRKRREVSGGSGI
# YAYAWTFVAAAEFLCFIESNSASAPTVNSLRRSSRLDLPPSSKNQSPRKKNKLASPNAPRKKPTLIRNLGGAGAPKGQSHPVVK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g111
###
# start gene g112
Scaffold_9	AUGUSTUS	gene	433067	433843	0.9	-	.	g112
Scaffold_9	AUGUSTUS	transcript	433067	433843	0.9	-	.	g112.t1
Scaffold_9	AUGUSTUS	stop_codon	433067	433069	.	-	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_9	AUGUSTUS	CDS	433067	433265	0.91	-	1	transcript_id "g112.t1"; gene_id "g112";
Scaffold_9	AUGUSTUS	CDS	433530	433843	0.91	-	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_9	AUGUSTUS	start_codon	433841	433843	.	-	0	transcript_id "g112.t1"; gene_id "g112";
# protein sequence = [MPNVHLSIWISLEESSATIDITGAGASINGVLSPNSVILALFLEVEKGQGVWGRIRGTLGDNSENLKDVARRVQEVWI
# AGWESGRWEAEIERTRIGLSGAVEHERGVFDGRELDALAETMAERDIRMRKGLDEVLEEWEPEKQKNDEPVNNNEDDEIEYNAKELRRLRPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g112
###
# start gene g113
Scaffold_9	AUGUSTUS	gene	434366	435259	0.91	-	.	g113
Scaffold_9	AUGUSTUS	transcript	434366	435259	0.91	-	.	g113.t1
Scaffold_9	AUGUSTUS	stop_codon	434366	434368	.	-	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_9	AUGUSTUS	CDS	434366	435259	0.91	-	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_9	AUGUSTUS	start_codon	435257	435259	.	-	0	transcript_id "g113.t1"; gene_id "g113";
# protein sequence = [MSALPPCFRRKLSCTLHFHKKDESLLIAGSSVFANPQALNGVPLEIRLAAFEEFWDSEVPRIGELHSKGWSHWVSHKQ
# ERNLLTVVTSSVTPTSTELDPYRQWAEYETRADCAGQLPARTIDDNIDSDPYSTILFVDIRPFLFDLRTQRSKNVFRLAWLSTLGLHIPGFSASLSSS
# GDSRDDRWSYIHLTKPAFLDAILPTAGAQNVSLTADALAGALVGRQKVYKQSFGPIKNWSLGSFHLFDPVYGTTGMWNTLDIADVDAAFVSRVFSSLR
# LGPEDTDWDSLSLAFETALSVKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g113
###
# start gene g114
Scaffold_9	AUGUSTUS	gene	435289	436516	0.4	-	.	g114
Scaffold_9	AUGUSTUS	transcript	435289	436516	0.4	-	.	g114.t1
Scaffold_9	AUGUSTUS	stop_codon	435289	435291	.	-	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_9	AUGUSTUS	CDS	435289	436029	0.55	-	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_9	AUGUSTUS	CDS	436208	436516	0.42	-	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_9	AUGUSTUS	start_codon	436514	436516	.	-	0	transcript_id "g114.t1"; gene_id "g114";
# protein sequence = [MSFAPSFSSFPSFDSFPDSRPSQIPKLQTEEKSKKKKKTKARNSKDKESKREGRSAQFKDTFDASSRAKAEEPTEFYF
# SDRTGDSGNIQYGKLSSSSIPKYFVITLDDRSKSLKLLSIPPQRRLTADSKSTKYQERDGFLLLGQGRRSRTGDPSYRAITQEDNSDSDSDSVVSIFS
# SSEDERTLSAHEETLRGLEQQLSADPSSITNWLRLLSQTLSTTSVATQEARKARSKITIPLLSRALAAHPANSTSPLLRIKYLRAIEDVWSESQCDSE
# WEDALKLGNIDMWMEWLEWRISKSTDGLDGVIDAALRILSSLDDSEDSEVGKLRVFWRIAIVFKQAGKPGLINCE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g114
###
# start gene g115
Scaffold_9	AUGUSTUS	gene	439852	441968	0.58	+	.	g115
Scaffold_9	AUGUSTUS	transcript	439852	441968	0.58	+	.	g115.t1
Scaffold_9	AUGUSTUS	start_codon	439852	439854	.	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_9	AUGUSTUS	CDS	439852	441757	0.63	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_9	AUGUSTUS	CDS	441874	441968	0.58	+	2	transcript_id "g115.t1"; gene_id "g115";
Scaffold_9	AUGUSTUS	stop_codon	441966	441968	.	+	0	transcript_id "g115.t1"; gene_id "g115";
# protein sequence = [MPSSAYTRWIKLTDEELTVNNVRDVLKAIHDDLWVSVACSDRLVDDLTLQRVILEVGLERTQTALERVKDILPSESDT
# GKQTSAETLTEYFRELPVDAQLCHVRAILLKRLDRLNTFVELCKEQPIVPVEKEVEVEDPEWEDDPWAETNAGPVTPRTNVILPPVTLSAFLTTDLLQ
# SAFILAIHQWFGALRVLHYRHRACLWPHRFTILEHIPAHANPTDYHFLLPSCDSLTSSEQRFDASEWRSEKDVSELPTVRLAVQSSDALSGFDTIIDS
# TPVITAPEAPEDILNAESVSEWYQKRVDDIIEATGMIDIVLTLIQHGASQNVPHLDELGEDLSLLSRLVYDVPRGHKSEDEDWTLTRWRAMNPPAIIR
# AYLAHSTPSTLPHDITHFVMPYLFVLESRAERAGKPEPQLPKRLLYEYILHAPLEMVLSVFEASKPTLPAAQRIIKQEDDMVRLSLACLYGSDSLNEW
# STMSGIFECLPVWEMTAADNEEDAADMTISSLGAFVTPSTSRPRATPSDLLIFFNPLPLSSLSRALDILDVHLESGEIFSRWSVPAPLRWFLQSSNSL
# AEQRAWANRMARRAGGSEDELTSLEDWEWLLEDMLKLAGETKIKGAFGLLPRDEIIRIYFGGLLSTGKDICLACSHEFYDNASSGNYKFGEMKLAYEW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g115
###
# start gene g116
Scaffold_9	AUGUSTUS	gene	442005	442541	0.95	+	.	g116
Scaffold_9	AUGUSTUS	transcript	442005	442541	0.95	+	.	g116.t1
Scaffold_9	AUGUSTUS	start_codon	442005	442007	.	+	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_9	AUGUSTUS	CDS	442005	442541	0.95	+	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_9	AUGUSTUS	stop_codon	442539	442541	.	+	0	transcript_id "g116.t1"; gene_id "g116";
# protein sequence = [MSSLDVPPLSDRLIKEKEFIEATSRLSSFNIVSRPGIPISPIEIRLTKDRLSLVSQVLSSNVDAYKHTEVILDLVYKL
# GFRDDIAAEVKAFAMLADTALQAEDFSRAYETSQRMIDTVLNLRATLMGIGDPKVREASEVCWVACFQLGRQPEFDDVDKKLLLLGRAIEICPPIGCT
# TC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g116
###
# start gene g117
Scaffold_9	AUGUSTUS	gene	443386	445580	0.29	-	.	g117
Scaffold_9	AUGUSTUS	transcript	443386	445580	0.29	-	.	g117.t1
Scaffold_9	AUGUSTUS	stop_codon	443386	443388	.	-	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_9	AUGUSTUS	CDS	443386	444203	1	-	2	transcript_id "g117.t1"; gene_id "g117";
Scaffold_9	AUGUSTUS	CDS	444311	445580	0.29	-	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_9	AUGUSTUS	start_codon	445578	445580	.	-	0	transcript_id "g117.t1"; gene_id "g117";
# protein sequence = [MLDMDDEPRSSYSSNEYDDMDGGDQSTVEQHQEEEDELAMPRLSLLGPKMRFHSKAPWELDDSVLQQDEESEDDMDSH
# SVMSSTTRNKGGAARHFRFGGSKLGNNNGRSSRESSRSRRVLRSRSIPLPLKLHMGVAQFSESSITFLIKLFASLSHSTLAQASLSSTSLVPGGPHRP
# FSPAHAESPSSAHFSPSSPRSPVFPGRVVEGTTTTRSSGSGESEPRPSFAYSVEDTHPYARSNPSAPLEHDPRALFKKIDFPNIPRSETVSTLTNSTA
# SYTSINQQPQISLSVQPTHEPLPQSPRLQAFGREISSPVAFRSTTHTAERADFLPPRTGNISGWTERAVSPSFNLISLEEARAQRSRSITSQSTTTHP
# SSSVLLEDRQNEQISSHSVTSRARARSISAGARAKQALTSMVGNTPPKQERHTPPPVPSLSEGFAAFNAQQSTVPKGLKVNRVPPPQVSPSMFEKSHF
# VEESQISSPKPTTSPKRTPPPLNIVDSNHVTGTLRPQFHGEVAQSAPANVTEFPSLKLRPISTVFSSHFGDHILPSPSSDDEPDTPSSLQSPITGISP
# VTPGPFSRPNEQNSHQHKTSSGSGGNVEDQSAVIRALQDQIVTAKRAWQRQIWELEGQVRDLKVEVEDLRNAGNVQGYCELCGRGIPNSRESSGESSQ
# GDEDKKPGSVVNRPRARTGTGQSRFGSAV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g117
###
# start gene g118
Scaffold_9	AUGUSTUS	gene	452406	454489	0.13	+	.	g118
Scaffold_9	AUGUSTUS	transcript	452406	454489	0.13	+	.	g118.t1
Scaffold_9	AUGUSTUS	start_codon	452406	452408	.	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_9	AUGUSTUS	CDS	452406	452666	0.27	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_9	AUGUSTUS	CDS	452755	453321	0.42	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_9	AUGUSTUS	CDS	453380	454489	0.68	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_9	AUGUSTUS	stop_codon	454487	454489	.	+	0	transcript_id "g118.t1"; gene_id "g118";
# protein sequence = [MTKHEAHDHFHSAPAESVMSEPVEKLDEQESAENGLVQHDIPPEVPVPIPTHADVTSEHEAESPKGAEKYNSAAGVNP
# KVVTPVKSGIPNSATGAGAAKVPAKASLPSSTRPAATSTVKKSTSASAASNATAKPTMSKPAPPPSRRASLAPSSKPPVVRSALSSSVNTKPPIASAT
# SAPRASVASPTNGDAKIGAAARPRASVSDVAAKRSSVTSRQSLSSSTAAKPVAPSAAAPKAASRTASVSHTKPSKSSPSISSIREVRGEDGKVIEDLQ
# NKLKESGEALKAKADSISDLEGQIGHLGASLEAAKAEAEAKDVILSELEGSKTALEAQLKEARETLSKLQNEQEEAVSKLAAVQEEVSCHKHVSFDLS
# FIYLTQLENARSSLVLQQELVQTLQEQIQTQGNDLALLKVNVSQSAEDSQAASLEHEALLKAQADFSAIQEETAALKAAHSTALEEVLAESHAVEEEL
# KEKTISFEALVAQIAEMKAEKEENANKVSELEIEILELKESQETAEDERSTFALKIQALEEELAKAHAAAQGIEDDYKAKEAESSARAEQISASHENA
# VQAATQAQAELVTQLETLKAALNEAKADNEHARAEASASTDAHSAALQEAEQNYLNKQSEMSAEIQRITAELEVSFF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g118
###
# start gene g119
Scaffold_9	AUGUSTUS	gene	454560	455614	0.74	+	.	g119
Scaffold_9	AUGUSTUS	transcript	454560	455614	0.74	+	.	g119.t1
Scaffold_9	AUGUSTUS	start_codon	454560	454562	.	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_9	AUGUSTUS	CDS	454560	454619	0.96	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_9	AUGUSTUS	CDS	454697	455614	0.75	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_9	AUGUSTUS	stop_codon	455612	455614	.	+	0	transcript_id "g119.t1"; gene_id "g119";
# protein sequence = [MTSRLNTINCFKRLSNERRSDLAEVRGGFDQTAAQLQANHDSTVESLRAEHAEILETQSKSFEKQISKLSLKLKATQD
# DLAKSKAALEASKTEIENLTNQRDAARAAGEASPDPSSELSAEVTRLAQELSNSKDDLSAVTDQLNLTKESIVAMTANHAAELEEAAKARAEETTKLR
# SAHDAEISLIVTQKSEMSMQISDLQGELATVKATLEAEPAAPKGNGSVPQSPGVSREELQRMHEAHNLKMNDLIAQHEKEMKVIKEERDNSLQSAREA
# DERCSAKAMELHLLESESEENGDEITRYVKFFGFKGFVGSMIALVAIYAFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g119
###
# start gene g120
Scaffold_9	AUGUSTUS	gene	460399	461025	0.65	-	.	g120
Scaffold_9	AUGUSTUS	transcript	460399	461025	0.65	-	.	g120.t1
Scaffold_9	AUGUSTUS	stop_codon	460399	460401	.	-	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_9	AUGUSTUS	CDS	460399	461025	0.65	-	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_9	AUGUSTUS	start_codon	461023	461025	.	-	0	transcript_id "g120.t1"; gene_id "g120";
# protein sequence = [MQVDVAEPGCRLQASFVDDEELNLHQGEITHLRLCLSSIGVESIDEVWLVVGSDNLWLDEGNGEVSGEVSYIAFHLFA
# LSSILDEMPAVESIHSSNSSEPFKPFNIPLGSSFSLAPAESLEVSLTFHALDFSQKDIHLLLLYRTGVYEYQGASPVSTSNFLDTSSAFQTSTKSTNV
# FSAPLVQDHFPCDSIYKRRGDVLATSRATEYF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g120
###
# start gene g121
Scaffold_9	AUGUSTUS	gene	462873	463172	0.51	-	.	g121
Scaffold_9	AUGUSTUS	transcript	462873	463172	0.51	-	.	g121.t1
Scaffold_9	AUGUSTUS	stop_codon	462873	462875	.	-	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_9	AUGUSTUS	CDS	462873	463172	0.51	-	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_9	AUGUSTUS	start_codon	463170	463172	.	-	0	transcript_id "g121.t1"; gene_id "g121";
# protein sequence = [MPNPPPAPVPVPTAKPRLPLADRDSPELSTKPVDSSTRNGASSGINTIRMNEKDIQQTAKFTREFLVMSLIPWMEKCV
# TDWNENVNSNLSLKKLRAQMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g121
###
# start gene g122
Scaffold_9	AUGUSTUS	gene	466976	467793	0.26	-	.	g122
Scaffold_9	AUGUSTUS	transcript	466976	467793	0.26	-	.	g122.t1
Scaffold_9	AUGUSTUS	stop_codon	466976	466978	.	-	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_9	AUGUSTUS	CDS	466976	467544	0.35	-	2	transcript_id "g122.t1"; gene_id "g122";
Scaffold_9	AUGUSTUS	CDS	467643	467793	0.49	-	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_9	AUGUSTUS	start_codon	467791	467793	.	-	0	transcript_id "g122.t1"; gene_id "g122";
# protein sequence = [MSLFQQQMLHDALALSTPVAGADDERLIIDTLVDARARKDNYKNALNSLHEWKDKIDPHVSLSLKHKGIPDPLPIVKV
# AKKPTPASFKHEPSPPPSPVHALKPKGPLPNASSSRSAVSSSPNSLPKLPSIKSGNRRSTINSITAHHPSYNSRLPPPNSEITIPDAPSRSPSPPNKV
# VPHSRGNKFTKEDKEFFIKFIQWRLRCDQSLTRTQLCEQLAEKVSRDFAPSTIRLISSAGTPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g122
###
# start gene g123
Scaffold_9	AUGUSTUS	gene	471715	472713	0.66	+	.	g123
Scaffold_9	AUGUSTUS	transcript	471715	472713	0.66	+	.	g123.t1
Scaffold_9	AUGUSTUS	start_codon	471715	471717	.	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_9	AUGUSTUS	CDS	471715	471720	0.69	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_9	AUGUSTUS	CDS	472217	472230	0.68	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_9	AUGUSTUS	CDS	472284	472713	0.98	+	1	transcript_id "g123.t1"; gene_id "g123";
Scaffold_9	AUGUSTUS	stop_codon	472711	472713	.	+	0	transcript_id "g123.t1"; gene_id "g123";
# protein sequence = [MVTFSDFEEAVEYGELDQFLRLKETWDDDLDNITKPPVHPIGVPGAMLPLQMTPDHLKSKILASPQSTPGKKPEPVNK
# PGARDGEFDVSTELSGYGLQGVMATEAELADLVAELGLDGDEAGDLVKGLSGGSSAEREEKGKQEIETRED]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g123
###
# start gene g124
Scaffold_9	AUGUSTUS	gene	488204	488943	0.69	-	.	g124
Scaffold_9	AUGUSTUS	transcript	488204	488943	0.69	-	.	g124.t1
Scaffold_9	AUGUSTUS	stop_codon	488204	488206	.	-	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_9	AUGUSTUS	CDS	488204	488764	1	-	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_9	AUGUSTUS	CDS	488818	488943	0.69	-	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_9	AUGUSTUS	start_codon	488941	488943	.	-	0	transcript_id "g124.t1"; gene_id "g124";
# protein sequence = [MSSSYESFGPTRPSLQTSHSPTVDNFHHDSTSQQHTRHFVFHQEKFESNSFAQFLKEDDERFFATFPEAAKAAAQQQQ
# QQWLVLGRDYRDFNGSAAFNLSANHGTYAYPSPTSPVHPSNVVDVMEGGQGTYPAPYATSASSSHASFPYTVDPNSCNDVPLEGYNQLSESAPTRQGV
# VTPVSNFANSSFYPPLSSEVWNYHSMILIHAHLFFSLLFELTGPSQHSWATA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g124
###
# start gene g125
Scaffold_9	AUGUSTUS	gene	491414	492153	0.32	+	.	g125
Scaffold_9	AUGUSTUS	transcript	491414	492153	0.32	+	.	g125.t1
Scaffold_9	AUGUSTUS	start_codon	491414	491416	.	+	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_9	AUGUSTUS	CDS	491414	491553	0.32	+	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_9	AUGUSTUS	CDS	491673	492153	0.62	+	1	transcript_id "g125.t1"; gene_id "g125";
Scaffold_9	AUGUSTUS	stop_codon	492151	492153	.	+	0	transcript_id "g125.t1"; gene_id "g125";
# protein sequence = [MTPDFDDIPLPEGWVEEFHESGHPYYVSIFGYQFEFQLMNYLPCLGSKSRSPSPLPDGRSPLYTENVKVAPALGDERR
# SSREYYGRRGPVDEYAPGMSTGSHMGDRGLLGGGRGLGGLGGDGRGFGGGGLGDRRGLIGGLLGALTERTEMAQESRGAYYEPRFGMGGGLGGPGMMI
# GGRGFGMPMDRRTERFMVNCLSACETLSID]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g125
###
# start gene g126
Scaffold_9	AUGUSTUS	gene	493184	493698	0.45	+	.	g126
Scaffold_9	AUGUSTUS	transcript	493184	493698	0.45	+	.	g126.t1
Scaffold_9	AUGUSTUS	start_codon	493184	493186	.	+	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_9	AUGUSTUS	CDS	493184	493255	0.79	+	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_9	AUGUSTUS	CDS	493351	493698	0.45	+	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_9	AUGUSTUS	stop_codon	493696	493698	.	+	0	transcript_id "g126.t1"; gene_id "g126";
# protein sequence = [MLQLKDKAIGTKEERQAEKARAAQRLAQQQAYYNQAQYAPPPQQYGNRYGGYGDTYGSGGLGGLGGMSGRRTGGMGMG
# GMALPLIGGMAGGLLLGEALGDFGGGGFDNGGFGGGGFDGGGFGGGGFDGGGFDNGGGGGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g126
###
# start gene g127
Scaffold_9	AUGUSTUS	gene	494064	494411	0.55	+	.	g127
Scaffold_9	AUGUSTUS	transcript	494064	494411	0.55	+	.	g127.t1
Scaffold_9	AUGUSTUS	start_codon	494064	494066	.	+	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_9	AUGUSTUS	CDS	494064	494411	0.55	+	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_9	AUGUSTUS	stop_codon	494409	494411	.	+	0	transcript_id "g127.t1"; gene_id "g127";
# protein sequence = [MGDINELVRKPPTQEESTQGITIDVDSANLPGPPPKKKRKRTPKSKRDGHGTRPMGSAPEGEESNPVKASEDLSDVAK
# PSTQPPKKSSKNKNKKKERKDKKCMAPSSPLFLLVLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g127
###
# start gene g128
Scaffold_9	AUGUSTUS	gene	495278	495595	0.3	-	.	g128
Scaffold_9	AUGUSTUS	transcript	495278	495595	0.3	-	.	g128.t1
Scaffold_9	AUGUSTUS	stop_codon	495278	495280	.	-	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_9	AUGUSTUS	CDS	495278	495595	0.3	-	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_9	AUGUSTUS	start_codon	495593	495595	.	-	0	transcript_id "g128.t1"; gene_id "g128";
# protein sequence = [MVIGNSSSSPNYNGVATTHRSTYSLAPSLRRQSSIMIDMDIPSTPPTRAVSPEGKSRSLKTSSIQEEHAPDEGDLVAK
# KAGLGSLMKSAKQVAQVPDFDMGAFNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g128
###
# start gene g129
Scaffold_9	AUGUSTUS	gene	502115	503122	0.67	+	.	g129
Scaffold_9	AUGUSTUS	transcript	502115	503122	0.67	+	.	g129.t1
Scaffold_9	AUGUSTUS	start_codon	502115	502117	.	+	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_9	AUGUSTUS	CDS	502115	503122	0.67	+	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_9	AUGUSTUS	stop_codon	503120	503122	.	+	0	transcript_id "g129.t1"; gene_id "g129";
# protein sequence = [MLDFSMFIAAVLSTSIGDKIRNAASTSLLIPPNSAFDRLGLLVSEYLLASSSKPDLENVLLHHVLSSVRYSEALENGT
# QRTFASAEGSDLTVSREDNGTVFVSASGGWVGMKSRLHTRNILTQTGVVHELSDILIPRSVNLTVGKLMKAAKGSTMISMVTKAGLDWVLNGTSPPED
# SQWAQQGFGKAGWVLLCPSDSAFGQYNLTELYGNKEKLISIVGQHLIPLPSQSNKLIAAPLDDDPLYNNRPLVLDDSVTYSTLQSASSVYGDLVFKQS
# DDAKGGYIVGIKGARGTDKQTDWANVISWGRTTTTGGGVLSASIDCSCRTIPRGGRNTECR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g129
###
# start gene g130
Scaffold_9	AUGUSTUS	gene	503393	503689	0.49	-	.	g130
Scaffold_9	AUGUSTUS	transcript	503393	503689	0.49	-	.	g130.t1
Scaffold_9	AUGUSTUS	stop_codon	503393	503395	.	-	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_9	AUGUSTUS	CDS	503393	503689	0.49	-	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_9	AUGUSTUS	start_codon	503687	503689	.	-	0	transcript_id "g130.t1"; gene_id "g130";
# protein sequence = [MGDLYRRRDERGIHEHKESSSSSPTRTAQTPPNPPATKALTLSAVADTAVVTDGSASLCKQILDTSRAQRKLAHHCLE
# EVEDGRRDLRVIIIWGRAGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g130
###
# start gene g131
Scaffold_9	AUGUSTUS	gene	511573	512868	0.92	-	.	g131
Scaffold_9	AUGUSTUS	transcript	511573	512868	0.92	-	.	g131.t1
Scaffold_9	AUGUSTUS	stop_codon	511573	511575	.	-	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_9	AUGUSTUS	CDS	511573	512868	0.92	-	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_9	AUGUSTUS	start_codon	512866	512868	.	-	0	transcript_id "g131.t1"; gene_id "g131";
# protein sequence = [MRLVSCLEKHGARARPVLGAVVRLGPKPEDPETVQDFVPPEAHTFPSDLVPIRSALRSGEIPVIPPFALDSFCRSVRI
# DANDVIGALARGMVEAGSQSSSADASIEASGEVDLTPLRLMIINREGGVPSYARSGFPHLLINLDSESKHIRETFHESWRHTHKTALSNLALAKTCLT
# YMPPTSSAVMVSHRSQSSLIGNLITNRPAVSSSLPHALLQGNRKLTPHTPTLIRRGLPIRVVRTVENIDRNKMNALLEQSFGRTLEETDFYDRLKRTL
# DFVIIAGDYAGAAIVTNEPSSDLSQPISYLDKFAVLPSHQGDGTVDFLWVALHDESYGLGHPFSANPNGGKEGQGEGRDLVWRSRANNPVNKWYFERS
# SGHVRMGDWVLFWCDAEKRLKIEQGRRGRAGLSYIEDWEEGRLASWIDVVHKIPSSWKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g131
###
# start gene g132
Scaffold_9	AUGUSTUS	gene	516264	516734	0.46	+	.	g132
Scaffold_9	AUGUSTUS	transcript	516264	516734	0.46	+	.	g132.t1
Scaffold_9	AUGUSTUS	start_codon	516264	516266	.	+	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_9	AUGUSTUS	CDS	516264	516734	0.46	+	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_9	AUGUSTUS	stop_codon	516732	516734	.	+	0	transcript_id "g132.t1"; gene_id "g132";
# protein sequence = [MNTIVGNYFVRLAAFLYIVHTTSYRPGDHVFFGDGGGTQAIPGVVQTVDAIQRTATILLRGKIEQVSLLELDSQGASD
# SISSPEIGGLGVRRGEMVFIHAPDKNNGFEAPRVPKIGELEPWVRANPFTLSGQLSGWREELATIGAGIATRRSLETR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g132
###
# start gene g133
Scaffold_9	AUGUSTUS	gene	516845	517372	1	+	.	g133
Scaffold_9	AUGUSTUS	transcript	516845	517372	1	+	.	g133.t1
Scaffold_9	AUGUSTUS	start_codon	516845	516847	.	+	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_9	AUGUSTUS	CDS	516845	517372	1	+	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_9	AUGUSTUS	stop_codon	517370	517372	.	+	0	transcript_id "g133.t1"; gene_id "g133";
# protein sequence = [MKLRLDGSLDVLHPDGSLGTYPLERVTRLYDGIEQLEDELYEDEEGSENQHQMHGIWDYDYHWGNGESQNSGDGYEDE
# EMREPDVEQSSEHTTTETIASMSPPSDPPTELITLDSTKSELEEEGEMQTQESDQNANWEKFKILSSAPQDHAYYQTSAAQPSRQFMSRLNREIGFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g133
###
# start gene g134
Scaffold_9	AUGUSTUS	gene	524492	524917	0.6	+	.	g134
Scaffold_9	AUGUSTUS	transcript	524492	524917	0.6	+	.	g134.t1
Scaffold_9	AUGUSTUS	start_codon	524492	524494	.	+	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_9	AUGUSTUS	CDS	524492	524917	0.6	+	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_9	AUGUSTUS	stop_codon	524915	524917	.	+	0	transcript_id "g134.t1"; gene_id "g134";
# protein sequence = [MDWTPTNVNPGTEKFKASSDSIGKDDGWWLRPQRFFAPEKPTGLESLFENTKLADDVPMKDVTAVPVNRSSVLRWKTH
# VEVWWWMYTAVLVLLMGVLLKLWVGRNGTSVQQDFQHISHDNFAQDPIQQSGVYRHTSRTSRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g134
###
# start gene g135
Scaffold_9	AUGUSTUS	gene	525232	526394	0.47	-	.	g135
Scaffold_9	AUGUSTUS	transcript	525232	526394	0.47	-	.	g135.t1
Scaffold_9	AUGUSTUS	stop_codon	525232	525234	.	-	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_9	AUGUSTUS	CDS	525232	526032	1	-	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_9	AUGUSTUS	CDS	526113	526394	0.47	-	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_9	AUGUSTUS	start_codon	526392	526394	.	-	0	transcript_id "g135.t1"; gene_id "g135";
# protein sequence = [MSKKITLTLLVYLVAIFAVSSLVEANGFESIHRRDHENLKRLIKKRATASSPVEGVGSEPSVTETAAGTTLSTSSAAS
# SQASSTSAASASASSSSSVSSSSASTSSSVSSSAISSSASSSSSSSASSSSSATSPTTTATSTSSTPQVTQAPTATEDTEPITSVISGVLVTLTESVA
# ASSTASSSSSVSGDISSSDGKKAGITVVIVIASCVGGVAILWTIFRKWKLGRSSKFDQRLQPINWQPTTEDGIDSGIPIHRRRASDTSSFHSGVHSGP
# SDMGHRSSENGHSTYGAADLPPLPSHDFTVGPSHLTPVGGYADLARGPSPQPQMQENLTRGPSINRNYDHNVPLHHQTGYGATGGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g135
###
# start gene g136
Scaffold_9	AUGUSTUS	gene	531012	532031	0.38	+	.	g136
Scaffold_9	AUGUSTUS	transcript	531012	532031	0.38	+	.	g136.t1
Scaffold_9	AUGUSTUS	start_codon	531012	531014	.	+	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_9	AUGUSTUS	CDS	531012	532031	0.38	+	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_9	AUGUSTUS	stop_codon	532029	532031	.	+	0	transcript_id "g136.t1"; gene_id "g136";
# protein sequence = [MVVGQENVGVNPKVNNLMGGYRSAVNDILWVLDSNVTVHSGTLARAVDALQAPTKSGKRVALVHHVPFAFSTESRVGS
# RIDEAFLNTNHAKMYLAINTVAIESCVVGKSNLYRRSDLERVNGSLKPITSTEPNAKQDGLCGLPAFGRFLAEDNMIASALWHELGLRHDLSCDVARN
# VVGNMSLRDYVQRRIRWIRVRKNMVFAATLVEPFTESIVLVAIGSSSLKYFFGLPRWLCILVHFFMLLIVDLDVYTSLAGHPLPQSIKWEFLAGWVAR
# EMLALPIFMLAIFGNTVEWRGRQYRVLSNGEVQHVSNHRSFFDSSKFLGWYRRQYQALETQPVSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g136
###
# start gene g137
Scaffold_9	AUGUSTUS	gene	534246	535061	0.66	+	.	g137
Scaffold_9	AUGUSTUS	transcript	534246	535061	0.66	+	.	g137.t1
Scaffold_9	AUGUSTUS	start_codon	534246	534248	.	+	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_9	AUGUSTUS	CDS	534246	535061	0.66	+	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_9	AUGUSTUS	stop_codon	535059	535061	.	+	0	transcript_id "g137.t1"; gene_id "g137";
# protein sequence = [MKPTVAKPQPREDRRLDSERVPSPAPPSRNGALSRPSSPAASTRSHGTSSGRPTRNRAPSPTQSASGRARRPSNADST
# LAANGLASRIPAGDPGHSINGTSRPSNNYNAPSNQPVITRTTTEDTMVSARSQLSLNDSLSVSSAVPTPSRSGQPSPQPSVRSRKQPTRAATVLTDVA
# RRDQNARISFFDPANQALIDRLIAGLSEIDGEEENNQATMSNFEEMLEGYEMASDDVIGRKTARGAAALMEARLLDELMALEKVIKSKFSYYSVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g137
###
# start gene g138
Scaffold_9	AUGUSTUS	gene	536711	537674	0.11	+	.	g138
Scaffold_9	AUGUSTUS	transcript	536711	537674	0.11	+	.	g138.t1
Scaffold_9	AUGUSTUS	start_codon	536711	536713	.	+	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_9	AUGUSTUS	CDS	536711	536731	0.47	+	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_9	AUGUSTUS	CDS	536878	537192	0.12	+	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_9	AUGUSTUS	CDS	537288	537674	0.47	+	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_9	AUGUSTUS	stop_codon	537672	537674	.	+	0	transcript_id "g138.t1"; gene_id "g138";
# protein sequence = [MLYSPPILIGADGLEIRMNVDAAYERIVNTMFESLKQMAKMEGEGEDKGQLNYHVILIGAKSDIKFSFTLISFHSSEN
# MHHFVAETSQMEIGSVASFVRKAEAIYDENLNAYDYFEGVERLLKTTAPSEISTNNNYNRSSLKKVVKEFNAKDIRKVVDNLFKRVEKHFTEASDLQT
# PGTEQGGSIAPGTVMVGAWKACEEELLRITELFMKRISQCYPDSGVSLEYGPGDVEAAFRRHRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g138
###
# start gene g139
Scaffold_9	AUGUSTUS	gene	537801	538211	0.98	-	.	g139
Scaffold_9	AUGUSTUS	transcript	537801	538211	0.98	-	.	g139.t1
Scaffold_9	AUGUSTUS	stop_codon	537801	537803	.	-	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_9	AUGUSTUS	CDS	537801	538211	0.98	-	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_9	AUGUSTUS	start_codon	538209	538211	.	-	0	transcript_id "g139.t1"; gene_id "g139";
# protein sequence = [MQPFFAKNEREIDAGIVSIQSNVLSFVQSRLYALWELLWSVLSKTPVSQGNINGVQQTQPAAPGISLDSAMGLFKTYG
# PSLLNSLKPAATPNGSAPTPPSFTPTTSSSSVSTMSAQSGTPLNEGPHPPFPEPVHMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g139
###
# start gene g140
Scaffold_9	AUGUSTUS	gene	563393	564082	0.65	-	.	g140
Scaffold_9	AUGUSTUS	transcript	563393	564082	0.65	-	.	g140.t1
Scaffold_9	AUGUSTUS	stop_codon	563393	563395	.	-	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_9	AUGUSTUS	CDS	563393	564082	0.65	-	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_9	AUGUSTUS	start_codon	564080	564082	.	-	0	transcript_id "g140.t1"; gene_id "g140";
# protein sequence = [MSSPPLMIVPFEGHASPPSTTISRSEGLGRAIVGKISTPTMAKAMLKFSLSKANSASGPRRVLLLESDKPTKPASAFG
# TFARPKIPLPTLATVYDEASVGASGISKPAFVSAILPLRQNHPFPPGLHVWSQSEYTTFFLKPNDAYQTCSTSSPYVGVVVESSFYLVIMRTSLQAWS
# FYATYGTEHSWLSHMSTKVTGIYDSIRRHLTNFEPHLSSKIFNEFHMQVNLKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g140
###
# start gene g141
Scaffold_9	AUGUSTUS	gene	576423	577255	0.58	-	.	g141
Scaffold_9	AUGUSTUS	transcript	576423	577255	0.58	-	.	g141.t1
Scaffold_9	AUGUSTUS	stop_codon	576423	576425	.	-	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_9	AUGUSTUS	CDS	576423	576701	0.77	-	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_9	AUGUSTUS	CDS	576772	577138	0.58	-	1	transcript_id "g141.t1"; gene_id "g141";
Scaffold_9	AUGUSTUS	CDS	577248	577255	0.77	-	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_9	AUGUSTUS	start_codon	577253	577255	.	-	0	transcript_id "g141.t1"; gene_id "g141";
# protein sequence = [MHGTVPSLLPHPSLLAHIIYRALQFDAALREERSELDGTLRDTVHKRDGVAAEAWPGVCDVILGKKEWFDANAPDAWQ
# IVNDELDDVVVGHDLKTTKSARRLKALIEQTAGASNLRPDDHYRYSLTPLLEQYSSRLTSSLDAYETLSSALVRAVPGALGVKLGMKEDHSSSVNIEH
# GRFTSRVEGVQRLCKAPLSSRFRETAMKVWGEDSTSVNQYF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g141
###
# start gene g142
Scaffold_9	AUGUSTUS	gene	585801	586371	0.46	-	.	g142
Scaffold_9	AUGUSTUS	transcript	585801	586371	0.46	-	.	g142.t1
Scaffold_9	AUGUSTUS	stop_codon	585801	585803	.	-	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_9	AUGUSTUS	CDS	585801	586136	0.73	-	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_9	AUGUSTUS	CDS	586369	586371	0.47	-	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_9	AUGUSTUS	start_codon	586369	586371	.	-	0	transcript_id "g142.t1"; gene_id "g142";
# protein sequence = [MRHWPSESVPQKVKVMSYFEILSAHTFFLLDTLASKKTKKASNNKSATAAMNTPLKSKPASTSLYLSEVHSYPLKFPT
# EARKHGAKQVNVDMPEEGMIITLLVMNVNEFIQP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g142
###
# start gene g143
Scaffold_9	AUGUSTUS	gene	586656	587280	0.81	+	.	g143
Scaffold_9	AUGUSTUS	transcript	586656	587280	0.81	+	.	g143.t1
Scaffold_9	AUGUSTUS	start_codon	586656	586658	.	+	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_9	AUGUSTUS	CDS	586656	586662	0.82	+	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_9	AUGUSTUS	CDS	586802	587280	0.98	+	2	transcript_id "g143.t1"; gene_id "g143";
Scaffold_9	AUGUSTUS	stop_codon	587278	587280	.	+	0	transcript_id "g143.t1"; gene_id "g143";
# protein sequence = [MTDDFPGLDDDEEDVAGDVNREDEDEDEDVFDDTLMDLEQTWEERERVVILEEREECNTMDIDESARKSSLRSLPAHR
# DDIHVDVYGGQTGAPLPDSNPTHTFHNSSHGFLHCQSQISGINHNPWAPFQSRTDWEVARWAKMRGPSSTAFSELLEIDGVHF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g143
###
# start gene g144
Scaffold_9	AUGUSTUS	gene	611946	612368	0.95	-	.	g144
Scaffold_9	AUGUSTUS	transcript	611946	612368	0.95	-	.	g144.t1
Scaffold_9	AUGUSTUS	stop_codon	611946	611948	.	-	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_9	AUGUSTUS	CDS	611946	612368	0.95	-	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_9	AUGUSTUS	start_codon	612366	612368	.	-	0	transcript_id "g144.t1"; gene_id "g144";
# protein sequence = [MSDFNLINHTGTTITKAMLSGTLNGATVDIAFVLHGWKFGQEKYWSFALDVQQVVVLCPEQNDTVLPNQMYNVVTPPR
# RSSTYRPLTPVTPLNVNSPLSNTYPSGNMYASSNGNVPHSPMSSSAEIWTRINKFWLATEPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g144
###
# start gene g145
Scaffold_9	AUGUSTUS	gene	613752	614861	0.96	-	.	g145
Scaffold_9	AUGUSTUS	transcript	613752	614861	0.96	-	.	g145.t1
Scaffold_9	AUGUSTUS	stop_codon	613752	613754	.	-	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_9	AUGUSTUS	CDS	613752	614861	0.96	-	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_9	AUGUSTUS	start_codon	614859	614861	.	-	0	transcript_id "g145.t1"; gene_id "g145";
# protein sequence = [MRKLVEDHNSKLSTLQSQSHNLCIYTDGSLKPIHRVRKTGAGLVAYQNNEEIFSRSIGLGVHAEAYDGEIVALSYAAG
# MAANLSSQNNMITHWQFFTDSASSIDTIFDTSPKPGQGYCSNFYRKIVEFLDMDITHTVEVAWVPSHTGIRGNERADFLAKAGTELVNEAIWGRSLSN
# AKRINQVRAEREWRKIWESRSTYGRFAVANRIVPSLKPSERLKETTRELFGRLTQCRTGHAFIGEYYLQFVPGENVDCPCGVELQTREHILRACPKYE
# EYRYILKRISDDICLTDILGTKEGIEALTEFISESGAFTKSGTHRPAPTEPNYTPLGIWDELEITYHNLAGEGITPKADWREETVDSDDPGPETT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g145
###
# start gene g146
Scaffold_9	AUGUSTUS	gene	615412	615945	0.67	+	.	g146
Scaffold_9	AUGUSTUS	transcript	615412	615945	0.67	+	.	g146.t1
Scaffold_9	AUGUSTUS	start_codon	615412	615414	.	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_9	AUGUSTUS	CDS	615412	615945	0.67	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_9	AUGUSTUS	stop_codon	615943	615945	.	+	0	transcript_id "g146.t1"; gene_id "g146";
# protein sequence = [MWWSLPPPTTTLPGQPRGATPNEIISNTGPGPGGRGASETPGGAGAGSVEAGNFLLKFEDFQFDASYHDKYITLESIM
# GPRSIENPKEYLPPSVTMGTGTPTSANTSTSTTPRLRNAQVRNGAPAAVGVTGLSGPSSSATSSTTMSTSSSPAINGITGSTTAFSSSPTMMNWESEQ
# V]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g146
###
# start gene g147
Scaffold_9	AUGUSTUS	gene	621426	621746	0.99	-	.	g147
Scaffold_9	AUGUSTUS	transcript	621426	621746	0.99	-	.	g147.t1
Scaffold_9	AUGUSTUS	stop_codon	621426	621428	.	-	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_9	AUGUSTUS	CDS	621426	621746	0.99	-	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_9	AUGUSTUS	start_codon	621744	621746	.	-	0	transcript_id "g147.t1"; gene_id "g147";
# protein sequence = [MDRSAYLSGRQSSDVSLSSVQQVEHHLLQEDCHSTIPTVSTQSQLPPIQSIESENDYMDLPLSIGFIEQTENHSKLRL
# LTNKQNSVSLESFYDEVEARARASPGES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g147
###
# start gene g148
Scaffold_9	AUGUSTUS	gene	624641	625135	1	+	.	g148
Scaffold_9	AUGUSTUS	transcript	624641	625135	1	+	.	g148.t1
Scaffold_9	AUGUSTUS	start_codon	624641	624643	.	+	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_9	AUGUSTUS	CDS	624641	625135	1	+	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_9	AUGUSTUS	stop_codon	625133	625135	.	+	0	transcript_id "g148.t1"; gene_id "g148";
# protein sequence = [MQNPPLIIILSWDITKSSAGKPINKPNRICSNIIRKLSVLPEEQDDVRVMLHSEALKRADELQRRSREIQIVEEAREL
# ARREELLRLEQTMAKAKLVADTKKKRLDELRSQAVKPSSDALHVKRSTSETSKSATSTKRVKLDHRVAETPTEEGQIIDEMPVDLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g148
###
# start gene g149
Scaffold_9	AUGUSTUS	gene	631056	631793	0.9	-	.	g149
Scaffold_9	AUGUSTUS	transcript	631056	631793	0.9	-	.	g149.t1
Scaffold_9	AUGUSTUS	stop_codon	631056	631058	.	-	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_9	AUGUSTUS	CDS	631056	631793	0.9	-	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_9	AUGUSTUS	start_codon	631791	631793	.	-	0	transcript_id "g149.t1"; gene_id "g149";
# protein sequence = [MKYVPPSSLCDIRSRSITALTAYHKVVLAGSAYITSSTLVDPSDHPAPLSNMHLTPEISTHMYHSGNSWYDCDSQPCL
# HALSNPVQNPTTVEDTTFLPIPYPRSPTPIMLTPVPPAQTTSADELMTQLIKQVANLATAMEECSSSKSSMNKPEVFKGKDSNEAHCFRAQFQNWASE
# QPDLANSQVKLIKSALGFFTEGAGDWATPHLLHFNAENPPFEGSWEKFLLEFDQRFESIDPGMEARNVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g149
###
# start gene g150
Scaffold_9	AUGUSTUS	gene	643236	643763	1	+	.	g150
Scaffold_9	AUGUSTUS	transcript	643236	643763	1	+	.	g150.t1
Scaffold_9	AUGUSTUS	start_codon	643236	643238	.	+	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_9	AUGUSTUS	CDS	643236	643763	1	+	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_9	AUGUSTUS	stop_codon	643761	643763	.	+	0	transcript_id "g150.t1"; gene_id "g150";
# protein sequence = [MSDDNAELDAQANADGKPVAKKKCGHMGGMDDRVITEKCGEHIIGTDAVPMREMCSLSMGENDVTMADAENLAGVIAV
# PCSSSTQAETANTVSRTEVSTVHPPAVKDITTIKIAHGQLLNFNRANVHDPRQISFATNIPRLECVWDDEGAQTGTPLTVVPISFDKRYSYCPSVLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g150
###
# start gene g151
Scaffold_9	AUGUSTUS	gene	647887	648180	0.57	+	.	g151
Scaffold_9	AUGUSTUS	transcript	647887	648180	0.57	+	.	g151.t1
Scaffold_9	AUGUSTUS	start_codon	647887	647889	.	+	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_9	AUGUSTUS	CDS	647887	648180	0.57	+	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_9	AUGUSTUS	stop_codon	648178	648180	.	+	0	transcript_id "g151.t1"; gene_id "g151";
# protein sequence = [MFMRYFPGGGVGHVANRKFFKQGEDSTDDNDISSISSDLGADELDVLDTEEISLEEMSEDGSDDDLGDEQGDSNDDDD
# DDLDVGGDDWQWDDGYGSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g151
###
# start gene g152
Scaffold_9	AUGUSTUS	gene	649056	650003	0.51	+	.	g152
Scaffold_9	AUGUSTUS	transcript	649056	650003	0.51	+	.	g152.t1
Scaffold_9	AUGUSTUS	start_codon	649056	649058	.	+	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_9	AUGUSTUS	CDS	649056	649318	0.74	+	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_9	AUGUSTUS	CDS	649442	649601	0.51	+	1	transcript_id "g152.t1"; gene_id "g152";
Scaffold_9	AUGUSTUS	CDS	649644	650003	0.58	+	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_9	AUGUSTUS	stop_codon	650001	650003	.	+	0	transcript_id "g152.t1"; gene_id "g152";
# protein sequence = [MLFNNNARPIASSSSSSRPSTGPAPSTSNSPPSIGPLPPDPTSSVDPSSPPQYSIYSESSDESTPSAAVTPGPGPDSS
# SPPGELPQLTSGSVFVASEGEEDDIDDEEKLVMPKARSSPVKKRVPSIAMSLDGNNSDEDGDTPNANGAGPSSGTQVNAKAALMAAVAEHRLTDHART
# GVDADDSVVDFGTAINDCDNLSALFGSDSSSEPLAKKKSKGNKHTKSKSKSNKSKLGIEEPELMTRLQVKGAEGTQQKAGPQTY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g152
###
# start gene g153
Scaffold_9	AUGUSTUS	gene	653408	653692	0.48	-	.	g153
Scaffold_9	AUGUSTUS	transcript	653408	653692	0.48	-	.	g153.t1
Scaffold_9	AUGUSTUS	stop_codon	653408	653410	.	-	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_9	AUGUSTUS	CDS	653408	653692	0.48	-	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_9	AUGUSTUS	start_codon	653690	653692	.	-	0	transcript_id "g153.t1"; gene_id "g153";
# protein sequence = [MVQQQLLEETEDAVESTVTKEDEYQQELEAEEDVEEDEEGGEGLEEEDVDDHEEPEAFDPTSIHGSSRELDPLGKTVR
# TDRPHGGCSCIEPANI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g153
###
# start gene g154
Scaffold_9	AUGUSTUS	gene	658608	662179	0.18	+	.	g154
Scaffold_9	AUGUSTUS	transcript	658608	662179	0.18	+	.	g154.t1
Scaffold_9	AUGUSTUS	start_codon	658608	658610	.	+	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_9	AUGUSTUS	CDS	658608	659310	0.4	+	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_9	AUGUSTUS	CDS	660759	662179	0.48	+	2	transcript_id "g154.t1"; gene_id "g154";
Scaffold_9	AUGUSTUS	stop_codon	662177	662179	.	+	0	transcript_id "g154.t1"; gene_id "g154";
# protein sequence = [MDSLQLTVTNLSRSFPPWLSSDHINKCRKYLNKLPTRALPQSVAIRRVKHADAIDNLIQKLLQFMDNHSDVIDKRPDL
# YSSIQNKCIAQFGITVVHVLYSHFEPHSILRNNSALIETDSLNAIISTFQTLTEQELSQLRLDLKICERKTKSGTIFHSQRQERQTEIRSNDIFKLMG
# KCFQQDYKKYYSRDNVGLCNDYLYLYHVPFTNLTLNEVLSKILSSMGYTENILQKIDRLSANVLSNLANKLKTEKDKSSFSKEEEAAFQLLNQVNIIS
# SKIPGSQASKTVTRNQIRSYYGYFGLPHLFLTLNPSAVHSPVFQVIYGEENIDLAQQFPYVVHPRSERACRVAKDPVAAADFFDFMYHTVFQELLGWN
# FKTGKSTPDGGIFGHIRAFFGCAELTERGCFHGHYLLFLRGGLNPSDIHKKMNDVEMYRSQFLSFFDDIIHYHLPNIDCSIAEGYEPRVEMPPDFHKD
# YNNDNASTELVPNWQKLFDDEHKRIGETFQRHSCRPVCHKGQTDMSSCRFGYPHEIIEESKFDVDQNSIIFARKETDVNGHNPHLLVCTRHNHDIKCI
# LSGKAAKAAMFYVSDYITKMPLNTEALLSTLSRAVASLLPDEADNDTIMDSKKLLHRCLTHFGRKQQIHAQQCARYLRRQGDNMISHQTIPLPSANLM
# IFVEQNYENILNLSDCESITHDSELLLHLVSKTVSYWVTAK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g154
###
# start gene g155
Scaffold_9	AUGUSTUS	gene	662413	664918	0.18	+	.	g155
Scaffold_9	AUGUSTUS	transcript	662413	664918	0.18	+	.	g155.t1
Scaffold_9	AUGUSTUS	start_codon	662413	662415	.	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_9	AUGUSTUS	CDS	662413	662419	0.54	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_9	AUGUSTUS	CDS	662511	662878	0.78	+	2	transcript_id "g155.t1"; gene_id "g155";
Scaffold_9	AUGUSTUS	CDS	662946	663302	0.45	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_9	AUGUSTUS	CDS	663425	664918	0.97	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_9	AUGUSTUS	stop_codon	664916	664918	.	+	0	transcript_id "g155.t1"; gene_id "g155";
# protein sequence = [MIETNNAETELQNITLSHEHENILKNWEEIHECADQRDAERLRKRSDILSKSVPVPMNINDNAEDENENIYAFVHSNT
# SKQHNTQNMSDIRELQLLKTDLKSAAWLNTPPSDSTKYIETVNQCLTHSNLRNNQTNLYNQKLPTEGEATLYNQDNMLRDHYKQKSTDHISETKPELF
# TPAQLKNRIAKEFNLNDQQKIAFEIISSVIIFREILKIPEWVAKQPLVMNLTGPGGTGKTHVIKAVQKKWKIKRDLGELKENMPIFATVKKNNSLRTE
# WKDVCLLLIDEISMVDAVLLADIDGSLRYAKEKPDSFFGGINIIFSGDPFQYPPVGTPLYSPIRSSGKQTAEELMRRLGRIAWKSINAVVELQEQKRM
# ESDPEYAAAVSRLRMRQCTASDVDLFNSRAIKTMSNPNGVTFDSITTYLASIIVSKNSLRRALNKYKAIAICNGTQSPELIEIAAHDEIKYKKDSNIP
# TGKKIIQPSFHEQSQLLAMDTSSGKLRGGLPGILNLYIGMPVILKHENLNTEMGITNGARGYLRKLDLLSDHNGLSYCEYALIEFPDSKIQLSGLPAG
# YFPVKARTWHFSTYIWNDKHEKILVSIVRKQLPFEPSFALTGQGAQGRTLLAILCMLHLGGYGAYVAASRPQSREGLFITRKVTLDDLNMPSIPYDLW
# VETQRFQAIAYNTTIIWGFATGDLKEIPDAESDKRHCIRNIHYNFSIHNPQNGNKLIVNIIQKSEKNQKLQLYHK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g155
###
# start gene g156
Scaffold_9	AUGUSTUS	gene	669377	670175	0.39	+	.	g156
Scaffold_9	AUGUSTUS	transcript	669377	670175	0.39	+	.	g156.t1
Scaffold_9	AUGUSTUS	start_codon	669377	669379	.	+	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_9	AUGUSTUS	CDS	669377	669548	0.4	+	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_9	AUGUSTUS	CDS	669733	670175	0.9	+	2	transcript_id "g156.t1"; gene_id "g156";
Scaffold_9	AUGUSTUS	stop_codon	670173	670175	.	+	0	transcript_id "g156.t1"; gene_id "g156";
# protein sequence = [MAIQIKNDISESEELRPKLKRTENVAMKTVQAARSDLSWYYSFQLSPSSFNSYILAKVEDSIDSIMKEKEILLQKRLE
# DATMKSNSQLHYRIPTSCIPSPFATELNKEIEYAQELYMKFHPNFPTWNELKFYQKLAIALIYKYKLNNQQTLAFLLLANNVGQQLFIDKPLQPLRML
# VTGPGGTGKSHIFAAFTTSYTCSTCRVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g156
###
# start gene g157
Scaffold_9	AUGUSTUS	gene	670565	671020	0.72	+	.	g157
Scaffold_9	AUGUSTUS	transcript	670565	671020	0.72	+	.	g157.t1
Scaffold_9	AUGUSTUS	start_codon	670565	670567	.	+	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_9	AUGUSTUS	CDS	670565	671020	0.72	+	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_9	AUGUSTUS	stop_codon	671018	671020	.	+	0	transcript_id "g157.t1"; gene_id "g157";
# protein sequence = [MSGSRTQTTTTTPTCNLSASTSSRPVNPPSPGASIDNEEDVIMREALARVKQVKARKAREAAKKKAVEEAAARKAAEE
# TEKKKQAAAHAAVARPQAAQDARDRAVWAREQEDKIIERRKKLAEAVTARSQGGTPQGMFLLCREGRLWRYQG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g157
###
# start gene g158
Scaffold_9	AUGUSTUS	gene	677765	678274	0.91	+	.	g158
Scaffold_9	AUGUSTUS	transcript	677765	678274	0.91	+	.	g158.t1
Scaffold_9	AUGUSTUS	start_codon	677765	677767	.	+	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_9	AUGUSTUS	CDS	677765	678274	0.91	+	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_9	AUGUSTUS	stop_codon	678272	678274	.	+	0	transcript_id "g158.t1"; gene_id "g158";
# protein sequence = [MQPSPVPGYAAHPMNQSSSSRPSRPPIATYPSQASQSSPVDYHQNGPQYPHQYPNGNYQQQQQSQPQPQPPSVPQQGG
# PVLPPFSSLQTLHPQSSVRFQGPPEEQARVGRQGGSNKRQAPSTSNVTSADSSDIDDDENGELPASGLVAPWEVLRGLADVASERAAKVSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g158
###
# start gene g159
Scaffold_9	AUGUSTUS	gene	679458	679946	0.93	+	.	g159
Scaffold_9	AUGUSTUS	transcript	679458	679946	0.93	+	.	g159.t1
Scaffold_9	AUGUSTUS	start_codon	679458	679460	.	+	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_9	AUGUSTUS	CDS	679458	679946	0.93	+	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_9	AUGUSTUS	stop_codon	679944	679946	.	+	0	transcript_id "g159.t1"; gene_id "g159";
# protein sequence = [MRLVSTVELITLRERVHNALSSFDEPVKDSDFDELKKADASFRTWFATWDHAFSQKYEDAGRIVAFMWRLFDTQCPVA
# FYRQSLQIQQFHAELFHNATALRGINGPEDVQRMPQIQRELAIRSIQIARQGLDITVNSPAYREGMKYGQLAFLVSSNLADDSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g159
###
# start gene g160
Scaffold_9	AUGUSTUS	gene	680304	680639	0.85	+	.	g160
Scaffold_9	AUGUSTUS	transcript	680304	680639	0.85	+	.	g160.t1
Scaffold_9	AUGUSTUS	start_codon	680304	680306	.	+	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_9	AUGUSTUS	CDS	680304	680639	0.85	+	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_9	AUGUSTUS	stop_codon	680637	680639	.	+	0	transcript_id "g160.t1"; gene_id "g160";
# protein sequence = [MEHSSSSSSSIQGAQVYSPVYDTHFGENALPVNHSQMQQQQQQLQLQQQHIQPHLQPADADNIWRGFETTANEQLPVW
# MSDQTLGGSSFSQNGMDAFLLPADYLPPAPQIW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g160
###
# start gene g161
Scaffold_9	AUGUSTUS	gene	681794	682564	0.63	-	.	g161
Scaffold_9	AUGUSTUS	transcript	681794	682564	0.63	-	.	g161.t1
Scaffold_9	AUGUSTUS	stop_codon	681794	681796	.	-	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_9	AUGUSTUS	CDS	681794	682564	0.63	-	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_9	AUGUSTUS	start_codon	682562	682564	.	-	0	transcript_id "g161.t1"; gene_id "g161";
# protein sequence = [MSDKNEVMKNYVGILQKILRLRQICDHFELVEGKGLTSEDQTLASMQETVAAIERDGLTPAYAQVIFGFLREAGMTQC
# VECSAELSTVGENQGEDDTPSAPKRSKKSKNSSSRASTRANSPTLPKAVLTRCQHLFCIACYRQCVHPGWPEVFYPTAQSVSACPACQTALQPSDALE
# VKSESLEGLKKKSAKREKRQKGQSLPFTPSTKVRALLGDLVQFSKANPYSANYDPDSIDIQMTDEKGNQLDDGVVKTVVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g161
###
# start gene g162
Scaffold_9	AUGUSTUS	gene	682909	684447	0.37	-	.	g162
Scaffold_9	AUGUSTUS	transcript	682909	684447	0.37	-	.	g162.t1
Scaffold_9	AUGUSTUS	stop_codon	682909	682911	.	-	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_9	AUGUSTUS	CDS	682909	683856	1	-	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_9	AUGUSTUS	CDS	683905	684447	0.37	-	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_9	AUGUSTUS	start_codon	684445	684447	.	-	0	transcript_id "g162.t1"; gene_id "g162";
# protein sequence = [MYQNNLLLDHPTPPYDLQKYGPLFYLNPHNPPPGGHNQILHANNRLYSSNNASRWTSSQVSAKSVEVQRSQVDEVFKS
# IKGGDQLPETEPGQNNYPVSSFGRSFSSLAPEIATTLYPHQKKALTFLLERERETPGQNGTFSSLWRRHKTGMNGRDFWVHAVTEKEMFEEPQEAKGA
# ILADDMGLGKTITCVSLIAATLVTSRAFASTSVEQIESAHATSQQQDIPDPSSFAGSVWGMPDPAVSSAKAKAKIQRMQEKMASEFVRASRIKIKSRA
# TLIICPLSTVANWEDQFKDHWKGEVFVIGGAGGCTPAMSSSQCSSTPGSSSAQPMALLGDVKMNKKLGRTREGTSLRVYIYHGNARRPDPTFLADFDA
# VITTYATLASEYSKQSRSIASAEADEEEEESDADGAGGVEVDANGNEILRLPKPKKGTKRKKPTVLHSSEATSALQSIHWFRVVLDEAQCVRCLKLLT
# NKFDFFVHSVVLKKPEQSPVELLAIW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g162
###
# start gene g163
Scaffold_9	AUGUSTUS	gene	684813	685679	0.56	-	.	g163
Scaffold_9	AUGUSTUS	transcript	684813	685679	0.56	-	.	g163.t1
Scaffold_9	AUGUSTUS	stop_codon	684813	684815	.	-	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_9	AUGUSTUS	CDS	684813	685679	0.56	-	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_9	AUGUSTUS	start_codon	685677	685679	.	-	0	transcript_id "g163.t1"; gene_id "g163";
# protein sequence = [MLTQDGPKYTTWYRSPVQNIFTVFSVSSTSIQLSSSLSSAAITTMAGSVASHQLPSTPTPSLSNLSLSLQRNHSTNPI
# DLTGDDEDEDDDIDQYIIPRAHKRIRVDGNISRTGSNSVTLASRSPSLASASSSMSSMSSFPSAPQIPLRNTLDMRPSLFTNPQPPRHTPAPPEMYKP
# PFAGPSNSAAFFPPRAPAPMHPQPSEYRPSLKPSGSNVIDLTGSPSPPPPALPPPPPPQQYLFQNGNHLPPDLDARTAICIGQLSATALVLYPVPYIV
# QEPGSMEPSWVPVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g163
###
# start gene g164
Scaffold_9	AUGUSTUS	gene	687291	688920	0.15	-	.	g164
Scaffold_9	AUGUSTUS	transcript	687291	688920	0.15	-	.	g164.t1
Scaffold_9	AUGUSTUS	stop_codon	687291	687293	.	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_9	AUGUSTUS	CDS	687291	687804	0.91	-	1	transcript_id "g164.t1"; gene_id "g164";
Scaffold_9	AUGUSTUS	CDS	688045	688300	0.44	-	2	transcript_id "g164.t1"; gene_id "g164";
Scaffold_9	AUGUSTUS	CDS	688381	688623	0.48	-	2	transcript_id "g164.t1"; gene_id "g164";
Scaffold_9	AUGUSTUS	CDS	688702	688825	0.63	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_9	AUGUSTUS	CDS	688918	688920	0.63	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_9	AUGUSTUS	start_codon	688918	688920	.	-	0	transcript_id "g164.t1"; gene_id "g164";
# protein sequence = [MIGKKKLVLDHLIVQKMDDDESAGENVQSILTYGAQQLFNESKADIDNLITKTEKEGDQENAPKEGAAFSFAKIWTAD
# KDELEEIADEDQFEVDSWAQTLQRINDERAKKQAQEDEEHGKRGRPSKYALDIDIPEKNRSRTGSDADSMYGSDRISHVSDSSDDEPDAIVEETFQAS
# AMNSKKGKSKGTLLNTSPSANEPNACGLCGQRIRGHAMMIYGQPLYPVRSPRSGLATKQAQGLVAPRRQEPAVAKSVPLPHRQAQTHNNASASAVNGA
# GPSNGIQIMPQQLQVPSQVASTTTVHHSDIGISSGTPKRSLSPSHSEPESKRLKQQDTPPDACAVCQERPVHRLSDCSVVKGDLSKWVISFCAPHKLL
# TSVYQSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g164
###
# start gene g165
Scaffold_9	AUGUSTUS	gene	690348	690789	0.88	-	.	g165
Scaffold_9	AUGUSTUS	transcript	690348	690789	0.88	-	.	g165.t1
Scaffold_9	AUGUSTUS	stop_codon	690348	690350	.	-	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_9	AUGUSTUS	CDS	690348	690731	0.98	-	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_9	AUGUSTUS	CDS	690781	690789	0.88	-	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_9	AUGUSTUS	start_codon	690787	690789	.	-	0	transcript_id "g165.t1"; gene_id "g165";
# protein sequence = [MGLGKTVQIASFIGHIVKKFNAMPALIVVPNSTITNWVREFERWAPNLRVVPFYGESKARDVVKKFELFHSKVAKGMT
# GAKFHVLVTTYEAVINPKDFGTVFKNQPRWEVIVYSSIHALCTESINEGVGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g165
###
# start gene g166
Scaffold_9	AUGUSTUS	gene	691174	692184	0.81	-	.	g166
Scaffold_9	AUGUSTUS	transcript	691174	692184	0.81	-	.	g166.t1
Scaffold_9	AUGUSTUS	stop_codon	691174	691176	.	-	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_9	AUGUSTUS	CDS	691174	692184	0.81	-	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_9	AUGUSTUS	start_codon	692182	692184	.	-	0	transcript_id "g166.t1"; gene_id "g166";
# protein sequence = [MYISLPKGFISDYCVKGGLCMGCLETIPAQSREQLKDADGDTDMNVASPSTPDNGQLLFRCFTCKRLAHYQHIEDDIT
# PDDNLAEIASYYQSNWSCRDCRSYRWGLDKILAWRSYPASAIQPTQPFNIKEPLPREYLVKWQERGYRRTQWVPHMWLVSTHFSKLKNFITNGTKIEL
# LESTTDKPSEEEPASLFDIPDESPITQSKIENDPSSLLSPLVDAENRIPPGWKTVDRVLDVQLRFVPRANTKTKKKPRGEHRKSLVVNSDEEESEMEE
# AKEAFEAAFERGEEPKGFVESVDKFEARTGTRFDPQDQEHVDLVIWAFFKWVDLGYEEGKYN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g166
###
# start gene g167
Scaffold_9	AUGUSTUS	gene	705910	706410	0.74	-	.	g167
Scaffold_9	AUGUSTUS	transcript	705910	706410	0.74	-	.	g167.t1
Scaffold_9	AUGUSTUS	stop_codon	705910	705912	.	-	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_9	AUGUSTUS	CDS	705910	706410	0.74	-	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_9	AUGUSTUS	start_codon	706408	706410	.	-	0	transcript_id "g167.t1"; gene_id "g167";
# protein sequence = [MDVNESNATIPSVASLNYSASSRPQALLNPEADSFAYLETVLESLAVLGRLGSTLDIVAQRLTSEIYSLVETTIDEVS
# ERAEYGRRNSMFGLSTHKSEGVYVFSSDPSLVVQHQGYFPSSSLRLAALESSAQQVDQEILRDFFWTLYSKVDAVSQGLRVIYEVAIE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g167
###
# start gene g168
Scaffold_9	AUGUSTUS	gene	709392	709778	0.78	-	.	g168
Scaffold_9	AUGUSTUS	transcript	709392	709778	0.78	-	.	g168.t1
Scaffold_9	AUGUSTUS	stop_codon	709392	709394	.	-	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_9	AUGUSTUS	CDS	709392	709778	0.78	-	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_9	AUGUSTUS	start_codon	709776	709778	.	-	0	transcript_id "g168.t1"; gene_id "g168";
# protein sequence = [MFAADEGEVIDDVILRAEPGPSRSPPWANSLIPPNPPPQDHALVYPIHNETAEDLSRNHSNYRQLDYKANIIQSTASG
# DENSQKDKRTEGFFPNWTSRVSDSLVSLAFLGSPPASSSCKPVTAGAASS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g168
###
# start gene g169
Scaffold_9	AUGUSTUS	gene	713097	713366	0.55	+	.	g169
Scaffold_9	AUGUSTUS	transcript	713097	713366	0.55	+	.	g169.t1
Scaffold_9	AUGUSTUS	start_codon	713097	713099	.	+	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_9	AUGUSTUS	CDS	713097	713366	0.55	+	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_9	AUGUSTUS	stop_codon	713364	713366	.	+	0	transcript_id "g169.t1"; gene_id "g169";
# protein sequence = [MAAQKRALDDSSSTHKTKKPKISQQPENTQPVSATTNLTADEIDFPRGGGTSFTPLEVKNIRAEAMKEAHEELFNVSL
# DQILRSDAHLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g169
###
# start gene g170
Scaffold_9	AUGUSTUS	gene	715125	716266	0.32	+	.	g170
Scaffold_9	AUGUSTUS	transcript	715125	716266	0.32	+	.	g170.t1
Scaffold_9	AUGUSTUS	start_codon	715125	715127	.	+	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_9	AUGUSTUS	CDS	715125	715342	0.32	+	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_9	AUGUSTUS	CDS	715408	716266	1	+	1	transcript_id "g170.t1"; gene_id "g170";
Scaffold_9	AUGUSTUS	stop_codon	716264	716266	.	+	0	transcript_id "g170.t1"; gene_id "g170";
# protein sequence = [MDLQVLVVDAERNRVSLTAKKSLIESDLPRITAFEHAKIGVVALGVIFKVLPKALMIEFYNNVKAIVPIKEVSEEPVE
# NLSSLYTPGKVVKIRIIALKPEEKTIIASIRKSGAVYKPFSPDISGVEIGNIVQGVVFEIHKENAVLALQPSNVRALISINNLANHRGLSAAQLKVAL
# KAGDKLEALVVVSRNTENNFVIVANKPRLKLSLAKSVISLDTVESGQSVGGRVVRHTAYGVLVKLSSHIGGVLYPTDVSDDFGSATPFPAMDAILKAV
# VVSVDQDRKQLILSTRRSRMYPDQANKVVDREITQISDLHVGAKVRGFIKSITDHGLFITIGRNIDARVQIRELFDDVSTNPDV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g170
###
# start gene g171
Scaffold_9	AUGUSTUS	gene	716437	717481	0.69	+	.	g171
Scaffold_9	AUGUSTUS	transcript	716437	717481	0.69	+	.	g171.t1
Scaffold_9	AUGUSTUS	start_codon	716437	716439	.	+	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_9	AUGUSTUS	CDS	716437	716578	0.71	+	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_9	AUGUSTUS	CDS	716670	717481	0.87	+	2	transcript_id "g171.t1"; gene_id "g171";
Scaffold_9	AUGUSTUS	stop_codon	717479	717481	.	+	0	transcript_id "g171.t1"; gene_id "g171";
# protein sequence = [MTLRSGDLSKPVALTFSALAPGQHVDGVVKRIEEYGLFIQIDNSKLSDFAVALRGFRENDRVKAVIVEIKDKRISLSL
# KPSRFAVEDTDDPQANDQPIDELDGVDVQSSRSEAGDEDSSDDDESVMRVDVNTQPQLQHSYATGKSSNAPLKLSDYQWFGDTVDVDASHSHESDDSD
# DEAPSKKKKKRKEIEQDLTAQMHSKAPESSADFERLLLGSPNSSYLWIQYMSFQLQLSEIEKAREIGRRALDKISFREEAEKLNVWVALLNLENAYGI
# DETLEKVFKDAARANDSKTVHLRLASILDQSDKHKVSRWFRGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g171
###
# start gene g172
Scaffold_9	AUGUSTUS	gene	718154	718954	0.73	-	.	g172
Scaffold_9	AUGUSTUS	transcript	718154	718954	0.73	-	.	g172.t1
Scaffold_9	AUGUSTUS	stop_codon	718154	718156	.	-	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_9	AUGUSTUS	CDS	718154	718954	0.73	-	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_9	AUGUSTUS	start_codon	718952	718954	.	-	0	transcript_id "g172.t1"; gene_id "g172";
# protein sequence = [MREELTKQKNSNTTLQAELDAARAGKSRANGRTTPSSDDGSEALRSQVVEAKWQLHQVQSENAELHSRLDSLESELET
# LRDSLVASQRESDDRLTQAEELQLEVERLQSSLIIARGGNEETMLEKISNENTTLRRENEQLSHKIGLLLEVDQSTFGQGRPISGISPRRASASSSEN
# ALAFEHLSSELDDWQRQLASSMSNRRPLSDWTQSPCSGPDLRVHDIHDIQILPLLCIYCWLIPSICRSTDLSTFAWIFTHITFILLPCFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g172
###
# start gene g173
Scaffold_9	AUGUSTUS	gene	719451	721496	0.25	-	.	g173
Scaffold_9	AUGUSTUS	transcript	719451	721496	0.25	-	.	g173.t1
Scaffold_9	AUGUSTUS	stop_codon	719451	719453	.	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_9	AUGUSTUS	CDS	719451	720527	0.56	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_9	AUGUSTUS	CDS	720585	721496	0.4	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_9	AUGUSTUS	start_codon	721494	721496	.	-	0	transcript_id "g173.t1"; gene_id "g173";
# protein sequence = [MQTSYMYWIRVRIPSLSFIHLPMLMVMLPEHIKYPDANKPQQNGNPAQQHVSRKSSAGSPAIQQQPRSGSPSVVTGAP
# YNRSMSPATQGSDSEDARRAVSPPNARLMKPVNGVITQPFPVKGKGPIRSRREDDDGAGTDDGMDAATSESGVRERAMSPEQSIMSRAKSPQYIRGVS
# PNDMEASSAPNMVTMALNGRSSPAVDRSRLPADPFYNPHTPHVNGHVRSGSKNGSVGNITADLVRDLKNKEIELEGMKRQMTWMKEAVGKATRAGFIY
# TERDIGDIDNNSSADNELVLKFKQFRAQMQVAMVEQANQASEHLANAERMKVSAAQEAAYYRSKIVALESSNESEALRLERQRVADLERDMSTLMNER
# WLQDRKINELSDSVALHTTLYEQAEARSAEASKRADMLDESNGRLSQQHSDLQQRHAALDAQFRSHADKLLSSSSSLQQSQAEVDAARAQVDDLTRSQ
# DQHIRALEQARDALQAAASRADEADEQYQHARERINTFEAELADLRGEVEARTSEVESTRARLAEVENMWAKSREEADSLRTMTTGSLGELLDSHRDL
# RSDEDRLTRGHVERMEAVEEESASLRQLLKDANQRVEESQLRSWRSIADFGNMRLNSLTLVSDLRFARSVSNALTENGDIDKALLREIPTFKIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g173
###
# start gene g174
Scaffold_9	AUGUSTUS	gene	724357	726728	0.22	+	.	g174
Scaffold_9	AUGUSTUS	transcript	724357	726728	0.22	+	.	g174.t1
Scaffold_9	AUGUSTUS	start_codon	724357	724359	.	+	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_9	AUGUSTUS	CDS	724357	724935	0.6	+	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_9	AUGUSTUS	CDS	725278	725749	0.31	+	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_9	AUGUSTUS	CDS	725854	726728	0.91	+	2	transcript_id "g174.t1"; gene_id "g174";
Scaffold_9	AUGUSTUS	stop_codon	726726	726728	.	+	0	transcript_id "g174.t1"; gene_id "g174";
# protein sequence = [MTESHTQESRFALPYYGISGNDSISLTHPNSSSQPLDLSSLEGMGTNTSTSQSSITIDEPSPPSSFTDTTTSSISSGV
# AGKLPKKNLIILEPPRILSPPPAYDEPSHQRPITVRHTSVPSLPSSQPYPTEVPPRPATTANDSRTVDSRRTDTNPRGLDPIDELDESNPLGLSLHHG
# GPYEAIKKVTQTPREPQVLHPQPALQNQQITNLQKHTPQHLMQAPLHHPQHHHQAQPPIHREQPYVQQNTSQFSTQHPSQLGVRARADLFDAEPAQPP
# SPLLSVPQRFEDDASSIYGDEADAYDGIEDEEISQDLDNPTSEILHQPESFTHFKSAPDMPQTYIDNATAIEDDVAPSYRPPPRRHEQQGRPLEYPEE
# QTPYTPYVTANQPDGVWHRRATSLDPDYNLHGSQLPQHRPMNPGHPHVSVTKNLGRVPELNPDNMVQLRAVKPYPQPQQFAPLPPNGNLERPVRSKPA
# PSIQQSISSTNSRNGLPPRHVPAKLTMPQPLYNPNAPPTHRDIAVPSNKPQVRFQPPPHNSGVSLSVPLSQTRPSTRNSVPESSKVQAQIIPMATDSR
# KVLRKRSSVQAVGPGTASVMPVGTPNIPRSNYPPTRSKSEVRPPATGTRTNSISVPPDKKAPRRLLSKKRAEF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g174
###
# start gene g175
Scaffold_9	AUGUSTUS	gene	727180	727481	0.34	-	.	g175
Scaffold_9	AUGUSTUS	transcript	727180	727481	0.34	-	.	g175.t1
Scaffold_9	AUGUSTUS	stop_codon	727180	727182	.	-	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_9	AUGUSTUS	CDS	727180	727208	0.64	-	2	transcript_id "g175.t1"; gene_id "g175";
Scaffold_9	AUGUSTUS	CDS	727283	727311	0.5	-	1	transcript_id "g175.t1"; gene_id "g175";
Scaffold_9	AUGUSTUS	CDS	727366	727481	0.39	-	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_9	AUGUSTUS	start_codon	727479	727481	.	-	0	transcript_id "g175.t1"; gene_id "g175";
# protein sequence = [MQVKHKAADDFNEHRELYLKRTAWAGQCSSWFKPGPNGTKSGDVPWKSSNEAEDVSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g175
###
# start gene g176
Scaffold_9	AUGUSTUS	gene	730175	730813	0.75	-	.	g176
Scaffold_9	AUGUSTUS	transcript	730175	730813	0.75	-	.	g176.t1
Scaffold_9	AUGUSTUS	stop_codon	730175	730177	.	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_9	AUGUSTUS	CDS	730175	730813	0.75	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_9	AUGUSTUS	start_codon	730811	730813	.	-	0	transcript_id "g176.t1"; gene_id "g176";
# protein sequence = [MITPAVQRTVAPTVPALRVIKRTKRYDDERTSSSTSSTSLVSGTVNNAPGGKMPSPPLMTAPLEAQGPPPSKTASRHE
# GLTRAIIAESSASTTAKAMLKPSLSKASSVSGPRRVLLPESGKPTKPASGPGTFARPKIPVPTLATVHGRASAVASGISRPAVVSGIPPPVSKLPAPS
# GIARFGRKASAPPSSESSSRMAPVRLIPRRYSTYGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g176
###
# start gene g177
Scaffold_9	AUGUSTUS	gene	731118	731612	0.82	-	.	g177
Scaffold_9	AUGUSTUS	transcript	731118	731612	0.82	-	.	g177.t1
Scaffold_9	AUGUSTUS	stop_codon	731118	731120	.	-	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_9	AUGUSTUS	CDS	731118	731612	0.82	-	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_9	AUGUSTUS	start_codon	731610	731612	.	-	0	transcript_id "g177.t1"; gene_id "g177";
# protein sequence = [MESPTQLPGDSISALTSLVDSVNLAGKTFGHIHRHILPPRITVDNSDAENDILATPAPFNLQTSTSSLQDASEAATVS
# LLAPPSPATTPVSRASNRISLDLHSSFNLQLQSETSFDLLNDRISFFDAQGKGMSSFLNELDDDSDPERFDADSAYLFPLVDTFQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g177
###
# start gene g178
Scaffold_9	AUGUSTUS	gene	731666	732028	0.79	-	.	g178
Scaffold_9	AUGUSTUS	transcript	731666	732028	0.79	-	.	g178.t1
Scaffold_9	AUGUSTUS	stop_codon	731666	731668	.	-	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_9	AUGUSTUS	CDS	731666	732028	0.79	-	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_9	AUGUSTUS	start_codon	732026	732028	.	-	0	transcript_id "g178.t1"; gene_id "g178";
# protein sequence = [MNRPRPSVLAQFDPLLSETRPDYVSDSEDESDPDKENSVPELNELSMTAFFSHTYKREYAQPAALTKRLVDIGDVTIA
# DTVDEEEETEESGDNGENAFFSLDTPSVPTLYGYLKTPYALR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g178
###
# start gene g179
Scaffold_9	AUGUSTUS	gene	732785	733845	0.38	+	.	g179
Scaffold_9	AUGUSTUS	transcript	732785	733845	0.38	+	.	g179.t1
Scaffold_9	AUGUSTUS	start_codon	732785	732787	.	+	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_9	AUGUSTUS	CDS	732785	733344	0.51	+	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_9	AUGUSTUS	CDS	733419	733845	0.6	+	1	transcript_id "g179.t1"; gene_id "g179";
Scaffold_9	AUGUSTUS	stop_codon	733843	733845	.	+	0	transcript_id "g179.t1"; gene_id "g179";
# protein sequence = [MSRRDSGSSNGREDDEEAGNSSFVADSPVKGSSSKSFMSLFEDASTDPKVKTALTRTKSTSASVGLFGPLRSQSVPFE
# DDFESILGPVEGKLKSRLRTTANGIPFSSGLVPKPKKDGLYLMQDPIPQPSHAHTVEKYSINDRISRKRQPDSESDSEQLNLNPLTSVTILIPPSPPR
# EAPSQRSVDVSVNVKVLPIVSRPSRASDEDRDLDAGPEFDSVHWYNRRVEPPRVDNGEHTSNTFEVDLPEKLKRVLAFSSSDIEMRHIQEEQVVESLI
# YGRRRGHYEPSKGGEIWDVGDTNAVGLHEEAGDMKAIADEDWEGEPVPWEVGEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g179
###
# start gene g180
Scaffold_9	AUGUSTUS	gene	734948	736753	0.7	+	.	g180
Scaffold_9	AUGUSTUS	transcript	734948	736753	0.7	+	.	g180.t1
Scaffold_9	AUGUSTUS	start_codon	734948	734950	.	+	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_9	AUGUSTUS	CDS	734948	736753	0.7	+	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_9	AUGUSTUS	stop_codon	736751	736753	.	+	0	transcript_id "g180.t1"; gene_id "g180";
# protein sequence = [MFLNPTIESLQFELGPTRFPNLNKILGDACSRLNLTSFSIISPASLPDTFTVMLSSQKSLQKVVLVAPGALSSGVGRW
# IAFLPQLKSLQLDLSARTLTAVEGFFDELPSHSGDSTPNSVATTDSGVFSGEELDFSEIRLKSAMRDSKAGFSSLRHIHLTGDVANIAVFLRHFSIPL
# TQLDLVIEDPPDNAEWMELSYLISERFGSSLHSLRISATATSKFNDLVRSTSRGEPTVSRLAFDNLQPLPALRRLDIDLPESINFIGDDIEALAHACP
# NLEELKLCPLARFPVQSGPPKLTLEQLAPLVEHCRRLHSLSSPCECARAGASVLDSQSNSSDTIRRLHVGHSWINDSLHVSILLSHLAPYLDNLKWFH
# DKNRPGFIESNARGWEKVADTLPHLQGIRLTERKAMIGPLPSLNIITTPPLPQPVPVDTVEKGVMASVSLVHEGVLARPLMTSRRPSMVDESVEVHPE
# LASVSIDATPRTTEIAVEAVVAVSDEFVEALPETVTASVDARPPSVSKSVEAMILNPLEGKKSIFHSSSHPLLFPVFSLISFTYRVLFAYPISIPIRM
# LHVIFDNMPTIIRRPPASTNSDISMDSLQVRQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g180
###
# start gene g181
Scaffold_9	AUGUSTUS	gene	738874	739737	0.7	-	.	g181
Scaffold_9	AUGUSTUS	transcript	738874	739737	0.7	-	.	g181.t1
Scaffold_9	AUGUSTUS	stop_codon	738874	738876	.	-	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_9	AUGUSTUS	CDS	738874	739737	0.7	-	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_9	AUGUSTUS	start_codon	739735	739737	.	-	0	transcript_id "g181.t1"; gene_id "g181";
# protein sequence = [MRGEVVKEPAWYAAVLDNPPLPLPPKAPPNRVAFDLKQQTTSARSKPKAKPYGPKPFPVYYLEDDIRRQFFRDHPFEV
# FRPVTLAEGQGIEADHPVTGTEWTRLRQRGRNPSPDEYVDVFTTRPSGFNVIAIHSAIQFTLNLHQHHNIPLSYAYARAIAQFRALRSERHIAMTMAI
# HEADNLGAVWQNSEIAHGFQKEIKSLASWERQSELDEGAMAARKRWRSIALEHTEDREWSKGQEYVRLWKEGITPRYAPALTEPVKPAVLEDPEKNVD
# TFGLRTKPAVVPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g181
###
# start gene g182
Scaffold_9	AUGUSTUS	gene	741382	742004	0.4	+	.	g182
Scaffold_9	AUGUSTUS	transcript	741382	742004	0.4	+	.	g182.t1
Scaffold_9	AUGUSTUS	start_codon	741382	741384	.	+	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_9	AUGUSTUS	CDS	741382	741486	0.4	+	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_9	AUGUSTUS	CDS	741540	742004	0.98	+	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_9	AUGUSTUS	stop_codon	742002	742004	.	+	0	transcript_id "g182.t1"; gene_id "g182";
# protein sequence = [MQPVVCWEKVWSTPENAPTGSSLKVFKWVKTDRIPHFEDENEVNAPLAPLPDEPEVVEVEEEEETQPVAEEKTQAEVA
# ETSEVIQEPEESKPPSPKPQLTMSMEDTVDTDSGLDVSLNPLDTSGVGGENMTTESSMDLDLSGLGPDGLALTDVQDLSQIEGEDSLMGGPNMDSTMD
# PFAAESTVTMDEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g182
###
# start gene g183
Scaffold_9	AUGUSTUS	gene	743940	744299	0.36	-	.	g183
Scaffold_9	AUGUSTUS	transcript	743940	744299	0.36	-	.	g183.t1
Scaffold_9	AUGUSTUS	stop_codon	743940	743942	.	-	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_9	AUGUSTUS	CDS	743940	744299	0.36	-	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_9	AUGUSTUS	start_codon	744297	744299	.	-	0	transcript_id "g183.t1"; gene_id "g183";
# protein sequence = [MSSVIVVNGPELSSAYHGETESKLRDVFKEARDKSPCIVVLDEVDALVPQREEGGGEVEKRVVATLLTILDGMEDDNE
# DDSRVVVIGTTNRPNAIDPALRRPGRFDREIEIGKFTLIFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g183
###
# start gene g184
Scaffold_9	AUGUSTUS	gene	748738	749904	0.92	-	.	g184
Scaffold_9	AUGUSTUS	transcript	748738	749904	0.92	-	.	g184.t1
Scaffold_9	AUGUSTUS	stop_codon	748738	748740	.	-	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_9	AUGUSTUS	CDS	748738	749904	0.92	-	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_9	AUGUSTUS	start_codon	749902	749904	.	-	0	transcript_id "g184.t1"; gene_id "g184";
# protein sequence = [MAHSTPGTPTITSKVVRGFRGSLQRSTTKLLSLSSSKDKLGSAAGTANPLSSVVEDGWTDSDYCHISTQDLPIPLDDP
# VTARSSSLTLAVRTPVPETSSRFSFTRLKNLSRISVSLRRPKSIQHKERVHLPFFNKSETSSILDEFPQPPSHIPVTPMTPAGYTWPLLPRPLIEEEH
# LSKSLPVTEIPRERSSSRESNGPFKSLTRALTRLGRHTSTKAGPTVVAESTTIIVGPPRPTRTPPDPPVEEQKTYQVVDPLQLTASPSSLLSAELSMS
# NRNSFIPPSPSWLSRNVQPEPRPEPPTVTLASSEDIATPSSPSPLPIPPRILVSSCSDSPLLSPLEAVDWLEYPEVADIRQSFVSIINARREERNDPV
# YKVSNLIFKIASMPRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g184
###
# start gene g185
Scaffold_9	AUGUSTUS	gene	750214	751667	0.27	-	.	g185
Scaffold_9	AUGUSTUS	transcript	750214	751667	0.27	-	.	g185.t1
Scaffold_9	AUGUSTUS	stop_codon	750214	750216	.	-	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_9	AUGUSTUS	CDS	750214	750880	0.98	-	1	transcript_id "g185.t1"; gene_id "g185";
Scaffold_9	AUGUSTUS	CDS	750943	751667	0.28	-	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_9	AUGUSTUS	start_codon	751665	751667	.	-	0	transcript_id "g185.t1"; gene_id "g185";
# protein sequence = [MLFPAIWATAWYALAHMSPVGYLTSWSPVSGSPTYDWLMPVFGTPIKDWLVAAWAVVFSQLGEMWYMGEESPEEASLL
# DHEHLVPHSIDSVIKSRFKGTLTFGAVLLALTAPSYIWHGSDLALPRPIIASDSTPLTVGCVLPPRAKSKQNHLQLTFEDFLIESRTMNTANILLWPE
# GAVSFTDEDERKNALETVRSMITSPNQRVGVSFEESYRDLANPTGRGHPLRRTGLALVSKSNVTEIVLIALIYMLIVAESFRLQKSDNPPPLFTFDLK
# LPKWASGPAIRPISVTASICLDFAMPDPFADLPSTSSSEKPQLILGPARTWDLAVGDAMWEQAKQRAKELDTMVLWCDGGEGGVSGVAGQGMDGVMQV
# GEGSWIRTVGIKNPPDSHKTFYATIKGSGATIGFIWLLVAGGSGWRMLEVLASGFGILPLNLRDVFLRWKEYRRTQALSHDQEANLLTFDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g185
###
# start gene g186
Scaffold_9	AUGUSTUS	gene	755429	756397	0.77	-	.	g186
Scaffold_9	AUGUSTUS	transcript	755429	756397	0.77	-	.	g186.t1
Scaffold_9	AUGUSTUS	stop_codon	755429	755431	.	-	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_9	AUGUSTUS	CDS	755429	756397	0.77	-	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_9	AUGUSTUS	start_codon	756395	756397	.	-	0	transcript_id "g186.t1"; gene_id "g186";
# protein sequence = [MPRKLSKRRGLSGIFGSYGKTTSHSLPTSPVADILSQPHPPRDEKSKRASTMPPVPPSSHRPISAIKKDRRGSIIGRL
# TKRFSVTRKQSSTVDHESLPHTEDHSTEMRLAFNKSSEKLSKRVPPPSLDNIEVDEITLKAIHDPDRRSSISVEASFPATGKLMVANPDAPSSEISTP
# PQVDAPLPVHQANTSDSQPWRSADKRSSSGPSQHAPLDPSLSAVSYSPPFPAPAQNPASTSFSSSPLNGHIYTSDSANAIKSPRHGSASAGYSQRQSL
# DDNVSHIPSERVISPIPSNHRRSEEHRRPRSPSVDRHHLRQPLSSTSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g186
###
# start gene g187
Scaffold_9	AUGUSTUS	gene	756480	757316	0.74	-	.	g187
Scaffold_9	AUGUSTUS	transcript	756480	757316	0.74	-	.	g187.t1
Scaffold_9	AUGUSTUS	stop_codon	756480	756482	.	-	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_9	AUGUSTUS	CDS	756480	757316	0.74	-	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_9	AUGUSTUS	start_codon	757314	757316	.	-	0	transcript_id "g187.t1"; gene_id "g187";
# protein sequence = [MEKRERLERKASSAKRKSQGHLFSRKSVKRSSKTAATSPAPEPGPSLNSTTTITASKLVGKQPEQKQDAGEMDTLEQN
# EKNDSVTSLPTTSIIPDALKELPAWYSKEDWSSTPSFKVRFPIHNPVGPRYYRNHHLIPPSVYRPGARPPSIFSPSFPAMGTSSMPERLDDATRLPVP
# SRTPSHSPLPTPSSSQTRVADLGIKPRSRKTSQSAHDNVDLLDVSDPWGTNWHHESPYDIGLASSGPIAADVDVSVVALSILYSSIVLLAFSLSSLEY
# NNAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g187
###
# start gene g188
Scaffold_9	AUGUSTUS	gene	759815	760666	0.99	+	.	g188
Scaffold_9	AUGUSTUS	transcript	759815	760666	0.99	+	.	g188.t1
Scaffold_9	AUGUSTUS	start_codon	759815	759817	.	+	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_9	AUGUSTUS	CDS	759815	760666	0.99	+	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_9	AUGUSTUS	stop_codon	760664	760666	.	+	0	transcript_id "g188.t1"; gene_id "g188";
# protein sequence = [MSVNDLLVQGAEPLYFLDYYGCSKLDVAIASQVIQGIAEGCREAKCALIGGETAEMPGMYQPGQRYINVQFDCALIGT
# RFIGDYDLAGFAVGAVERERILPSNNIVAGDILLGVASSGLHSNGFSLVRKILETTNLSYSSPCPWDTTLTLGRALLKPTAIYIKQILPAAQAGYIKG
# MSHITGGGFVENIPRVLPKELGCSIDASSWELPPVFQFLMKQGGVEPLEMARTFNNGIGMVVIVSESSAPLVTETLRKAGNAEIYQIGRVTSKVGVVM
# ENIHVWNPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g188
###
# start gene g189
Scaffold_9	AUGUSTUS	gene	762118	762531	0.76	-	.	g189
Scaffold_9	AUGUSTUS	transcript	762118	762531	0.76	-	.	g189.t1
Scaffold_9	AUGUSTUS	stop_codon	762118	762120	.	-	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_9	AUGUSTUS	CDS	762118	762531	0.76	-	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_9	AUGUSTUS	start_codon	762529	762531	.	-	0	transcript_id "g189.t1"; gene_id "g189";
# protein sequence = [MNTSYPPNDYYSMSTPSFQQPSPNGMNIISSPNGAPVVQPEMFPPPHPFSPNGVPQVPFTAVSPVGEPAPYLPQPPMS
# AAPPQIYHQPPPPQPSTMYNNTSVPAPPFVVQSNGMSQYPPIPASAPVGYSDGVVDPHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g189
###
# start gene g190
Scaffold_9	AUGUSTUS	gene	767575	768065	0.48	-	.	g190
Scaffold_9	AUGUSTUS	transcript	767575	768065	0.48	-	.	g190.t1
Scaffold_9	AUGUSTUS	stop_codon	767575	767577	.	-	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_9	AUGUSTUS	CDS	767575	767945	1	-	2	transcript_id "g190.t1"; gene_id "g190";
Scaffold_9	AUGUSTUS	CDS	768014	768065	0.48	-	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_9	AUGUSTUS	start_codon	768063	768065	.	-	0	transcript_id "g190.t1"; gene_id "g190";
# protein sequence = [MNSSKLTKKQKKGIAFRIPVLEIQDGLDIEDVEMENETVFPEEKIKDATASAREKGKGKAIEEKADAVMVPPNKRKRG
# SEPVMEKVRDGEGKEENVPKKKKKGNDEKQRFILFVGRSIIRFSIQAGFDFTFAGNLKYTTP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g190
###
# start gene g191
Scaffold_9	AUGUSTUS	gene	768913	769623	0.53	-	.	g191
Scaffold_9	AUGUSTUS	transcript	768913	769623	0.53	-	.	g191.t1
Scaffold_9	AUGUSTUS	stop_codon	768913	768915	.	-	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_9	AUGUSTUS	CDS	768913	769623	0.53	-	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_9	AUGUSTUS	start_codon	769621	769623	.	-	0	transcript_id "g191.t1"; gene_id "g191";
# protein sequence = [MFVLFHQCKKISNNTAQEQPLSASFLKIAESLGVFDLWCDTNMNTTKESDQWAQHTVQAIVWNAAGAFTNIEIFLQWL
# YLRACGKGCENIGDIEADVAVAFTSAGSSDNNRLTALLNTAYRVRMLRTCNSSFPTLFLAARTAGKLRQCSRDTSESGSVERTYSPRLQDMGSRSLAS
# FSIACFKAVRFIVFYIFQVLYNVMVEVKTGYTATFYFHASPLESVTCDIMFIYRDLDQFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g191
###
# start gene g192
Scaffold_9	AUGUSTUS	gene	771430	771732	0.68	+	.	g192
Scaffold_9	AUGUSTUS	transcript	771430	771732	0.68	+	.	g192.t1
Scaffold_9	AUGUSTUS	start_codon	771430	771432	.	+	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_9	AUGUSTUS	CDS	771430	771732	0.68	+	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_9	AUGUSTUS	stop_codon	771730	771732	.	+	0	transcript_id "g192.t1"; gene_id "g192";
# protein sequence = [MSDWRAIAAKKKAKQQALIPKEWMLKLDDIPIGADVSRVPETCGLMTVTEIQITNSDVDDLLEKLAAGEWSSVLVTTA
# FYKRAIIAHQLVSWLLKNLQRC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g192
###
# start gene g193
Scaffold_9	AUGUSTUS	gene	774348	775136	0.48	-	.	g193
Scaffold_9	AUGUSTUS	transcript	774348	775136	0.48	-	.	g193.t1
Scaffold_9	AUGUSTUS	stop_codon	774348	774350	.	-	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_9	AUGUSTUS	CDS	774348	774872	0.94	-	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_9	AUGUSTUS	CDS	775023	775136	0.49	-	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_9	AUGUSTUS	start_codon	775134	775136	.	-	0	transcript_id "g193.t1"; gene_id "g193";
# protein sequence = [MYRDRAGRESSPSSSSENPTPPLAVQENSEESEDGGKVVKQPRILNLLAESRPVEDEVKSEAAFQRLVAAGAELPMQP
# RTPSTMSNRGRYPEEACEDDYQREETPSDDEGEDEPSYASSMSEPIAIRNRTPAGSVNGDDLNTMSISESPSFSSISSMAMDVDVVSESSLCLTFSDY
# EVQPSASPSISSLSSTPIHHWRYPSPDYQCRAVKQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g193
###
# start gene g194
Scaffold_9	AUGUSTUS	gene	776642	776875	0.88	+	.	g194
Scaffold_9	AUGUSTUS	transcript	776642	776875	0.88	+	.	g194.t1
Scaffold_9	AUGUSTUS	start_codon	776642	776644	.	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_9	AUGUSTUS	CDS	776642	776875	0.88	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_9	AUGUSTUS	stop_codon	776873	776875	.	+	0	transcript_id "g194.t1"; gene_id "g194";
# protein sequence = [MSKRSVTEVVSTAYGQAFLKVSGAGARREASTEDEMGEFEDAWEDEIEEDEDVVDAEADSQEDGAEFSGHLSTCSTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g194
###
# start gene g195
Scaffold_9	AUGUSTUS	gene	777182	778338	0.46	+	.	g195
Scaffold_9	AUGUSTUS	transcript	777182	778338	0.46	+	.	g195.t1
Scaffold_9	AUGUSTUS	start_codon	777182	777184	.	+	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_9	AUGUSTUS	CDS	777182	777430	0.46	+	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_9	AUGUSTUS	CDS	777490	778338	0.54	+	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_9	AUGUSTUS	stop_codon	778336	778338	.	+	0	transcript_id "g195.t1"; gene_id "g195";
# protein sequence = [MSSLHKKQKNSGKYVDCIFRKSTHHSILRADDSDSDDDEEDDALDEDPIIEHRSVPHLGGVNRIRAQPLPASEPLPPP
# TQPYHNHWRLLATLLINYAVANLSSQSMRMDGQRALRWDWAASSASSIRLLTGDINSQIFLTTSTVSGFSVLPRPFTSHTSSVEDIQWSPAEPTVFAS
# CSADRTVQIWDVRSKGRKSVAGIDPAHESDVNVISWNKGTSYLLVSGGDEGSIKVWDLRNVQKKGYLVFCWIFTLILTDLELRTSTPTPTPIASFDWH
# KGPITSLEWHPSDLSTFAASSADGIVSLWDLAVEHDDDEMNETLDTKDIPPQMLFNHHQKDVKEIHWHPQIPGAVVSTGAEGFDVFSTIAT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g195
###
# start gene g196
Scaffold_9	AUGUSTUS	gene	785415	786110	0.6	+	.	g196
Scaffold_9	AUGUSTUS	transcript	785415	786110	0.6	+	.	g196.t1
Scaffold_9	AUGUSTUS	start_codon	785415	785417	.	+	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_9	AUGUSTUS	CDS	785415	786110	0.6	+	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_9	AUGUSTUS	stop_codon	786108	786110	.	+	0	transcript_id "g196.t1"; gene_id "g196";
# protein sequence = [MVERLNNMAYNHSHSNVPFNPRSVSLDIRTPEELAAVNEFLVTLGRDVSGMIPSTRSGHQTRSQGSFTSESFFDSVAL
# SQLGLTGMPGLPPTEDFVSAPSSYAGGPPTSATFTHRPGSSGMYSGVGGEAAPGRRSSRYSHLQQYDFPGSGTYHQLTPPLDPSSESPHSTSTPVSMH
# AMAQSFSNNSRYSALSPTYSSHPSVSGQFGVHLNPSPRVQLGLIICALPVDLYQM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g196
###
# start gene g197
Scaffold_9	AUGUSTUS	gene	792135	792874	0.54	+	.	g197
Scaffold_9	AUGUSTUS	transcript	792135	792874	0.54	+	.	g197.t1
Scaffold_9	AUGUSTUS	start_codon	792135	792137	.	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_9	AUGUSTUS	CDS	792135	792213	0.62	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_9	AUGUSTUS	CDS	792294	792874	0.7	+	2	transcript_id "g197.t1"; gene_id "g197";
Scaffold_9	AUGUSTUS	stop_codon	792872	792874	.	+	0	transcript_id "g197.t1"; gene_id "g197";
# protein sequence = [MQLEGQGCPASISFKTYYDTDEIRACWPANLAFTRRGRRAAAEAEKTKSNKHIRFANDTNSVNDASTSTSIAGPSAIP
# QSLPANNYTSAVSMIAPLPPTQNSYQTTPSQSYNYQTQYQYASTPAPVPPPAPVPPPQSSNDAFSHDRWANMETLFQSVREHARTFAYPSASVAVLET
# VLIRLFLESPSQPGMGQQPMTAPLMPQSMSTRMDDEDGSSEET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g197
###
# start gene g198
Scaffold_9	AUGUSTUS	gene	798591	799481	0.77	-	.	g198
Scaffold_9	AUGUSTUS	transcript	798591	799481	0.77	-	.	g198.t1
Scaffold_9	AUGUSTUS	stop_codon	798591	798593	.	-	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_9	AUGUSTUS	CDS	798591	799163	0.78	-	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_9	AUGUSTUS	CDS	799215	799481	0.77	-	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_9	AUGUSTUS	start_codon	799479	799481	.	-	0	transcript_id "g198.t1"; gene_id "g198";
# protein sequence = [MPGLKLTATALLSLFPLQVFAGPSVLRSRESNFDVIPPGFTLVGTPPSDSIIDIRIALKAADNAGLQSRLYEVSTPGS
# ASYGQYLTKDQIKSYAAPSSDSITAVTSWLLSQNISATSTGPSGEYLSFSIPVSEANNLLNAEYTNFTYSSPSSSTSQVTHTWGLYTSAYSIPSDLAE
# HITLVYPSIAFAPPVNRNGRTILYPKAAATARRTASAKFATRANTAPASCETLVPPSCLQSLYGIPSTPATQPSNVLGVASLQSNWALVNVPRRGPFT
# SIEYM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g198
###
# start gene g199
Scaffold_9	AUGUSTUS	gene	800852	801575	0.51	+	.	g199
Scaffold_9	AUGUSTUS	transcript	800852	801575	0.51	+	.	g199.t1
Scaffold_9	AUGUSTUS	start_codon	800852	800854	.	+	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_9	AUGUSTUS	CDS	800852	800892	0.51	+	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_9	AUGUSTUS	CDS	800966	801575	0.67	+	1	transcript_id "g199.t1"; gene_id "g199";
Scaffold_9	AUGUSTUS	stop_codon	801573	801575	.	+	0	transcript_id "g199.t1"; gene_id "g199";
# protein sequence = [MIYQLVNPEKESLQCDSSFPYIIWAQSIKLVENEEVIGVLIETNDRIIAALEMYDNMSSPDSKSDQSSAIVAGLAATH
# IGPESEVIKLQEKQKAAVQKAKMNGSLRSDSTGGIYADLDDLNFGTLGASSSNLPPPLRPTSMSGESTGVGADTRGSLSDFSDYESSDEETHNARVSS
# KYATDDYYTSDDDGANGSRGMKTVKTKASIDDPFADPFAD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g199
###
# start gene g200
Scaffold_9	AUGUSTUS	gene	809093	811038	0.05	+	.	g200
Scaffold_9	AUGUSTUS	transcript	809093	811038	0.05	+	.	g200.t1
Scaffold_9	AUGUSTUS	start_codon	809093	809095	.	+	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_9	AUGUSTUS	CDS	809093	809477	0.45	+	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_9	AUGUSTUS	CDS	809830	810314	0.17	+	2	transcript_id "g200.t1"; gene_id "g200";
Scaffold_9	AUGUSTUS	CDS	810370	811038	0.55	+	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_9	AUGUSTUS	stop_codon	811036	811038	.	+	0	transcript_id "g200.t1"; gene_id "g200";
# protein sequence = [MLCNVHPLRSDYRSVSISTSIPDSTSQELELQLTPALARSPVTPKTPGSLFPPTPTSFNDERPTLYLKETDDELSYRT
# EGVSGEQVLDPTTLFVGGLEMRGAGAWDEGKVYRLFKRFGGLETVKVIRPNASLGKSVTEVIETSCPQPSPLEPTSETTKNAEPNAAGSSHKSDVELP
# TPQMQEPEPYREWYDVENHLPDSVATPSVGNSFTLEGGPGMPYPFPAFYAPGPWMQQYPPHAHYPMAFYPPIYAVPPNPHPPRYSGSSGSDASGPTSC
# PPLMPQGPWSASANYGYIPYHGFPQVTDSSSPQGQDQAPVVPTGFFRDEAGTLIPVYPRAIIDQYMTNNPSQSNSPPVGVTVTVPATVPSPIPVPPSG
# PIQAWVPPGPPMFGHGPNQFPSRMGPLGQPSGWITPGQSMNSQAHHAQGFPPSFAMPMIGAPPFREGFHSGMGQGNGHKRQGRRDNFHAKRNNGTRGR
# GSGAAVTNPTHVDGRLNSNRQVSGDWTHWPEAHQGIGIIPIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g200
###
# start gene g201
Scaffold_9	AUGUSTUS	gene	814563	814943	0.4	-	.	g201
Scaffold_9	AUGUSTUS	transcript	814563	814943	0.4	-	.	g201.t1
Scaffold_9	AUGUSTUS	stop_codon	814563	814565	.	-	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_9	AUGUSTUS	CDS	814563	814943	0.4	-	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_9	AUGUSTUS	start_codon	814941	814943	.	-	0	transcript_id "g201.t1"; gene_id "g201";
# protein sequence = [MLHVQSSNSVENNVPNSSYARSSKGGSTRIPLAPKSTVRLANSNVNPIHDDDEERSPAPVPIAKHNAKPEVVFVASSK
# TNTLSKMSFAALSSKNNKKKRLIISGIASNDVRKFEGVKNWCEASQKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g201
###
# start gene g202
Scaffold_9	AUGUSTUS	gene	818635	820261	0.35	+	.	g202
Scaffold_9	AUGUSTUS	transcript	818635	820261	0.35	+	.	g202.t1
Scaffold_9	AUGUSTUS	start_codon	818635	818637	.	+	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_9	AUGUSTUS	CDS	818635	819381	0.35	+	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_9	AUGUSTUS	CDS	819449	820261	1	+	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_9	AUGUSTUS	stop_codon	820259	820261	.	+	0	transcript_id "g202.t1"; gene_id "g202";
# protein sequence = [MRALAKERDRNAEQISPSILGFSSPSATEDSEELDPCADTDTAPTPNSPVPQRPGRTDSIQENGLSPDVETTADRTRR
# RMKWVAQISEYWPLEKLAAMTEKDVKGYLEDEGAETETKAEVDPSITPMETHLSCMATTKSQSPPFSVPPPPPTSIHSIFPSPPNPIKPGQILLIGSG
# PGHPSLLTIAAHRALTELADIVLADKLVPAAVLALIPSRVEVVIAKKFPGNADRAQQEMMERALKEARKGRCVLKQGDPAIYGRFGEEVLYFRNPPPR
# SPSTTTPAVDHPPLPPTLVIPGVSSALAAPTMFDIPCTQRGASTSFLITTPVGKGGKMLDMPKYERARTVVVLMGVARLRSVVKTLIGSGKDAGDYPP
# YLPIAIIERASMPDQRVVESTLEDIEHAMESAEVGAQRPPGMMVIGWSVSALWGDGNVDVLNEGDDGEGETLGKRASESTGILREASKAIEGEFREKN
# EQEMKQSEGTKVGNSEDVRRVRNWLGDGVRWRVREGLASTWDMFNINSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g202
###
# start gene g203
Scaffold_9	AUGUSTUS	gene	823707	824843	0.07	-	.	g203
Scaffold_9	AUGUSTUS	transcript	823707	824843	0.07	-	.	g203.t1
Scaffold_9	AUGUSTUS	stop_codon	823707	823709	.	-	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_9	AUGUSTUS	CDS	823707	824104	0.42	-	2	transcript_id "g203.t1"; gene_id "g203";
Scaffold_9	AUGUSTUS	CDS	824198	824245	0.65	-	2	transcript_id "g203.t1"; gene_id "g203";
Scaffold_9	AUGUSTUS	CDS	824325	824679	0.19	-	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_9	AUGUSTUS	CDS	824733	824843	0.97	-	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_9	AUGUSTUS	start_codon	824841	824843	.	-	0	transcript_id "g203.t1"; gene_id "g203";
# protein sequence = [MYTTPATGSTQNSNDLEDYLLGKKRVDKILTADENAKLGASHKNFIAVQNANNVRDIASKIREDPLLAIKQQEQASYE
# ALMANPLRLREMQMRNGIVPKKDKKERKREKEEKRRLKEEKKQRKLQDRYSRSPSPLNDRYNSRDRHDRRDNQRRSPNARVEVLSPGKVVITTALEGE
# QYLLVVASDLEVRVLHGSLDTSHTITNGLEEVLVRVLRRVPGADDDRAARLAAMALSAEATKIERQERLTKLLEKEKADMAAEEATRSKSKGMGGFLS
# HESKKVFGGSGGLEDRIRRGRGGMVIDAE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g203
###
# start gene g204
Scaffold_9	AUGUSTUS	gene	830735	832892	0.89	+	.	g204
Scaffold_9	AUGUSTUS	transcript	830735	832892	0.89	+	.	g204.t1
Scaffold_9	AUGUSTUS	start_codon	830735	830737	.	+	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_9	AUGUSTUS	CDS	830735	831404	0.9	+	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_9	AUGUSTUS	CDS	831490	832892	0.89	+	2	transcript_id "g204.t1"; gene_id "g204";
Scaffold_9	AUGUSTUS	stop_codon	832890	832892	.	+	0	transcript_id "g204.t1"; gene_id "g204";
# protein sequence = [MSSALPSRSDSSRNWWSLSSKGSTREPSSFPQEKAGRPSSSKRNDNTKFNTLASAFGLKTKKHPSLTIEDPPATSFPS
# HHELEPLYSPELSPKYTNRPPSKSVSSTRSRVDSIEPRTPSDGQRDSASNRHSLLTLSDIDPFAARSGIAVPHSPIDPNRLSAYSGSSVVPEYITKKL
# DDVPVAASRVSYASSSSHSFSPDDMASLSPPSSLYFIAENLTRSYLQSQRTSRSKLDEFPPGMIKSNSSVTLTDKNRLSHPEIFSAPRPPMRARGMTD
# AAAIYRLPNFLQDDRSATNSATFSLSSPSSPPPVSPRVVIRQPSLQRMGLPISAPPSHRLPPPPVPVDVTDDEDVDPLRFSNSASSSTTSFKSERDAG
# MVNQHYIPRSRPRERELRPVEDTIQKSRTLKKAVSHQSLSKMASSSATSVSTPPPMPEKGPRKQRSFHHPRIPLPQMPSLKHHSSGSAVPPLDGPEPK
# RGSMNGPPTPSRKRLFSGSSTRRPSTSQETWGEDDHRSVFSLDREKSTPISPISTKPSSHSSFWDEGGADATPSSPRASTMDYTPQQIMSPAEMLKLE
# ADVRESLSLSRSRGMSIVSSSTVASESDSTSPLPSLMNSIRSHGLLNPQPHPIRSNSMGSGGMVVTPRLPRPSTGQSVSSPTLSNTISTPGLVSLPPP
# PRSRRPQPASNAPEPSLKALSPTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g204
###
# start gene g205
Scaffold_9	AUGUSTUS	gene	833417	835345	0.09	-	.	g205
Scaffold_9	AUGUSTUS	transcript	833417	835345	0.09	-	.	g205.t1
Scaffold_9	AUGUSTUS	stop_codon	833417	833419	.	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_9	AUGUSTUS	CDS	833417	834640	0.96	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_9	AUGUSTUS	CDS	834844	834957	0.32	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_9	AUGUSTUS	CDS	835052	835345	0.23	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_9	AUGUSTUS	start_codon	835343	835345	.	-	0	transcript_id "g205.t1"; gene_id "g205";
# protein sequence = [MQLKANSAQEAVDRMERMERDLKAKNLELADMLRERDRARFDVDRQKSSHKEEMDRLRRELNFANERADDASRSKNSE
# VSSVLSKYNRQISELEDSLRLDQAHDDLEHLRDEKDQEIEILNAGMDDTLKKLDEAQQACVQKVDESIYELESMTQAGNLNSTPEYTLSMIEKAMNNA
# NEFSTIYNLYLGEEEGGEHVNVIKSANEFAQSLADVLINTKGVTRLASDDDASDKLIGLAKTSGDIGLRFFLNLQSYKVNLLKPNQRKDVAMRGNGDI
# RSALVKLSENVDKLIPKGAKSDALARANGNIGDIVENEMNSAAQAIEAATQRLQELMARPRDTSRFSAVDLQVHDSILSAAMAITNAIARLIKAATES
# QQEIVAEGKGSSSMQQFYKRNNRWTEGLISAAKAVAFATNLLIESADGVLSGTHSLEQLIVASNEVAAATAQLVAASRVKANLMSKTQERLELAAKAV
# TEACRALVRQVKAVAAKQAEDNDVNYSNMAVLEFKKREMEQQVEILKLEKELGAARHRLGAMRRAGYHTDETD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g205
###
# start gene g206
Scaffold_9	AUGUSTUS	gene	835538	836110	0.38	-	.	g206
Scaffold_9	AUGUSTUS	transcript	835538	836110	0.38	-	.	g206.t1
Scaffold_9	AUGUSTUS	stop_codon	835538	835540	.	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_9	AUGUSTUS	CDS	835538	836013	0.5	-	2	transcript_id "g206.t1"; gene_id "g206";
Scaffold_9	AUGUSTUS	CDS	836056	836110	0.81	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_9	AUGUSTUS	start_codon	836108	836110	.	-	0	transcript_id "g206.t1"; gene_id "g206";
# protein sequence = [MLQPEISDRLNQCAQAGSVIQDPPNLMDTGDAPDLPARPKTVAPKSPSPPPAPSPDANAMNEQARMLREYEEHQAALL
# AAREAEERRRQELDAQQQQEFEQRQRDQAEAQRLAQEQLMLQQQQMYNNQAAQQVGELERELLAMRGQYERDQIFLEQYDRVSMFVIGRTAFVDTRQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g206
###
# start gene g207
Scaffold_9	AUGUSTUS	gene	837713	838192	0.88	+	.	g207
Scaffold_9	AUGUSTUS	transcript	837713	838192	0.88	+	.	g207.t1
Scaffold_9	AUGUSTUS	start_codon	837713	837715	.	+	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_9	AUGUSTUS	CDS	837713	838031	0.88	+	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_9	AUGUSTUS	CDS	838083	838192	0.89	+	2	transcript_id "g207.t1"; gene_id "g207";
Scaffold_9	AUGUSTUS	stop_codon	838190	838192	.	+	0	transcript_id "g207.t1"; gene_id "g207";
# protein sequence = [MLLTPRVREGVHGAHVVTPLIRENGTTILVDRGFVSNDYVDDLSFTKEEGEVEVLGMLRTAQIRNSFTPDNLPEERKW
# YWNDVDGMAAYAGGDEANVQPVFVERIFQGHAGDADYCVSRGIPVGRAAVVDMRNAHLSYVITW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g207
###
# start gene g208
Scaffold_9	AUGUSTUS	gene	842155	842757	0.9	-	.	g208
Scaffold_9	AUGUSTUS	transcript	842155	842757	0.9	-	.	g208.t1
Scaffold_9	AUGUSTUS	stop_codon	842155	842157	.	-	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_9	AUGUSTUS	CDS	842155	842757	0.9	-	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_9	AUGUSTUS	start_codon	842755	842757	.	-	0	transcript_id "g208.t1"; gene_id "g208";
# protein sequence = [MAFLCSDTGQGRVSSKAQEVLNNHVTWKASNRERRARMKIMMERKKYGQPEDEDTPPEAPTTSDLAPVVPAAESSHSR
# QPSPFLDNAASTSTPAVAANLDPDSFDYTQKLAVSRFNVQVRIGPNGETIIDEESLVVDRAGDMEDDTSGYTHVIESDRSKFTNSSTYGTKLRGTRWS
# AEETELFYEVRMIRLIRLGSQGLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g208
###
# start gene g209
Scaffold_9	AUGUSTUS	gene	843025	843691	0.29	-	.	g209
Scaffold_9	AUGUSTUS	transcript	843025	843691	0.29	-	.	g209.t1
Scaffold_9	AUGUSTUS	stop_codon	843025	843027	.	-	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_9	AUGUSTUS	CDS	843025	843591	0.81	-	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_9	AUGUSTUS	CDS	843683	843691	0.32	-	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_9	AUGUSTUS	start_codon	843689	843691	.	-	0	transcript_id "g209.t1"; gene_id "g209";
# protein sequence = [MGYGAVPRQQSVVVEQEQSSPSLHSSTAPASLPGNGIAAAVSTFSDDSQAPKAVAVPIVAPSASMPLPALNSVPSFSP
# SSSAFISQHVAPLSLPPPLAPSIQSVIPTPSQPPLRPQPTPMIPLIQSSSYFPPPSNVLHNSVTENASTLPTPRSALNVESHVKTPQWRDDNSVVENV
# GAKHRPERKWRRCFH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g209
###
# start gene g210
Scaffold_9	AUGUSTUS	gene	844318	845518	0.28	+	.	g210
Scaffold_9	AUGUSTUS	transcript	844318	845518	0.28	+	.	g210.t1
Scaffold_9	AUGUSTUS	start_codon	844318	844320	.	+	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_9	AUGUSTUS	CDS	844318	844977	0.33	+	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_9	AUGUSTUS	CDS	845030	845518	0.73	+	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_9	AUGUSTUS	stop_codon	845516	845518	.	+	0	transcript_id "g210.t1"; gene_id "g210";
# protein sequence = [MATPALIDQINAAAATNPILASLLQLANAGQATPDQLHMLSITIRSLAANPLPASQYSSLNAQNSSALSTTPESNKEF
# DLVIEFEASSNRFIFPRGTTVCERVSGSEDIVVTSYIQLQNSSSMQKITEESQGQSSSQYRMLRLSLHGASESLWDSLNRWAGGEDIMNANRKTLNQL
# VRSSSFFLISRLLILLQKGKQPRKTYLAYRLPEGLLLDHIKAVRAVSAPYPMKALKPPASLLKSRRIRKPVTKTPQELERSSLDTQTNAKPPRRKRSA
# AELNAALDLAAAITGAGSVANYSLTQSSHSSALPTPSALTAASTHAVPPPPKKRKQRTTLKSEYQSQPAATEIKCRSCQATDVPLMLGGRGCLFRTRL
# VWFTYLISPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g210
###
# start gene g211
Scaffold_9	AUGUSTUS	gene	859835	861296	0.2	+	.	g211
Scaffold_9	AUGUSTUS	transcript	859835	861296	0.2	+	.	g211.t1
Scaffold_9	AUGUSTUS	start_codon	859835	859837	.	+	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_9	AUGUSTUS	CDS	859835	860307	0.83	+	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_9	AUGUSTUS	CDS	860432	861296	0.21	+	1	transcript_id "g211.t1"; gene_id "g211";
Scaffold_9	AUGUSTUS	stop_codon	861294	861296	.	+	0	transcript_id "g211.t1"; gene_id "g211";
# protein sequence = [MNRPSSPLRSSVFPMSTSPTPVPTTTTDATQPSSAPLAPSSTTTPSATTASAISTLTAPSTTDIDFSPSTGPSVVRVR
# VDPHRRLHPIPLSNDGGETLDWSGSGSVNGYGSEDEKSEKAEKSEKRWSLSVSRRGKEKEKEKERELLPSAEDLKRLEGFKKVAITADQIGRRYNLIY
# TSLLTPGSTLLPNHQSDITTTSASASSASETDIKEFNLLKVSKWYSAQDPLVRSSLEKAEPFIWLKHLEKKRNLKQPKGEEGQKDKAGGEEDNVKEDP
# TAATTTRLPWHLSALIMEEYILAQSAKNYSHFPAFPVQNIPHLQPPPKPINPTPYAARSMRSIPEHPSSPDSATHTHDFGKDYVPGTNMPSPPDDGGG
# GGTGSLNDLLPPFIPSGYSTPSAYSAYSPLPYIRIIPLLQLIPHILLLLNLNNPVLPLTHLAHLTLPIALTHF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g211
###
# start gene g212
Scaffold_9	AUGUSTUS	gene	862487	862852	0.64	+	.	g212
Scaffold_9	AUGUSTUS	transcript	862487	862852	0.64	+	.	g212.t1
Scaffold_9	AUGUSTUS	start_codon	862487	862489	.	+	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_9	AUGUSTUS	CDS	862487	862852	0.64	+	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_9	AUGUSTUS	stop_codon	862850	862852	.	+	0	transcript_id "g212.t1"; gene_id "g212";
# protein sequence = [MPTSGLCSTTLRNTCVNTRCVRLVSSQEKVRKAPEAVVMVVTVVTVPEQEQEEEEEEEEEEEEEGEGLDTRLSRRNFS
# KHSAMTSERDELDEETQDLSRGRRYPSSADQAEGGVCRVFSAK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g212
###
# start gene g213
Scaffold_9	AUGUSTUS	gene	867869	869029	0.71	+	.	g213
Scaffold_9	AUGUSTUS	transcript	867869	869029	0.71	+	.	g213.t1
Scaffold_9	AUGUSTUS	start_codon	867869	867871	.	+	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_9	AUGUSTUS	CDS	867869	869029	0.71	+	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_9	AUGUSTUS	stop_codon	869027	869029	.	+	0	transcript_id "g213.t1"; gene_id "g213";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD
# LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRME
# LSGHVSCASRQIIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g213
###
# start gene g214
Scaffold_9	AUGUSTUS	gene	869124	869393	0.51	+	.	g214
Scaffold_9	AUGUSTUS	transcript	869124	869393	0.51	+	.	g214.t1
Scaffold_9	AUGUSTUS	start_codon	869124	869126	.	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_9	AUGUSTUS	CDS	869124	869393	0.51	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_9	AUGUSTUS	stop_codon	869391	869393	.	+	0	transcript_id "g214.t1"; gene_id "g214";
# protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR
# VFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g214
###
# start gene g215
Scaffold_9	AUGUSTUS	gene	869423	869827	0.52	+	.	g215
Scaffold_9	AUGUSTUS	transcript	869423	869827	0.52	+	.	g215.t1
Scaffold_9	AUGUSTUS	start_codon	869423	869425	.	+	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_9	AUGUSTUS	CDS	869423	869827	0.52	+	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_9	AUGUSTUS	stop_codon	869825	869827	.	+	0	transcript_id "g215.t1"; gene_id "g215";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTYEGTKRPDESN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g215
###
# start gene g216
Scaffold_9	AUGUSTUS	gene	869978	871739	0.36	+	.	g216
Scaffold_9	AUGUSTUS	transcript	869978	871739	0.36	+	.	g216.t1
Scaffold_9	AUGUSTUS	start_codon	869978	869980	.	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_9	AUGUSTUS	CDS	869978	870412	0.4	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_9	AUGUSTUS	CDS	870912	871739	0.75	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_9	AUGUSTUS	stop_codon	871737	871739	.	+	0	transcript_id "g216.t1"; gene_id "g216";
# protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIV
# ESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIQNIVLDGYKRCEQETFSKKELSEAYVLASRE
# HLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTE
# TTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLN
# QQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g216
###
# start gene g217
Scaffold_9	AUGUSTUS	gene	872731	873840	0.76	+	.	g217
Scaffold_9	AUGUSTUS	transcript	872731	873840	0.76	+	.	g217.t1
Scaffold_9	AUGUSTUS	start_codon	872731	872733	.	+	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_9	AUGUSTUS	CDS	872731	873840	0.76	+	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_9	AUGUSTUS	stop_codon	873838	873840	.	+	0	transcript_id "g217.t1"; gene_id "g217";
# protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLVKCQKMNGLNLLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g217
###
# start gene g218
Scaffold_9	AUGUSTUS	gene	874352	875194	0.75	+	.	g218
Scaffold_9	AUGUSTUS	transcript	874352	875194	0.75	+	.	g218.t1
Scaffold_9	AUGUSTUS	start_codon	874352	874354	.	+	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_9	AUGUSTUS	CDS	874352	875194	0.75	+	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_9	AUGUSTUS	stop_codon	875192	875194	.	+	0	transcript_id "g218.t1"; gene_id "g218";
# protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG
# AEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPR
# YRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWTPENDYIFDAIPHLRLSDTDSDEEL
# SEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g218
###
# start gene g219
Scaffold_9	AUGUSTUS	gene	875482	875974	0.16	-	.	g219
Scaffold_9	AUGUSTUS	transcript	875482	875974	0.16	-	.	g219.t1
Scaffold_9	AUGUSTUS	stop_codon	875482	875484	.	-	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_9	AUGUSTUS	CDS	875482	875879	0.94	-	2	transcript_id "g219.t1"; gene_id "g219";
Scaffold_9	AUGUSTUS	CDS	875956	875974	0.16	-	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_9	AUGUSTUS	start_codon	875972	875974	.	-	0	transcript_id "g219.t1"; gene_id "g219";
# protein sequence = [MFLLTVLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSI
# LKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEMLFQSLRPSNEPLLHSLVVLLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g219
###
# start gene g220
Scaffold_9	AUGUSTUS	gene	879228	879930	0.55	-	.	g220
Scaffold_9	AUGUSTUS	transcript	879228	879930	0.55	-	.	g220.t1
Scaffold_9	AUGUSTUS	stop_codon	879228	879230	.	-	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_9	AUGUSTUS	CDS	879228	879664	0.95	-	2	transcript_id "g220.t1"; gene_id "g220";
Scaffold_9	AUGUSTUS	CDS	879723	879930	0.6	-	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_9	AUGUSTUS	start_codon	879928	879930	.	-	0	transcript_id "g220.t1"; gene_id "g220";
# protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS
# KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE
# DEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g220
###
# start gene g221
Scaffold_9	AUGUSTUS	gene	895320	896099	0.86	-	.	g221
Scaffold_9	AUGUSTUS	transcript	895320	896099	0.86	-	.	g221.t1
Scaffold_9	AUGUSTUS	stop_codon	895320	895322	.	-	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_9	AUGUSTUS	CDS	895320	896099	0.86	-	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_9	AUGUSTUS	start_codon	896097	896099	.	-	0	transcript_id "g221.t1"; gene_id "g221";
# protein sequence = [MGYGDLTQINIPSGDWGGELDPHGAYGSGNPIGGNVTTNMTIDGETINVAEWMLYVSYEQFCFRACTWANSTYSAAAM
# CWHELDEMGCEFVMPGNYDFNGTFETCEADVAYPPGWYVEGSSDGTTSFSSFAQYWTGVVDGVTYTQGDLVTPSTVQSTPSSSNCQTVATISNGIDLA
# SLGVTGAATATGSGATATATGSAATATGTAGAASGSSSGSTTAAASSSSNAATSGARVFQAGMSEGLTVLSMISAIAAIAVFH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g221
###
# start gene g222
Scaffold_9	AUGUSTUS	gene	896139	896507	0.86	-	.	g222
Scaffold_9	AUGUSTUS	transcript	896139	896507	0.86	-	.	g222.t1
Scaffold_9	AUGUSTUS	stop_codon	896139	896141	.	-	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_9	AUGUSTUS	CDS	896139	896507	0.86	-	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_9	AUGUSTUS	start_codon	896505	896507	.	-	0	transcript_id "g222.t1"; gene_id "g222";
# protein sequence = [MLAIATASLLLASTAFAQSTTTFPDGVVATGTMGVTNPPEPTTGTAINQTSFSRLLSINSVDDWCIFAPPESQDIADS
# ETIEVAWCTQQRNDARVIPDGTISGVSLLKTGSFFVSVLFHREN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g222
###
# start gene g223
Scaffold_9	AUGUSTUS	gene	898712	899914	0.45	+	.	g223
Scaffold_9	AUGUSTUS	transcript	898712	899914	0.45	+	.	g223.t1
Scaffold_9	AUGUSTUS	start_codon	898712	898714	.	+	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_9	AUGUSTUS	CDS	898712	898788	0.45	+	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_9	AUGUSTUS	CDS	899136	899249	0.9	+	1	transcript_id "g223.t1"; gene_id "g223";
Scaffold_9	AUGUSTUS	CDS	899368	899914	1	+	1	transcript_id "g223.t1"; gene_id "g223";
Scaffold_9	AUGUSTUS	stop_codon	899912	899914	.	+	0	transcript_id "g223.t1"; gene_id "g223";
# protein sequence = [MTTSSSISLNLKVYFPIIVSNDTRFVLEAMLSGAGVEEGGLSAFDGLNDPLEINEDIIGSNSDGDDHHSFDAHQDREA
# FLAITRDANAEVVVEGEDSIWRDLEHFAATGEFPQHLIQEGSNDQQSVRTGTSAPAHVVDDHDASRSQSQSGIPNQIEVSDDSTDSLFGDSPVAVSPE
# LEADAPLGEYPASAEPNSNDLNVNIDAFLTMMQSHQMSNGPSLNMEEEHRPNGSVHMGSAGYERASDYP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g223
###
# start gene g224
Scaffold_9	AUGUSTUS	gene	900881	901310	0.41	+	.	g224
Scaffold_9	AUGUSTUS	transcript	900881	901310	0.41	+	.	g224.t1
Scaffold_9	AUGUSTUS	start_codon	900881	900883	.	+	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_9	AUGUSTUS	CDS	900881	900903	0.51	+	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_9	AUGUSTUS	CDS	900956	901310	0.41	+	1	transcript_id "g224.t1"; gene_id "g224";
Scaffold_9	AUGUSTUS	stop_codon	901308	901310	.	+	0	transcript_id "g224.t1"; gene_id "g224";
# protein sequence = [MKKSEIPPTSRSKIEPAISTTSTKYLPRSANGSDAKNLLEGLVWQNTLTRNTTPIADTTVIPVIWASKRKKDVKIIGH
# DVAQSFRLKRVRVSQSWNLPNKPATMKRNLFRIKDVASKQIRRQCVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g224
###
# start gene g225
Scaffold_9	AUGUSTUS	gene	903169	903531	0.47	+	.	g225
Scaffold_9	AUGUSTUS	transcript	903169	903531	0.47	+	.	g225.t1
Scaffold_9	AUGUSTUS	start_codon	903169	903171	.	+	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_9	AUGUSTUS	CDS	903169	903531	0.47	+	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_9	AUGUSTUS	stop_codon	903529	903531	.	+	0	transcript_id "g225.t1"; gene_id "g225";
# protein sequence = [MFASSWNSLCSDAELMRSVWDRYDAQEHGSNALSTLITALKRLVTEKPALLGVGSQMFGVGVSSNNDSHYALSPSGSA
# YSLDGVAGMVATAASATVSNVVGMMGSNAGLSLQGSTMKLQW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g225
###
# start gene g226
Scaffold_9	AUGUSTUS	gene	903932	906316	0.49	+	.	g226
Scaffold_9	AUGUSTUS	transcript	903932	906316	0.49	+	.	g226.t1
Scaffold_9	AUGUSTUS	start_codon	903932	903934	.	+	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_9	AUGUSTUS	CDS	903932	906316	0.49	+	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_9	AUGUSTUS	stop_codon	906314	906316	.	+	0	transcript_id "g226.t1"; gene_id "g226";
# protein sequence = [MTNVAGMLGLTTPRDAFFTSLAKFSVPTRVVSSLDSYTDPQTPRSATTSFSENLGLSLSGSTGSTSPGLSERNLACLK
# VLISSSMFLAGSLGESWFGILEVLQNADYVLTSKGIAYGAQTPGSKGGAFSPGRGGHTTPSRSVSMALSSSGSGLGLSSAAVSSSQQPSPRHPLLSDL
# DPEMMLTAIQRLFDASKNLEDGAFNFFTDALCKLSAEMIGMQTGTADGLGLEVIAETGSVEELSSLDGVVLSPPAPSIADTPHRRRVSGIHLPRTLVR
# CSLFRFLSYINIVVYSQRSGDFGINKLGGVISQNIHRLVYRPPEVAWTTITTHLLSVIRLPTAPPPIRIQAARVLDDILITVPRNLGTAGELQAQVQQ
# RVLEVLSYQVIPDYTSLPGAATANVGTTVELRRMGLETLHEILQVSGHTLIVGWETIFSMLESVCRPPPPTKSGSVDSTIAIPTASPPRAKPILLGLG
# VPSEKNYTTLIKIAFQSLNLVCDSVSELSPEHLRLCISTLGQFGRQANTNIALTAAASLLWSVSDAIQAKRKDAEKEPEYSALWMFLLLEVLGLCSDD
# RPEVRDGAIQTLFRTMQLYGASLSLQTWDECIWKVTFPLVESLSTEIHRRSALVEPFDGAGAGEQAWDESKILAFNSIGSIFHDFLSSKLVHLESFHS
# AWDTFVTRIQESVLLDNRSISTPALRCLEKAVKASSASIFDVRQKVVEMKERIWIAIDAVGSAILRRRNGAQSPSLDSAILPNPFTQECLVAFVDVIQ
# STRDLSRALEGADWPLERITRLMVILKGAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g226
###
# start gene g227
Scaffold_9	AUGUSTUS	gene	906483	907021	0.49	+	.	g227
Scaffold_9	AUGUSTUS	transcript	906483	907021	0.49	+	.	g227.t1
Scaffold_9	AUGUSTUS	start_codon	906483	906485	.	+	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_9	AUGUSTUS	CDS	906483	906740	0.84	+	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_9	AUGUSTUS	CDS	906797	907021	0.49	+	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_9	AUGUSTUS	stop_codon	907019	907021	.	+	0	transcript_id "g227.t1"; gene_id "g227";
# protein sequence = [MTTIGGIDLSGSGIPSLVLRDLSEFATLPFLAAFDIPPDPKSSTPSKRITYIALAKKTMPKLVELCLQFKDRLELYSE
# GTIEAVLSAYSIPVKLKYDCPSPSKHGKDPPLWKTATTCFLRIVKECAPQVIAFDEGRLPDLQYISFAERSTYTFRDIRRAT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g227
###
# start gene g228
Scaffold_9	AUGUSTUS	gene	914928	916094	0.86	+	.	g228
Scaffold_9	AUGUSTUS	transcript	914928	916094	0.86	+	.	g228.t1
Scaffold_9	AUGUSTUS	start_codon	914928	914930	.	+	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_9	AUGUSTUS	CDS	914928	916094	0.86	+	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_9	AUGUSTUS	stop_codon	916092	916094	.	+	0	transcript_id "g228.t1"; gene_id "g228";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g228
###
# start gene g229
Scaffold_9	AUGUSTUS	gene	916145	918757	0.91	+	.	g229
Scaffold_9	AUGUSTUS	transcript	916145	918757	0.91	+	.	g229.t1
Scaffold_9	AUGUSTUS	start_codon	916145	916147	.	+	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_9	AUGUSTUS	CDS	916145	918757	0.91	+	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_9	AUGUSTUS	stop_codon	918755	918757	.	+	0	transcript_id "g229.t1"; gene_id "g229";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM
# VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT
# DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF
# DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE
# AQVLEGLKTVKEHGLQRLANGIAEWEETMGWSTTEVEYTYQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVR
# RSSDTHGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g229
###
# start gene g230
Scaffold_9	AUGUSTUS	gene	919219	919833	0.67	+	.	g230
Scaffold_9	AUGUSTUS	transcript	919219	919833	0.67	+	.	g230.t1
Scaffold_9	AUGUSTUS	start_codon	919219	919221	.	+	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_9	AUGUSTUS	CDS	919219	919833	0.67	+	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_9	AUGUSTUS	stop_codon	919831	919833	.	+	0	transcript_id "g230.t1"; gene_id "g230";
# protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED
# INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK
# WKGYDARAQLLGTRSQPQSSTKNCSGLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g230
###
# start gene g231
Scaffold_9	AUGUSTUS	gene	922780	923247	0.78	-	.	g231
Scaffold_9	AUGUSTUS	transcript	922780	923247	0.78	-	.	g231.t1
Scaffold_9	AUGUSTUS	stop_codon	922780	922782	.	-	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_9	AUGUSTUS	CDS	922780	923247	0.78	-	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_9	AUGUSTUS	start_codon	923245	923247	.	-	0	transcript_id "g231.t1"; gene_id "g231";
# protein sequence = [MAAEDAGEFLDDGEIEFEDEDEGVNEEVKQEACAESVFAIDPFNNSPSMSRNNKKYAKLTKRSRKKRAAEAVKRIASR
# GIKPFVVELAKGALPLELEDFDASTLPVSSSGWNANPRKKLSPGLQRVWKDLEVLSSLNGLKLLRWDGQCMYHFLQL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g231
###
# start gene g232
Scaffold_9	AUGUSTUS	gene	938405	939052	1	+	.	g232
Scaffold_9	AUGUSTUS	transcript	938405	939052	1	+	.	g232.t1
Scaffold_9	AUGUSTUS	start_codon	938405	938407	.	+	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_9	AUGUSTUS	CDS	938405	939052	1	+	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_9	AUGUSTUS	stop_codon	939050	939052	.	+	0	transcript_id "g232.t1"; gene_id "g232";
# protein sequence = [MSTPVPPTTPAPPTSAEDLMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKS
# QAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGDWEEFLKEFVQRFESVDPGMEARSEIKNLKQVKGQTVAEFAQKFKDIGDRTGMSDIDYGTLL
# HCPTSGDPTKSHHCKHRPRTCSDSEGGNQTSHISRRLHA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g232
###
# start gene g233
Scaffold_9	AUGUSTUS	gene	945553	946245	0.53	-	.	g233
Scaffold_9	AUGUSTUS	transcript	945553	946245	0.53	-	.	g233.t1
Scaffold_9	AUGUSTUS	stop_codon	945553	945555	.	-	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_9	AUGUSTUS	CDS	945553	946245	0.53	-	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_9	AUGUSTUS	start_codon	946243	946245	.	-	0	transcript_id "g233.t1"; gene_id "g233";
# protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN
# TPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW
# TGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPQSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g233
###
# start gene g234
Scaffold_9	AUGUSTUS	gene	953237	954013	0.58	-	.	g234
Scaffold_9	AUGUSTUS	transcript	953237	954013	0.58	-	.	g234.t1
Scaffold_9	AUGUSTUS	stop_codon	953237	953239	.	-	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_9	AUGUSTUS	CDS	953237	954013	0.58	-	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_9	AUGUSTUS	start_codon	954011	954013	.	-	0	transcript_id "g234.t1"; gene_id "g234";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV
# SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLKTSFEFRSVSRRM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g234
###
# start gene g235
Scaffold_9	AUGUSTUS	gene	968857	969430	0.72	+	.	g235
Scaffold_9	AUGUSTUS	transcript	968857	969430	0.72	+	.	g235.t1
Scaffold_9	AUGUSTUS	start_codon	968857	968859	.	+	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_9	AUGUSTUS	CDS	968857	969134	0.75	+	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_9	AUGUSTUS	CDS	969184	969430	0.97	+	1	transcript_id "g235.t1"; gene_id "g235";
Scaffold_9	AUGUSTUS	stop_codon	969428	969430	.	+	0	transcript_id "g235.t1"; gene_id "g235";
# protein sequence = [MLQAATIQDGGDDDDETSLYTRMVAYDIANATVTPPTMVGEWVVPLPVSTSKSKTRKCSEIHFVSENVFFALSRDGNG
# NGAGTSSSDTTSKYKQADLFSIANATNIAGSKFDDPSNPVAPGGVLDDSVTPATYVSFVNYIDDDQLARFGLHNGTLNAAYSVYDLDPFGLNFRRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g235
###
# start gene g236
Scaffold_9	AUGUSTUS	gene	971415	971732	0.55	-	.	g236
Scaffold_9	AUGUSTUS	transcript	971415	971732	0.55	-	.	g236.t1
Scaffold_9	AUGUSTUS	stop_codon	971415	971417	.	-	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_9	AUGUSTUS	CDS	971415	971732	0.55	-	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_9	AUGUSTUS	start_codon	971730	971732	.	-	0	transcript_id "g236.t1"; gene_id "g236";
# protein sequence = [MGRKCVQTVLDMIVNGHFDHQNSITYANAQNVALKSISPSGTFKRKLVNSAASKIYHTLSQHPHSAEDDPIVLQEKDY
# TQAEAIAIFSFVHFARTLQYPHAISQQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g236
###
# start gene g237
Scaffold_9	AUGUSTUS	gene	973606	974052	0.54	-	.	g237
Scaffold_9	AUGUSTUS	transcript	973606	974052	0.54	-	.	g237.t1
Scaffold_9	AUGUSTUS	stop_codon	973606	973608	.	-	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_9	AUGUSTUS	CDS	973606	974052	0.54	-	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_9	AUGUSTUS	start_codon	974050	974052	.	-	0	transcript_id "g237.t1"; gene_id "g237";
# protein sequence = [MPTISKNKNASPPTTARLITGDRIIAYDVYLKDGKYTVDCDVCNQSIVVGKGAYARHGADRQNGNMATKAVAKQPPTG
# IAISALLSCGAPAQNQCQLTVDDILAHAVFDTSSNSSTCGGAKLNNNNHLLTESTASSTLESTWRIWRNI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g237
###
# start gene g238
Scaffold_9	AUGUSTUS	gene	977063	979999	0.76	-	.	g238
Scaffold_9	AUGUSTUS	transcript	977063	979999	0.76	-	.	g238.t1
Scaffold_9	AUGUSTUS	stop_codon	977063	977065	.	-	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_9	AUGUSTUS	CDS	977063	979999	0.76	-	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_9	AUGUSTUS	start_codon	979997	979999	.	-	0	transcript_id "g238.t1"; gene_id "g238";
# protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS
# PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL
# MNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF
# LGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ
# PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN
# QQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQVLEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPG
# LHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEG
# VADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL
# GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYR
# ILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSR
# APKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g238
###
# start gene g239
Scaffold_9	AUGUSTUS	gene	981336	981977	0.96	-	.	g239
Scaffold_9	AUGUSTUS	transcript	981336	981977	0.96	-	.	g239.t1
Scaffold_9	AUGUSTUS	stop_codon	981336	981338	.	-	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_9	AUGUSTUS	CDS	981336	981977	0.96	-	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_9	AUGUSTUS	start_codon	981975	981977	.	-	0	transcript_id "g239.t1"; gene_id "g239";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPENPTTPYHRKHRPRNRSDFERGNQTSHIGGCLPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g239
###
# start gene g240
Scaffold_9	AUGUSTUS	gene	990601	991705	0.24	-	.	g240
Scaffold_9	AUGUSTUS	transcript	990601	991705	0.24	-	.	g240.t1
Scaffold_9	AUGUSTUS	stop_codon	990601	990603	.	-	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_9	AUGUSTUS	CDS	990601	991122	0.28	-	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_9	AUGUSTUS	CDS	991211	991705	0.71	-	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_9	AUGUSTUS	start_codon	991703	991705	.	-	0	transcript_id "g240.t1"; gene_id "g240";
# protein sequence = [MGGGDGEGGGRGKGEGEIDDEVGVAVVFDDEDEESEDDGEGFEVRDDDDDDDDDESSSEPEVDGPRVAIEGDDDEEIV
# IGDKPSSSKKQTSKSKNSSSKDDDLVSPHSIDAFWVQRQISQVYPDPHILHQSLRGALDPFFHNNTSGGDSTHEPPRCGEPADGGVRERADVQVAMRE
# RGVGWILRELDGERRPNTTSNDDDDEQMDVDDPKPPMTTTPPNPTLRLPKTIDLTAMAFSQGSHLMSNKKCVLPEGSFKRARKGWEEIHVPAVKSRYS
# TTVGGSDELVPITALPFWARAAFTVPNLNRVQSKLFPVAFGTDEPILLCAPTGAGKVFVSCSYN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g240
###
# start gene g241
Scaffold_9	AUGUSTUS	gene	996087	998687	0.36	+	.	g241
Scaffold_9	AUGUSTUS	transcript	996087	998687	0.36	+	.	g241.t1
Scaffold_9	AUGUSTUS	start_codon	996087	996089	.	+	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_9	AUGUSTUS	CDS	996087	997383	0.65	+	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_9	AUGUSTUS	CDS	997472	997502	0.72	+	2	transcript_id "g241.t1"; gene_id "g241";
Scaffold_9	AUGUSTUS	CDS	998007	998464	0.6	+	1	transcript_id "g241.t1"; gene_id "g241";
Scaffold_9	AUGUSTUS	CDS	998557	998687	1	+	2	transcript_id "g241.t1"; gene_id "g241";
Scaffold_9	AUGUSTUS	stop_codon	998685	998687	.	+	0	transcript_id "g241.t1"; gene_id "g241";
# protein sequence = [MSPTPTRPLSRTSSPLLPPLTALGEVPSPAPESDGEVEADQLAFTIESPSRPQLQLFKTVFNTGKSLSAYCQDDLLWP
# ILAEVASPCTNCLKTPGKCKVLPSSPQCMNCSSKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHKSTWGIPLTAWREYDSALHARTSSTSI
# FLELNMLDEQDAVDADQQELQQFLTLQQNEAAVAAKRKRNRSPMPVAGPSSKKIRSDAPKKCSRRKSPAVEVNVEPFRRVRLVVPPVRSVAPTSPPVP
# PPASPSLMGVLNRDLPTQGPSDLVWLATVAELHSGLVQQSVSSPSARTPIKGARQDLLSSPMPPTPCPALVPRTFTAHPYRAENQRLAARVRELESQL
# ADSQWENSSLTSALRDTSHALESRQWEVEQLRSSNREQEVEYRGVLDQFRALDEALPGTPGDLQDATRSGSIQWFFNNTVDEDEGFYRMVLEHSRFDN
# DGPFLTAAQHAGFAPPPSDSLEPPLHRRMLALSTPLPHSDGAGRWDDIVPALPSIDQLTADWEQLMLDYIHHITDTPLPGPNPPAPVSAVDPVTEPSQ
# EVVVEQSPEVPVAPVSSSSIGSHPRSLSIDLTGDDDELYETEESRVARVSMTGEVVDLAPGQGIVKEESL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g241
###
# start gene g242
Scaffold_9	AUGUSTUS	gene	1026878	1027282	0.96	+	.	g242
Scaffold_9	AUGUSTUS	transcript	1026878	1027282	0.96	+	.	g242.t1
Scaffold_9	AUGUSTUS	start_codon	1026878	1026880	.	+	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_9	AUGUSTUS	CDS	1026878	1027282	0.96	+	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_9	AUGUSTUS	stop_codon	1027280	1027282	.	+	0	transcript_id "g242.t1"; gene_id "g242";
# protein sequence = [MTTSRTTTTTIGNPTASTSSRPANPPSPSASIDDEEDVIMREALTRVERVRARKAEEAAKKKAAEEAATRKAVEEAEK
# KKQAAVARHQAAQDARNWAIWVREQEDEVVEQRRRLAEAVTARSQRGPPLVGLLLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g242
###
# start gene g243
Scaffold_9	AUGUSTUS	gene	1051914	1052324	0.78	-	.	g243
Scaffold_9	AUGUSTUS	transcript	1051914	1052324	0.78	-	.	g243.t1
Scaffold_9	AUGUSTUS	stop_codon	1051914	1051916	.	-	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_9	AUGUSTUS	CDS	1051914	1052324	0.78	-	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_9	AUGUSTUS	start_codon	1052322	1052324	.	-	0	transcript_id "g243.t1"; gene_id "g243";
# protein sequence = [MALEADVATSAQALTLMREVCFGAPGVPALSFYEDCFMAGIQVMQPYNARRVAMRRNKDPTLYLTALREGKIRVFVCY
# GAADRMLDGTILSKEMQETAKYVEIKAIDGGSHVVFMQYPEVVAKDLIVFVDSFTHNC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g243
###
# start gene g244
Scaffold_9	AUGUSTUS	gene	1054312	1054863	0.88	-	.	g244
Scaffold_9	AUGUSTUS	transcript	1054312	1054863	0.88	-	.	g244.t1
Scaffold_9	AUGUSTUS	stop_codon	1054312	1054314	.	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_9	AUGUSTUS	CDS	1054312	1054863	0.88	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_9	AUGUSTUS	start_codon	1054861	1054863	.	-	0	transcript_id "g244.t1"; gene_id "g244";
# protein sequence = [MNSTASSNDSVAVNPANSTRAGSPSPSSVSTPRSQNTTPGPEGGESLTVDKLDKLNAITSAGSGAGTASTLTSADLTS
# APAYSVMSSAAFTSASTEGSVLASSDPDGSAPPLGHRDSKRDKGKPPVKGYKNIPSLDAITARLAKTRALSIDGTPKPPEPEMIEDPKTPGVHVMKEE
# HPLQYSW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g244
###
# start gene g245
Scaffold_9	AUGUSTUS	gene	1062093	1062662	0.99	-	.	g245
Scaffold_9	AUGUSTUS	transcript	1062093	1062662	0.99	-	.	g245.t1
Scaffold_9	AUGUSTUS	stop_codon	1062093	1062095	.	-	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_9	AUGUSTUS	CDS	1062093	1062662	0.99	-	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_9	AUGUSTUS	start_codon	1062660	1062662	.	-	0	transcript_id "g245.t1"; gene_id "g245";
# protein sequence = [MGIPFPPGIYHPFVDESTPIENRGAVFAKWLTSYFPHGDLSKHDFSSLNQCDHDDTRKHTFEGLHEDDLVKIIDLSPG
# ARCDTHLCQTPYLAVEKEVANKALYDPDIRAAWKTMKIWAMFGDKNPWNIIYCWWTWEAESKAADRKDPAIHFTVNEGANHFVSFIDCCMHDPYYHLL
# VHVGQSQWMHGQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g245
###
# start gene g246
Scaffold_9	AUGUSTUS	gene	1070276	1072729	0.61	-	.	g246
Scaffold_9	AUGUSTUS	transcript	1070276	1072729	0.61	-	.	g246.t1
Scaffold_9	AUGUSTUS	stop_codon	1070276	1070278	.	-	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_9	AUGUSTUS	CDS	1070276	1072729	0.61	-	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_9	AUGUSTUS	start_codon	1072727	1072729	.	-	0	transcript_id "g246.t1"; gene_id "g246";
# protein sequence = [MFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEY
# LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPT
# RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYL
# SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDN
# GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLIT
# QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQE
# VEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRK
# AHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEE
# ILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g246
###
# start gene g247
Scaffold_9	AUGUSTUS	gene	1072876	1073991	0.85	-	.	g247
Scaffold_9	AUGUSTUS	transcript	1072876	1073991	0.85	-	.	g247.t1
Scaffold_9	AUGUSTUS	stop_codon	1072876	1072878	.	-	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_9	AUGUSTUS	CDS	1072876	1073991	0.85	-	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_9	AUGUSTUS	start_codon	1073989	1073991	.	-	0	transcript_id "g247.t1"; gene_id "g247";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYLSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g247
###
# start gene g248
Scaffold_9	AUGUSTUS	gene	1074042	1075205	0.88	-	.	g248
Scaffold_9	AUGUSTUS	transcript	1074042	1075205	0.88	-	.	g248.t1
Scaffold_9	AUGUSTUS	stop_codon	1074042	1074044	.	-	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_9	AUGUSTUS	CDS	1074042	1075205	0.88	-	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_9	AUGUSTUS	start_codon	1075203	1075205	.	-	0	transcript_id "g248.t1"; gene_id "g248";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPQDFSNQIGQIRELLDR
# ANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g248
###
# start gene g249
Scaffold_9	AUGUSTUS	gene	1080741	1082286	0.33	-	.	g249
Scaffold_9	AUGUSTUS	transcript	1080741	1082286	0.33	-	.	g249.t1
Scaffold_9	AUGUSTUS	stop_codon	1080741	1080743	.	-	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_9	AUGUSTUS	CDS	1080741	1081658	0.59	-	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_9	AUGUSTUS	CDS	1081822	1082286	0.33	-	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_9	AUGUSTUS	start_codon	1082284	1082286	.	-	0	transcript_id "g249.t1"; gene_id "g249";
# protein sequence = [MNGLTRTLLAYLRLSVRNGLRPAKKSLKRSNGVVLLNSWIVQQTERSLRTAGSSTSNLMVVRRHALLSKGSHKLKVLI
# MTKSSLCSTVWTVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLIPLKGDSCHTGNAEILVKPKN
# SFACGLIVMAKRSILINAPTLTKSLSVCGMENAKMADTPLPAGFQPEPTIGQSNSALRSKFQMVIGSLLYLMLGTRPDISFAVTKLAQHAANPSQEHL
# NKALYICRYLLGTRSYALCYDGESGIGLSVGLIRIGLPIPIHAGHRLDFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNLLEELG
# YKLDAIPIAGDNQGSIFMHQILSLASTRKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFRSMLGLEFYSSTNP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g249
###
# start gene g250
Scaffold_9	AUGUSTUS	gene	1083481	1084686	0.9	-	.	g250
Scaffold_9	AUGUSTUS	transcript	1083481	1084686	0.9	-	.	g250.t1
Scaffold_9	AUGUSTUS	stop_codon	1083481	1083483	.	-	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_9	AUGUSTUS	CDS	1083481	1084686	0.9	-	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_9	AUGUSTUS	start_codon	1084684	1084686	.	-	0	transcript_id "g250.t1"; gene_id "g250";
# protein sequence = [MAIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPPTKRTRAMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASF
# DPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQP
# KWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDF
# WDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRA
# SRPSRLFTQTSKNGLPFRTTSTSIDLLHR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g250
###
# start gene g251
Scaffold_9	AUGUSTUS	gene	1085749	1088737	0.33	+	.	g251
Scaffold_9	AUGUSTUS	transcript	1085749	1088737	0.33	+	.	g251.t1
Scaffold_9	AUGUSTUS	start_codon	1085749	1085751	.	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_9	AUGUSTUS	CDS	1085749	1085764	0.4	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_9	AUGUSTUS	CDS	1086768	1088737	0.53	+	2	transcript_id "g251.t1"; gene_id "g251";
Scaffold_9	AUGUSTUS	stop_codon	1088735	1088737	.	+	0	transcript_id "g251.t1"; gene_id "g251";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ
# SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR
# DNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g251
###
# start gene g252
Scaffold_9	AUGUSTUS	gene	1088767	1090196	0.4	+	.	g252
Scaffold_9	AUGUSTUS	transcript	1088767	1090196	0.4	+	.	g252.t1
Scaffold_9	AUGUSTUS	start_codon	1088767	1088769	.	+	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_9	AUGUSTUS	CDS	1088767	1089490	0.4	+	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_9	AUGUSTUS	CDS	1089541	1090196	0.4	+	2	transcript_id "g252.t1"; gene_id "g252";
Scaffold_9	AUGUSTUS	stop_codon	1090194	1090196	.	+	0	transcript_id "g252.t1"; gene_id "g252";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYE
# DHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNK
# APFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEMIQREIFIPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g252
###
# start gene g253
Scaffold_9	AUGUSTUS	gene	1090738	1091545	0.2	+	.	g253
Scaffold_9	AUGUSTUS	transcript	1090738	1091545	0.2	+	.	g253.t1
Scaffold_9	AUGUSTUS	start_codon	1090738	1090740	.	+	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_9	AUGUSTUS	CDS	1090738	1091388	0.2	+	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_9	AUGUSTUS	CDS	1091465	1091545	0.48	+	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_9	AUGUSTUS	stop_codon	1091543	1091545	.	+	0	transcript_id "g253.t1"; gene_id "g253";
# protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE
# TNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERD
# LMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWEYTNHRMLVIVRNGSVSLRKMARVYD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g253
###
# start gene g254
Scaffold_9	AUGUSTUS	gene	1093034	1093333	0.62	+	.	g254
Scaffold_9	AUGUSTUS	transcript	1093034	1093333	0.62	+	.	g254.t1
Scaffold_9	AUGUSTUS	start_codon	1093034	1093036	.	+	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_9	AUGUSTUS	CDS	1093034	1093333	0.62	+	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_9	AUGUSTUS	stop_codon	1093331	1093333	.	+	0	transcript_id "g254.t1"; gene_id "g254";
# protein sequence = [MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKS
# FRWTTKEGCTIGILINLINHN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g254
###
# start gene g255
Scaffold_9	AUGUSTUS	gene	1093582	1094616	0.42	+	.	g255
Scaffold_9	AUGUSTUS	transcript	1093582	1094616	0.42	+	.	g255.t1
Scaffold_9	AUGUSTUS	start_codon	1093582	1093584	.	+	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_9	AUGUSTUS	CDS	1093582	1094616	0.42	+	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_9	AUGUSTUS	stop_codon	1094614	1094616	.	+	0	transcript_id "g255.t1"; gene_id "g255";
# protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTNNAGQMKNMLAWLEEKYGIKGIR
# ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA
# LSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKNWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRV
# LPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMAPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g255
###
# start gene g256
Scaffold_9	AUGUSTUS	gene	1094877	1095654	0.79	-	.	g256
Scaffold_9	AUGUSTUS	transcript	1094877	1095654	0.79	-	.	g256.t1
Scaffold_9	AUGUSTUS	stop_codon	1094877	1094879	.	-	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_9	AUGUSTUS	CDS	1094877	1095304	1	-	2	transcript_id "g256.t1"; gene_id "g256";
Scaffold_9	AUGUSTUS	CDS	1095386	1095521	0.85	-	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_9	AUGUSTUS	CDS	1095628	1095654	0.79	-	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_9	AUGUSTUS	start_codon	1095652	1095654	.	-	0	transcript_id "g256.t1"; gene_id "g256";
# protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSTKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINRALAQVVSSNLDTPPA
# PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERA
# TTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g256
###
# start gene g257
Scaffold_9	AUGUSTUS	gene	1097462	1098120	0.21	-	.	g257
Scaffold_9	AUGUSTUS	transcript	1097462	1098120	0.21	-	.	g257.t1
Scaffold_9	AUGUSTUS	stop_codon	1097462	1097464	.	-	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_9	AUGUSTUS	CDS	1097462	1098009	1	-	2	transcript_id "g257.t1"; gene_id "g257";
Scaffold_9	AUGUSTUS	CDS	1098072	1098120	0.21	-	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_9	AUGUSTUS	start_codon	1098118	1098120	.	-	0	transcript_id "g257.t1"; gene_id "g257";
# protein sequence = [MDALNALHTASSSSTHNLANSLRRAADLNDQLKQLGSLFDTTKELFLRSILDLQNAGTDPIVVLEALKAAEPNRRAIN
# LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLP
# AIESLAEPALSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g257
###
# start gene g258
Scaffold_9	AUGUSTUS	gene	1098893	1099421	0.33	-	.	g258
Scaffold_9	AUGUSTUS	transcript	1098893	1099421	0.33	-	.	g258.t1
Scaffold_9	AUGUSTUS	stop_codon	1098893	1098895	.	-	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_9	AUGUSTUS	CDS	1098893	1099160	0.85	-	1	transcript_id "g258.t1"; gene_id "g258";
Scaffold_9	AUGUSTUS	CDS	1099255	1099421	0.35	-	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_9	AUGUSTUS	start_codon	1099419	1099421	.	-	0	transcript_id "g258.t1"; gene_id "g258";
# protein sequence = [MVSSKDLDVFASLRGKALSAVALKDTTSSPPLETQASTSVSKTLVAPPRLIRRNRDSSPRSARSKDSDNELLSGFPLV
# DAVPRASSSTKVPVGKKEPKSKTTVKVVEASKASKPTPTAMVYKRVRLPPSSGKSHQLLSKANPDK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g258
###
# start gene g259
Scaffold_9	AUGUSTUS	gene	1112434	1113243	0.91	+	.	g259
Scaffold_9	AUGUSTUS	transcript	1112434	1113243	0.91	+	.	g259.t1
Scaffold_9	AUGUSTUS	start_codon	1112434	1112436	.	+	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_9	AUGUSTUS	CDS	1112434	1113243	0.91	+	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_9	AUGUSTUS	stop_codon	1113241	1113243	.	+	0	transcript_id "g259.t1"; gene_id "g259";
# protein sequence = [MSVSQSFLTRPSTPDLSITLRVLSTKNDKQTFTAVGPDDELLSDVVPSNIVSRQPSTGADGESEADFDDDELASEPDE
# PVPSKGKGKSKAKGRKSTGGGRKGASKAAEHQLADQRVEMDKAKEADAVKRYSYLLGQTELFKHFVDIKRARDSEYAALLDAQQGKGNGKKKGKNGKA
# GNGGARHRKSEKEEDEELLKDGEKELGGAEDMPMVFEESPSYIEGTMRPYQLQGLNWMISLHHNGLNGILADEMVGYGLGHSSIWLASYQYLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g259
###
# start gene g260
Scaffold_9	AUGUSTUS	gene	1113719	1114261	0.84	+	.	g260
Scaffold_9	AUGUSTUS	transcript	1113719	1114261	0.84	+	.	g260.t1
Scaffold_9	AUGUSTUS	start_codon	1113719	1113721	.	+	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_9	AUGUSTUS	CDS	1113719	1114261	0.84	+	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_9	AUGUSTUS	stop_codon	1114259	1114261	.	+	0	transcript_id "g260.t1"; gene_id "g260";
# protein sequence = [MPLVAHYTLGTPLQNSLEELWALLNFIAPEIFVSFSDLDSFLNKDDAPTAATITTADTIVNNASEKDPAAMEVDGTEV
# EQKPNEGENQSVAQGKQKEQTDQEKKSQKVVEALHKILRPFLLRRVKADVEKGLLPSKRRSPRTLSVFVYPSAFVHRKGNQHLCAPYSDAAPLVPLSP
# RKRY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g260
###
# start gene g261
Scaffold_9	AUGUSTUS	gene	1115283	1116119	0.34	+	.	g261
Scaffold_9	AUGUSTUS	transcript	1115283	1116119	0.34	+	.	g261.t1
Scaffold_9	AUGUSTUS	start_codon	1115283	1115285	.	+	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_9	AUGUSTUS	CDS	1115283	1115500	0.45	+	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_9	AUGUSTUS	CDS	1115852	1116119	0.39	+	1	transcript_id "g261.t1"; gene_id "g261";
Scaffold_9	AUGUSTUS	stop_codon	1116117	1116119	.	+	0	transcript_id "g261.t1"; gene_id "g261";
# protein sequence = [MITHGAEKIIHGGDNGDSDDLDIDAIIAKGEERTSELNSKYEGLNLEDLSNFKSDASVQQWEGEDFRSGVSLIEPTAE
# DTADTLAELEIERQQEQEFIDTGKSKLYYCLLHGLNECTAEPLVDSEIALKESYLEHGFPNWSRRDFQQFVKGLEAYGWYAGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g261
###
# start gene g262
Scaffold_9	AUGUSTUS	gene	1128555	1129814	0.38	-	.	g262
Scaffold_9	AUGUSTUS	transcript	1128555	1129814	0.38	-	.	g262.t1
Scaffold_9	AUGUSTUS	stop_codon	1128555	1128557	.	-	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_9	AUGUSTUS	CDS	1128555	1129814	0.38	-	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_9	AUGUSTUS	start_codon	1129812	1129814	.	-	0	transcript_id "g262.t1"; gene_id "g262";
# protein sequence = [MISLPNEIQLEIFYALHYSDATQIAKQDTLHAVSQVCRQWRHLTTSTSIFWTYIFVTETSVDMSVRFDDPLLVEETHT
# SLIFPWVSTLLRRSRAKPIDVSIALESDFFDPTLSEAQNLSNFSWRPGHVAILSRILATHAARLRTVEILSDVWQPIQDLGAALVGVPMPLLQVWNVT
# RDNAQWGHQTHFDLELDANMSAIECPCGMNPSNELNTKMYPNLRILTLQGVPQNWNQLIPRNLVELDLEYLPLNRRPNQEELRALLLGSQFSLQSLTL
# WAAAPLRGDHVKVTLPNLKTLSVGFSFLHAAINLTTYLEVPKLSSLEIYDMTHHNSSNFDDEHSVMTTMWLLEDFYLHMIDHWPLKKLTQLTFRSPSF
# PTSDYDDLEDAFAEHREDDSPLPILLNFLLHCSSVKKVHFIDAISPH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g262
###
# start gene g263
Scaffold_9	AUGUSTUS	gene	1130285	1131515	0.55	-	.	g263
Scaffold_9	AUGUSTUS	transcript	1130285	1131515	0.55	-	.	g263.t1
Scaffold_9	AUGUSTUS	stop_codon	1130285	1130287	.	-	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_9	AUGUSTUS	CDS	1130285	1130884	0.55	-	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_9	AUGUSTUS	CDS	1131030	1131515	0.78	-	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_9	AUGUSTUS	start_codon	1131513	1131515	.	-	0	transcript_id "g263.t1"; gene_id "g263";
# protein sequence = [MHEAEVIEIEGEVEDQEGLDDDEALPDIKRARTVAEEGGEEEGEISEETISTTQAVIMQLHPLLRAVVAKASGTPLPL
# IPLTTQTVDSFTPLPPPQTSSSSSEQISNPVATAVDNLTSQLESKIVDESSSSSQQVRRTPELEPDESSSSSQQVKRTPELEPGQSLSQPSQPPTSAS
# IIAHAQSQNPIPTTVTDTVGSNPATTGESNKISPTSTIPSTANITMEPSNVEPNQDANHIPPWSFSSQLASTFAQSSSLYPQSQSQLHGISNYQTQLL
# EQAIANAAHAAQAEADLEEDGDENGDGDGDANGKDRAELAGASQEETAVTTSANRDVVGDRQVGGGVDSDADADGEVDMDLQNENIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g263
###
# start gene g264
Scaffold_9	AUGUSTUS	gene	1131667	1132743	1	-	.	g264
Scaffold_9	AUGUSTUS	transcript	1131667	1132743	1	-	.	g264.t1
Scaffold_9	AUGUSTUS	stop_codon	1131667	1131669	.	-	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_9	AUGUSTUS	CDS	1131667	1132743	1	-	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_9	AUGUSTUS	start_codon	1132741	1132743	.	-	0	transcript_id "g264.t1"; gene_id "g264";
# protein sequence = [MEQSPPLAELEEDWDENDEGEYDEEEDGDDDIDAQAEEMARKLNEQLWEDMRRAATTESVSTTPMEIDPVSAIHSNTS
# DPASTVAPGSSQKEEAVLSTIKAIMALLNHDSVAHNILASTALPSTPFGSVLDALIQTLTTGKVTKPTAIVLSQTLVGLAGSEALFGSLKGRDAAQAK
# KEILGKRKREEEPVTIPPPQVPSKYDIVSEAVQVVTHALHTSSSINPALITSIQESLRNIFLFCVSAAARPVESGASASTASLQEISGLIQVLGVLSG
# IQFGLNTAHGTGQSADINAMVHPCMVPSCNKTFMQLTNLRTHENTHHSNQSQPNSAPAMLPLLTTDPSHAHFLLAPPLFSEIMI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g264
###
# start gene g265
Scaffold_9	AUGUSTUS	gene	1137678	1138894	0.61	-	.	g265
Scaffold_9	AUGUSTUS	transcript	1137678	1138894	0.61	-	.	g265.t1
Scaffold_9	AUGUSTUS	stop_codon	1137678	1137680	.	-	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_9	AUGUSTUS	CDS	1137678	1138050	0.63	-	1	transcript_id "g265.t1"; gene_id "g265";
Scaffold_9	AUGUSTUS	CDS	1138242	1138894	0.72	-	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_9	AUGUSTUS	start_codon	1138892	1138894	.	-	0	transcript_id "g265.t1"; gene_id "g265";
# protein sequence = [MAEKPFERGFRRGRVEGKREALEILRRLGKRVCLYSLDFEPGSIWNHSTVSEDEVKEYLQVLEEDEDISPTANSIIPT
# PRTTESPVASPTKRLFKRTFSHVEIPVATSSLKRKDPDISFEHIGSPSKRIRQDYDDDDDDDEEEEEEEEEEEEEEAYASNEEAQAEKRWKGKEKELD
# IDAGPSRLTPEHSTLRRKPLKPSNSRVFVEIPILTSSQKGRTSLAIDENDYDDEYSSDTSIYFESDNHSRPNTSRSNTRVSSSEMISALTPNVHRIAK
# KFFRHKFEVIGPDLSSKKAVEREVTTNFASHPGHPESMKWGQKLAVEENKIFFNTINLDGEEYEVSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g265
###
# start gene g266
Scaffold_9	AUGUSTUS	gene	1139860	1140654	0.17	-	.	g266
Scaffold_9	AUGUSTUS	transcript	1139860	1140654	0.17	-	.	g266.t1
Scaffold_9	AUGUSTUS	stop_codon	1139860	1139862	.	-	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_9	AUGUSTUS	CDS	1139860	1140248	0.7	-	2	transcript_id "g266.t1"; gene_id "g266";
Scaffold_9	AUGUSTUS	CDS	1140387	1140654	0.17	-	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_9	AUGUSTUS	start_codon	1140652	1140654	.	-	0	transcript_id "g266.t1"; gene_id "g266";
# protein sequence = [MEITPEMQQTIEEMKTDPSLYTKLSQSIAPEIYGHDDVKKALLLLLIGGVTKITADGLKIRGDINICLMGDPGVAKSQ
# LLKYITKIAPREGGALVLADNGICCIDEFDKMEESDRTAIHEVMEQQTISISKAGISTTLNARTSILAAANPLYGRYNLKLSPVENINLPAALLSRFD
# LIFLILDKPNREDDERLAQHVTYVHMHNTHPDLGIEIFNPML]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g266
###
# start gene g267
Scaffold_9	AUGUSTUS	gene	1144128	1144742	0.34	+	.	g267
Scaffold_9	AUGUSTUS	transcript	1144128	1144742	0.34	+	.	g267.t1
Scaffold_9	AUGUSTUS	start_codon	1144128	1144130	.	+	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_9	AUGUSTUS	CDS	1144128	1144742	0.34	+	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_9	AUGUSTUS	stop_codon	1144740	1144742	.	+	0	transcript_id "g267.t1"; gene_id "g267";
# protein sequence = [MDWGNAIVRSKSVDATGIVNSIEMDLHLEGDFKKTKKKITWLSQSTSEYPLIPVTLLDYDYLITKKKLEENDNIKDFI
# TPVTEFRESALADANVRDLKKGDYLQFERKGYFIFDGENKEDGRLEFIRIPDGKAANLASKAAPSSQAVPASTEGSQSFVTDGGPVIARDPESATKMY
# KMDKVYGVNVNLEGPVTKMYKMESIYNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g267
###
# start gene g268
Scaffold_9	AUGUSTUS	gene	1153965	1156557	0.28	+	.	g268
Scaffold_9	AUGUSTUS	transcript	1153965	1156557	0.28	+	.	g268.t1
Scaffold_9	AUGUSTUS	start_codon	1153965	1153967	.	+	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_9	AUGUSTUS	CDS	1153965	1154316	0.36	+	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_9	AUGUSTUS	CDS	1154394	1154754	0.36	+	2	transcript_id "g268.t1"; gene_id "g268";
Scaffold_9	AUGUSTUS	CDS	1154871	1156557	0.79	+	1	transcript_id "g268.t1"; gene_id "g268";
Scaffold_9	AUGUSTUS	stop_codon	1156555	1156557	.	+	0	transcript_id "g268.t1"; gene_id "g268";
# protein sequence = [MISCCSNELFVRSQPSQKYKPYTPINLPNRQWPSKTFTKSPIWLSTDLRDGNQALVNPMTIEQKTTFFRELVKCGVKQ
# IEVAYPSASDTDFAFVRGLIEKHEIPDDVWIQVSIDRHGFAGSKHAIIHMYNATSPTFRNVVFRNSKEQTLDLAIKHTKIIRELTEECTQKYGTKFIY
# EYSPETFTQTEPDFAIEVCEAVKNAWGKAGLGDERIIFNLPSTVEIAPPNHYADQVRVVLLVPNTHSLSSFQGTGIASAELGTLAGGDRIEGCFFGNG
# ERTGNVDLVTLALNLYTQGIPPMLDLSDLQNTIDVVTACNDLPIPARYPYAGELVYTAFSGSHQDAIKKGFEAQRLRHEGCKAKGEPLIWDIPYLPID
# PADLGQTYEALIRVNSQSGKGGISYLLKQNLHLDLPRKMQVAFYQVVQEVSDREAREMTVDDITSAFKRTYHFGTGHKGRLSLRSFKISSLNSEKPKP
# KAESDQESGEEDDTQRRFDGTVSVDGVYRVIRGKGNGPLSALLDALRTHLSLDFAIREYSEHTINDADEGENAQAASYVELISATERKTTSTRQSWWG
# VGVDADIARSGLRAVLSAINCAIIDGRELPNLKLSVGFHSKSSGQEDVASVIVNQLGLELPRRFQAAFFEVVQRKALEEADEISIDGVTQLFKDTYKY
# QNDSPSTKVSMESFKLDHLDGSRRSLTGSFSFFGGASRTISGTGNGPLSSLLAALHTQIAGTLSIKDYWEHSIGEGSEVRAASYVDLVYEVTGESTKN
# LKSSAWGVATDTDITASGVKAVLNAVNDLNVVLKN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g268
###
# start gene g269
Scaffold_9	AUGUSTUS	gene	1158025	1159023	0.99	-	.	g269
Scaffold_9	AUGUSTUS	transcript	1158025	1159023	0.99	-	.	g269.t1
Scaffold_9	AUGUSTUS	stop_codon	1158025	1158027	.	-	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_9	AUGUSTUS	CDS	1158025	1159023	0.99	-	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_9	AUGUSTUS	start_codon	1159021	1159023	.	-	0	transcript_id "g269.t1"; gene_id "g269";
# protein sequence = [MASDITAEPGPTSVSSRIKALESQSLADSSSNQKRSNLIIDSDGDHEEDWVSVPITATALTPTIITTSVAPPLPSRKQ
# NHVPALSVSSFHSVSLSSESVNSLVIDSGRDFNKEEDTVSLESEPYEDVDSTTSLGSPGAVARLTADWNQLNNLPSNLQRPRSAAPIIAGKTKSAPPL
# PPPRSASASFSSSVSSSGPPSTSTSNGRRPPPPPPSSNRASTFTTAGSDRSSVLNVTSNASSTTSSSINHGYPPYQAYKSKPPPPPPPNKPTAPLKPQ
# ALKYLPSSSCSSSVTSSSSTSTTGPGPLPPLLPLAVPHQFPHLPESDMKPSSKQTWLI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g269
###
# start gene g270
Scaffold_9	AUGUSTUS	gene	1161965	1162279	0.63	-	.	g270
Scaffold_9	AUGUSTUS	transcript	1161965	1162279	0.63	-	.	g270.t1
Scaffold_9	AUGUSTUS	stop_codon	1161965	1161967	.	-	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_9	AUGUSTUS	CDS	1161965	1162279	0.63	-	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_9	AUGUSTUS	start_codon	1162277	1162279	.	-	0	transcript_id "g270.t1"; gene_id "g270";
# protein sequence = [MCVPWSHVEFGTFLTIRDSSDLKLTTGKKFTLLGTPEGDEIKDPARLYSVLQFLLSPLIFSFFFEIELGNLPDVVNDL
# DIDFTKDPNAVRDINMIRGTFAKLKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g270
###
# start gene g271
Scaffold_9	AUGUSTUS	gene	1163672	1163968	0.62	-	.	g271
Scaffold_9	AUGUSTUS	transcript	1163672	1163968	0.62	-	.	g271.t1
Scaffold_9	AUGUSTUS	stop_codon	1163672	1163674	.	-	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_9	AUGUSTUS	CDS	1163672	1163968	0.62	-	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_9	AUGUSTUS	start_codon	1163966	1163968	.	-	0	transcript_id "g271.t1"; gene_id "g271";
# protein sequence = [MANGPPTPPPTTDVEIQDEARMNDTLPPAVDGTSDPAPEATSAQPPPQQSNQIQDPYGLIFPRIAELATQKRWIELID
# IAEITEINARLALSRQTLSG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g271
###
# start gene g272
Scaffold_9	AUGUSTUS	gene	1169822	1170238	0.52	+	.	g272
Scaffold_9	AUGUSTUS	transcript	1169822	1170238	0.52	+	.	g272.t1
Scaffold_9	AUGUSTUS	start_codon	1169822	1169824	.	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_9	AUGUSTUS	CDS	1169822	1170238	0.52	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_9	AUGUSTUS	stop_codon	1170236	1170238	.	+	0	transcript_id "g272.t1"; gene_id "g272";
# protein sequence = [MTVNNETGVIQPIKEIGALLRQHSGVYFHTDAAQAVGKIPVDVNDMNVDLMSISGHKLYGPKGVGAAYVRRRPRVRLE
# PILNGGGQERGLRSGTLPTALAVGLGEAARIAKKEMAVSVVHFFIFHDEDARSQFPISDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g272
###
# start gene g273
Scaffold_9	AUGUSTUS	gene	1176645	1177171	0.94	+	.	g273
Scaffold_9	AUGUSTUS	transcript	1176645	1177171	0.94	+	.	g273.t1
Scaffold_9	AUGUSTUS	start_codon	1176645	1176647	.	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_9	AUGUSTUS	CDS	1176645	1176674	0.94	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_9	AUGUSTUS	CDS	1176722	1177171	0.97	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_9	AUGUSTUS	stop_codon	1177169	1177171	.	+	0	transcript_id "g273.t1"; gene_id "g273";
# protein sequence = [MEYKIAAAFCNGASPDFETGVNFVLVEKIKTGRPNWSPATLEEVSDEIVDKFFHEKSPYLESVPEFKHPFAPGESREY
# VEYALPTETAIKDMVTGEHPNGGDTGITLNELVSSFENITDSKMGVREKIQEVAARRCELIDNADGNRVWLKWIHNAQLPE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g273
###
# start gene g274
Scaffold_9	AUGUSTUS	gene	1181729	1182136	0.29	+	.	g274
Scaffold_9	AUGUSTUS	transcript	1181729	1182136	0.29	+	.	g274.t1
Scaffold_9	AUGUSTUS	start_codon	1181729	1181731	.	+	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_9	AUGUSTUS	CDS	1181729	1182136	0.29	+	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_9	AUGUSTUS	stop_codon	1182134	1182136	.	+	0	transcript_id "g274.t1"; gene_id "g274";
# protein sequence = [MIASSTMTQNPDIPESHALRGWYDSSGSGASFQSHNNAGGSFGAAGGGGFSRSELKPLLEMKLEANRIPESEEKPVYF
# STRAMVMHIRGENIAYPACETCNKKVVEDGGAWRCDKCDKTLAGPTYRHADFFVDFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g274
###
# start gene g275
Scaffold_9	AUGUSTUS	gene	1185737	1186150	0.86	+	.	g275
Scaffold_9	AUGUSTUS	transcript	1185737	1186150	0.86	+	.	g275.t1
Scaffold_9	AUGUSTUS	start_codon	1185737	1185739	.	+	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_9	AUGUSTUS	CDS	1185737	1186150	0.86	+	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_9	AUGUSTUS	stop_codon	1186148	1186150	.	+	0	transcript_id "g275.t1"; gene_id "g275";
# protein sequence = [MIRALRARNFSKRPSENTPPAKKSTTPKGIRRNRTRKTKKNIIAAKFDAEQAKKKAQKSSLPVRFNVVFYGDNADVEM
# QDAPSTSQPTIVPVMLPRALNQPPVCEPSGEAIAAATGSSYCGQPAAFVRDELESSGPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g275
###
# start gene g276
Scaffold_9	AUGUSTUS	gene	1187794	1189086	0.47	-	.	g276
Scaffold_9	AUGUSTUS	transcript	1187794	1189086	0.47	-	.	g276.t1
Scaffold_9	AUGUSTUS	stop_codon	1187794	1187796	.	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_9	AUGUSTUS	CDS	1187794	1188113	0.68	-	2	transcript_id "g276.t1"; gene_id "g276";
Scaffold_9	AUGUSTUS	CDS	1188561	1189086	0.5	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_9	AUGUSTUS	start_codon	1189084	1189086	.	-	0	transcript_id "g276.t1"; gene_id "g276";
# protein sequence = [MTPVEKLRMTIRRCRRKANGLEKWMTRDTKNRADDIYALVIGDNIFAAELTASLTTSPEASSAQTIKVIPAQEFQPFQ
# KLENTIQTHYYTTLKASAQFSNVEKQSAFDDLRNIDTLQTKCLRTTLKSSFDYVDCAVLFIRNKFVPSDDWSELDDIWTAYKRKRTNDLAGVYTPRPD
# ADFFSSLKAYALFDTAEDKNSAVHNLRDIGTLQTKCGGIFKNSFDYVDCAVGYFKDNYARSEDKPRLDEMWKVYKAKRDGDLQKAGKRRATEQDVVDG
# TKKLKLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g276
###
# start gene g277
Scaffold_9	AUGUSTUS	gene	1192550	1194826	0.4	-	.	g277
Scaffold_9	AUGUSTUS	transcript	1192550	1194826	0.4	-	.	g277.t1
Scaffold_9	AUGUSTUS	stop_codon	1192550	1192552	.	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_9	AUGUSTUS	CDS	1192550	1194826	0.4	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_9	AUGUSTUS	start_codon	1194824	1194826	.	-	0	transcript_id "g277.t1"; gene_id "g277";
# protein sequence = [MCFQSTSLWRPVPPSLDARSPISERNQVHFMAAIDMVVPYVSRPPRAPYLLSIPTPRCLQNYINLRIFPPSTPNISSS
# FASLSSTDNDESGSWDLASEPHVTRSTSSRSRSNSYNNNFADDESSDSSTVGFSYGCGISGTFPSAERIRVRWAKPIRSFDTVDSSDGRRRVGVKDVK
# GEMTCVIRGQAGNGVLIEVSYKGTCKGVWFPGVATMLGMDVGLIAKNSGVTWAEGFPNEWQVNGGTGYTGFDVGSNQKLSRHDSLESNAGNPDINILP
# STPNGEIKFPRASGLASRQDSTSSTSSSTSSLLRAPLPTQNVADYSFEGSPTASGILSSNGTESLSSLPASVSNLTSQSQSRIDRGPEHPVTLHLNMN
# ELLPASRNNFIFSISGTVVVTPRPPHPRLNGNSTVHSGSEGEGDSDDLRSVILPKFTVHAADSESFSFIVKNDSPDGEIVEVYNDSMSSSSIKGRPTQ
# LNKGAISKSSSDNGLRIALKRIPFPVAANGTPVNKQRTDETTLRPLARPLTPSGSIGSRSSSPINGQINNRVPRTSLSSLGKLPSGTTVIARPVRDGP
# LMIPWVNATVTPLLPSTSEGLPESYAVRLSLPAPADMVSEWLEFGLAKPGISAGSKDADRRPPRIDLVNVSVEGVPVRFDTTAATAPTASQELDVVDL
# GGVKFGEMSSKEWISWIRVRVGGAGGSMVVVDYVVRTEDDAKGKAGGKGKKKVPMDIYLPSFSLPVGRLEVVVEDAPGKIFCHTFLRPFISD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g277
###
# start gene g278
Scaffold_9	AUGUSTUS	gene	1217861	1218250	0.99	-	.	g278
Scaffold_9	AUGUSTUS	transcript	1217861	1218250	0.99	-	.	g278.t1
Scaffold_9	AUGUSTUS	stop_codon	1217861	1217863	.	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_9	AUGUSTUS	CDS	1217861	1218250	0.99	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_9	AUGUSTUS	start_codon	1218248	1218250	.	-	0	transcript_id "g278.t1"; gene_id "g278";
# protein sequence = [MECRLFSSSNAWTCCVSIRIEFDDDGNRLREVAENIFIGNITDKSQVESALRKAQFAVLNPEISWDKILESPIEELKK
# LVNAKSLPFSQNVVCVDLEGPDLTDLSFIDLPGELNVCFCAAKDNALTWLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g278
###
# start gene g279
Scaffold_9	AUGUSTUS	gene	1221663	1223364	0.56	+	.	g279
Scaffold_9	AUGUSTUS	transcript	1221663	1223364	0.56	+	.	g279.t1
Scaffold_9	AUGUSTUS	start_codon	1221663	1221665	.	+	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_9	AUGUSTUS	CDS	1221663	1222772	0.59	+	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_9	AUGUSTUS	CDS	1222909	1223364	0.93	+	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_9	AUGUSTUS	stop_codon	1223362	1223364	.	+	0	transcript_id "g279.t1"; gene_id "g279";
# protein sequence = [MVFPNPTHTRDDAMLHQEGRNEGSQLYNPHDQGQPAHSSSDPVRPKYGHGIPQEHRDAQPDANAAVTVPSTTAIREHD
# GDRMNTQSASTDSRTETFQSNRRTYSDAVQSAPSTKAGEDRKTDTQAGMVPGTVNHRNAAPSQSSGRGPSGSIEIGHRTTRDTSLHGRDGRADRETSS
# GVLRESRIPRQYLEEQIAHIQKQNQRLEAHLCDIQRRNQEMEAQLGSVERYLRKQEIEIGELRKRLINEQAATAHYQTKDAHSRELLDARMKELQGAR
# AFLNTSDMYSGADIVSMVKSLNGEIFQAAASITDTIVGFMSSQVSLENDPWAVDIVSKTLGEEVATLLQHNHAVLDEHMTLVQIALQAGLNQRSQYAV
# VYRTWRSLTKAQTKHTVYQNPGPHEHIAEIVKAILIVAGWWPSRSSEIVARIESTIRGRISAIVLLLEKLDTAMTQITSMDLTLEIPTPGVHFNTRRM
# QDEDGKGSLTDETVLCTSEIGLMMKSVDIDGRSEEAILLKPKVVFRSAFIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g279
###
# start gene g280
Scaffold_9	AUGUSTUS	gene	1224110	1225844	0.16	+	.	g280
Scaffold_9	AUGUSTUS	transcript	1224110	1225844	0.16	+	.	g280.t1
Scaffold_9	AUGUSTUS	start_codon	1224110	1224112	.	+	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_9	AUGUSTUS	CDS	1224110	1224666	0.16	+	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_9	AUGUSTUS	CDS	1224719	1225844	0.32	+	1	transcript_id "g280.t1"; gene_id "g280";
Scaffold_9	AUGUSTUS	stop_codon	1225842	1225844	.	+	0	transcript_id "g280.t1"; gene_id "g280";
# protein sequence = [MDGFTNKQGHTTYGFLDMGGASTQIAFEPGKDHELDTNDLIDVRLRLLDGDEIHHKVFVTTWLGYGTNQARERYVGMA
# IEGFEESRSGEADVVPDPCLPKDLELVETPAFVGHASDHIQKTHHLKGTGSFEQCMQKTSTLLNKSKPCPDVPCLMDGVHVPPIDFSVSFHWCFRVLV
# FIGACLWAWREWSDIVREHEETVKYRPLDGDGEVQGKNGEVVAVGKWGPQVEITRLQMQCFKAAWITNVLHEGIGMPRIVDIGGNTTSESDNVDAKAE
# QKGLGRPAFQSMDSVGDIAISWTLGKMVLEASKEVPPLHGTVPPINDPQIPEGFPVKPIRPWSSLDGLEDRLTPHLPPSLHRTSLGFSPVLLILYTMV
# FFVILVIACPLRRQSRAFCLRTLRKVAKRDLNSFALEEGKFLNGNGIISRPPSPTSGPTSGPIKWLRPLRQFLAPKPKRSRTRPSVLTLTGLNSNVHD
# GPVTPIRGSPVRSYTLPAGVILANSGGSRSSSPIPPSPNNGIVDDTNGGSSSFSPSRNTSHMNLSSMITRSVSRVNVNSGHQISDGFLHD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g280
###
# start gene g281
Scaffold_9	AUGUSTUS	gene	1228753	1229193	0.91	+	.	g281
Scaffold_9	AUGUSTUS	transcript	1228753	1229193	0.91	+	.	g281.t1
Scaffold_9	AUGUSTUS	start_codon	1228753	1228755	.	+	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_9	AUGUSTUS	CDS	1228753	1229193	0.91	+	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_9	AUGUSTUS	stop_codon	1229191	1229193	.	+	0	transcript_id "g281.t1"; gene_id "g281";
# protein sequence = [MREPGTSQTLVNINPPTQPPNQDEDGMEEFYVPTALEGGVDPENAQPFTFSLEQLMPLAGAGPNDRLSVDPPALEDPP
# YYNTRSRARSRSASVEPLPLPPAPSRKTRKVPEPSQILPPLREASHEPESLPSKMEYEHEHDPPVLGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g281
###
# start gene g282
Scaffold_9	AUGUSTUS	gene	1231135	1231548	0.91	-	.	g282
Scaffold_9	AUGUSTUS	transcript	1231135	1231548	0.91	-	.	g282.t1
Scaffold_9	AUGUSTUS	stop_codon	1231135	1231137	.	-	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_9	AUGUSTUS	CDS	1231135	1231548	0.91	-	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_9	AUGUSTUS	start_codon	1231546	1231548	.	-	0	transcript_id "g282.t1"; gene_id "g282";
# protein sequence = [MITGSHIQAASNEADLLGGLNFGTPKVASRSGTPAPTIPSSNQAFDAVIAIGVLIKGATMHFEYICDAVSNSLMKIQV
# DTGVPVIFGVLTVLNDDQALERAGLGKGDKKGHNHGEEWGLAAVEMGSHVRRWNSGKFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g282
###
# start gene g283
Scaffold_9	AUGUSTUS	gene	1232930	1233376	1	-	.	g283
Scaffold_9	AUGUSTUS	transcript	1232930	1233376	1	-	.	g283.t1
Scaffold_9	AUGUSTUS	stop_codon	1232930	1232932	.	-	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_9	AUGUSTUS	CDS	1232930	1233376	1	-	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_9	AUGUSTUS	start_codon	1233374	1233376	.	-	0	transcript_id "g283.t1"; gene_id "g283";
# protein sequence = [MLLANNNININSFCFLFVIRRLVDFFALFLVDVSDSDSDEFDEEEEEEEEVGSESEDEEALSSSKTFLLAVFVGFLGS
# VSDSESEDDEDEDELELVLLVFLVGFFFIGFSSDSDSEEDADEEEAETLELFALLNFLGTSDFDFLKVRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g283
###
# start gene g284
Scaffold_9	AUGUSTUS	gene	1242721	1243938	0.48	+	.	g284
Scaffold_9	AUGUSTUS	transcript	1242721	1243938	0.48	+	.	g284.t1
Scaffold_9	AUGUSTUS	start_codon	1242721	1242723	.	+	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_9	AUGUSTUS	CDS	1242721	1242855	0.59	+	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_9	AUGUSTUS	CDS	1242935	1243392	0.68	+	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_9	AUGUSTUS	CDS	1243455	1243938	0.77	+	1	transcript_id "g284.t1"; gene_id "g284";
Scaffold_9	AUGUSTUS	stop_codon	1243936	1243938	.	+	0	transcript_id "g284.t1"; gene_id "g284";
# protein sequence = [MTPKTMNSLTAIAGHEGDEEEWEKEIGGYVVPEEEASLQPFDFGMDPSPPPAASGVRRHVSLTYGAQGAGVNRPKVTS
# LKRAGTLQTPLPVNNTPEHAVAGGEEEEYEYTYAMEDPAAYESYDTYGAGGPTSPLGRSSPWGSTGSSSGSAGDWRTPGGPAVSNAIDDVQRALSNME
# ISGSGASGSFGQSAHPPRFNPTVDYDGRKTPISQAQSYHASGGNDTITGRVSNPNLQYAYNQHQKNPSGGSGERIPNVPLIPSQYLQQNQQQQLQGNQ
# QPRLGVATSFVGGQNQQGQNRDIPAGQNTTQAFGAPIDVSSLIATKGYNPSTFDIRPSFVSYISLCNFIFIPFPSLYTFRLDIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g284
###
# start gene g285
Scaffold_9	AUGUSTUS	gene	1244612	1245007	0.88	+	.	g285
Scaffold_9	AUGUSTUS	transcript	1244612	1245007	0.88	+	.	g285.t1
Scaffold_9	AUGUSTUS	start_codon	1244612	1244614	.	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_9	AUGUSTUS	CDS	1244612	1245007	0.88	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_9	AUGUSTUS	stop_codon	1245005	1245007	.	+	0	transcript_id "g285.t1"; gene_id "g285";
# protein sequence = [MQKIQAQSGPSSPISSQGGGFGSPNMQNMSPLQSGQQSPVQQQANLFAMGNPNALAYQMPQMTPMMQMQMMGMNMGGG
# LGMGNMGNMVGSQFPMSQSQAMHQSVMRHPSPGSGPQQQQQQQQAGGQGFINF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g285
###
# start gene g286
Scaffold_9	AUGUSTUS	gene	1246635	1247441	0.7	+	.	g286
Scaffold_9	AUGUSTUS	transcript	1246635	1247441	0.7	+	.	g286.t1
Scaffold_9	AUGUSTUS	start_codon	1246635	1246637	.	+	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_9	AUGUSTUS	CDS	1246635	1247441	0.7	+	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_9	AUGUSTUS	stop_codon	1247439	1247441	.	+	0	transcript_id "g286.t1"; gene_id "g286";
# protein sequence = [MLSRNALRSPPGTYLITHRSLASIENPKVQRAIILRILRYASFHPWGSLAAQVNRRTNSLSQIVNKLWGGNPFEKQIR
# PFCAGGGVSWTPVAISGDKFRFIDRGSNGNINFRNSETFGWLASRQNPPSHETMSGRGFTNPLRVDITSRIVSKLDSGDTTPLEVLYDNRFIVTMNLA
# SIPPEIEKSIRNPDNQIWLLSQTRWFWPKVVLKSQTQEDIVLHSAAQSPKNLVLFQSPSEVDQWKQIYWRPYEKEIVAPWIEVDFMRPLTTM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g286
###
# start gene g287
Scaffold_9	AUGUSTUS	gene	1256390	1257868	0.78	-	.	g287
Scaffold_9	AUGUSTUS	transcript	1256390	1257868	0.78	-	.	g287.t1
Scaffold_9	AUGUSTUS	stop_codon	1256390	1256392	.	-	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_9	AUGUSTUS	CDS	1256390	1257868	0.78	-	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_9	AUGUSTUS	start_codon	1257866	1257868	.	-	0	transcript_id "g287.t1"; gene_id "g287";
# protein sequence = [MAPLTIESLNPALLKVEYAVRGELAIKAEEYRTKLKTADHDLPFDRVISSNIGNPQQQGLDQPQITFLRQLAALMEYP
# ALVELAPGVFPDDVVKRAKQLQAEIGSIGAYSHSQGVPLIREHVAKFIEGRTKCNPVSASLNYFTLERDGYPSDPKNIFLTAGASAGVSLLISMLISS
# PDSGIMIPIPQYPLYTATIAQYSGKPIPYYLDGSSDWNTSLEEIKVALDKAEAEGTKPKALVVINPGNPTGALLSEDTQIELIHICEKHGLVLLADEV
# YQSNLHKPDTHPFTSFKKLVSQLKSTVPLVSFHSVSKGVLGECGRRGGYFECTNFSPEILALIYKMVSVGLCPPLQGQIAVDTLVRPPKEGELSFPKW
# KEETDKIHAALAERTKIMADRLNKLAGVECVNSPGALYLYPKITLSSKAIAEAEKHGKQPDAFYALQLLDETGICVVPGSGFGQREGHWHYRLTCLCP
# GVEEYVGKLEKFHNRFIDKFGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g287
###
# start gene g288
Scaffold_9	AUGUSTUS	gene	1262395	1263282	0.93	-	.	g288
Scaffold_9	AUGUSTUS	transcript	1262395	1263282	0.93	-	.	g288.t1
Scaffold_9	AUGUSTUS	stop_codon	1262395	1262397	.	-	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_9	AUGUSTUS	CDS	1262395	1263021	0.98	-	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_9	AUGUSTUS	CDS	1263076	1263282	0.95	-	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_9	AUGUSTUS	start_codon	1263280	1263282	.	-	0	transcript_id "g288.t1"; gene_id "g288";
# protein sequence = [MSLTASQKSAISSVLDVLLTAVATPPSKAKPGDIGVGGTGIGTGRGRKRLLSGMFLVLLDRNDWAEYYDLIPNPRALH
# PIRDSLAENKYTNALEVYTDLSLVFWNAIFYNERDSQISKDAAVLKNLLDIEWAKRADLPQPKSRSPPPGSAQKTYPEIEEKEREREREIEHQIEMEK
# EKEKEKERNAKSSEIQTPQPSQLLYQPQPTFQPQLTFNSVPDIVDMDVDMPDTESEVDQTDTEAEADDEDEGDGIDEDIIHQLETVSPDGLDSMITRK
# KGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g288
###
# start gene g289
Scaffold_9	AUGUSTUS	gene	1268581	1269954	0.76	+	.	g289
Scaffold_9	AUGUSTUS	transcript	1268581	1269954	0.76	+	.	g289.t1
Scaffold_9	AUGUSTUS	start_codon	1268581	1268583	.	+	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_9	AUGUSTUS	CDS	1268581	1269954	0.76	+	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_9	AUGUSTUS	stop_codon	1269952	1269954	.	+	0	transcript_id "g289.t1"; gene_id "g289";
# protein sequence = [MKNYRHHVAGKEDIHNEVLSIESRDLRTRGARNEKLQGSYAQRESIEEKSKEISGERDDAYDNKVMELYRQQSLEGSV
# GESCEQRISREAKLVESRSRYEIIEGKLQESNARCETLEDKLKGSNTRCEILENKVTELNTRCETLESRLKKSNARYEILEGQLKESNTLYETLECRS
# KESFEQRAALESNLEISRAQLFLRQEELAGQAQAINTLNEHIQEQQVTLLKLKQFGITFDHSEAEKRPESNGLDKPDALIHKLITVSNYSRRLGLLDS
# TDVVDLILHQIKGPLESIIGIISQAPDFAGRADIQHQLELTMKTQFAIICRLETALKYVAHNTEYRSQDACKIMEAYASINEGQLLSISQHLLVKPCS
# ENAIEKPIFREPLEGYTDISDPTSRSGLVPAVVHKGVSGRRWYHSMWLCCSALWTMSMLFPINVESYYVCSAFHTDSARIFSFIN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g289
###
# start gene g290
Scaffold_9	AUGUSTUS	gene	1274989	1276155	0.89	+	.	g290
Scaffold_9	AUGUSTUS	transcript	1274989	1276155	0.89	+	.	g290.t1
Scaffold_9	AUGUSTUS	start_codon	1274989	1274991	.	+	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_9	AUGUSTUS	CDS	1274989	1276155	0.89	+	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_9	AUGUSTUS	stop_codon	1276153	1276155	.	+	0	transcript_id "g290.t1"; gene_id "g290";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g290
###
# start gene g291
Scaffold_9	AUGUSTUS	gene	1276206	1277330	0.5	+	.	g291
Scaffold_9	AUGUSTUS	transcript	1276206	1277330	0.5	+	.	g291.t1
Scaffold_9	AUGUSTUS	start_codon	1276206	1276208	.	+	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_9	AUGUSTUS	CDS	1276206	1277330	0.5	+	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_9	AUGUSTUS	stop_codon	1277328	1277330	.	+	0	transcript_id "g291.t1"; gene_id "g291";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDDV
# FNIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELP
# ELEPPAENPHIEVPLEATLEPRESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVF
# SESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRTERVHCEEPIPSPI
# SC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g291
###
# start gene g292
Scaffold_9	AUGUSTUS	gene	1287646	1288812	0.88	+	.	g292
Scaffold_9	AUGUSTUS	transcript	1287646	1288812	0.88	+	.	g292.t1
Scaffold_9	AUGUSTUS	start_codon	1287646	1287648	.	+	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_9	AUGUSTUS	CDS	1287646	1288812	0.88	+	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_9	AUGUSTUS	stop_codon	1288810	1288812	.	+	0	transcript_id "g292.t1"; gene_id "g292";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g292
###
# start gene g293
Scaffold_9	AUGUSTUS	gene	1289104	1290297	0.65	+	.	g293
Scaffold_9	AUGUSTUS	transcript	1289104	1290297	0.65	+	.	g293.t1
Scaffold_9	AUGUSTUS	start_codon	1289104	1289106	.	+	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_9	AUGUSTUS	CDS	1289104	1290297	0.65	+	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_9	AUGUSTUS	stop_codon	1290295	1290297	.	+	0	transcript_id "g293.t1"; gene_id "g293";
# protein sequence = [METPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEIL
# YSHLAATHTETPILELPELEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVK
# TFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQ
# DYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAV
# YLDDILIFSNDLEEHRRMVREVLTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g293
###
# start gene g294
Scaffold_9	AUGUSTUS	gene	1293713	1294297	0.5	+	.	g294
Scaffold_9	AUGUSTUS	transcript	1293713	1294297	0.5	+	.	g294.t1
Scaffold_9	AUGUSTUS	start_codon	1293713	1293715	.	+	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_9	AUGUSTUS	CDS	1293713	1294297	0.5	+	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_9	AUGUSTUS	stop_codon	1294295	1294297	.	+	0	transcript_id "g294.t1"; gene_id "g294";
# protein sequence = [MVEPMDPGMEARSEIKNLRQSKRQTVTEFAQNFKDIGDWTEMSDIDLRECFFTALLPKIRQHLIMVNIAQGITPTLKE
# AIKRAISVDVYLHDPTITGRTSGTSPYTLLTPLLLTLTPWTSALLTPAPEIAGRLSLPVCADDVLVAELKVILSRTAHTRNSGYPSTHTTHTTPADPT
# LWTLMQPIPVMGILGRHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g294
###
# start gene g295
Scaffold_9	AUGUSTUS	gene	1307824	1309158	0.9	-	.	g295
Scaffold_9	AUGUSTUS	transcript	1307824	1309158	0.9	-	.	g295.t1
Scaffold_9	AUGUSTUS	stop_codon	1307824	1307826	.	-	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_9	AUGUSTUS	CDS	1307824	1308755	0.97	-	2	transcript_id "g295.t1"; gene_id "g295";
Scaffold_9	AUGUSTUS	CDS	1308864	1309158	0.9	-	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_9	AUGUSTUS	start_codon	1309156	1309158	.	-	0	transcript_id "g295.t1"; gene_id "g295";
# protein sequence = [MDRASDSFSKFSSTSIMSPAASSNVDQESAWTEPQTPLSKFLSTSTLFPAASSNFDQESVWTEPLTPLRQFSSTSIMS
# PAASSNVDQESAWTEPQTPLTLSPTAFSNVDQKSAWTEPLTPLSKFSSTSTLSPATSFNSGSINSPDTPPSPSRRPRVQPHMEEKSEEHIKRPPNAFI
# LFRTWFIEKQRVSVKVEKNGSALSTIIGLVWRRLPEDERQIWYRKAEIALEDHRRRFPHYTFNPSPSKEKIGKGKRKAREVNARDIVRCEKIAALVSE
# GKEGFELDAAIQEFDESRVPQMVTCFDVPVTEQMFQSSCSSASGARENKEQQIPSIQSSDQLFVDSIARPSNLLDSQSVNTDASTLSPHQVSLLLDWY
# LSEYGVSPSQENLVSQVSPSADTFLVSYPSVVLFVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g295
###
# start gene g296
Scaffold_9	AUGUSTUS	gene	1347936	1348395	0.84	-	.	g296
Scaffold_9	AUGUSTUS	transcript	1347936	1348395	0.84	-	.	g296.t1
Scaffold_9	AUGUSTUS	stop_codon	1347936	1347938	.	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_9	AUGUSTUS	CDS	1347936	1348244	0.95	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_9	AUGUSTUS	CDS	1348306	1348395	0.89	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_9	AUGUSTUS	start_codon	1348393	1348395	.	-	0	transcript_id "g296.t1"; gene_id "g296";
# protein sequence = [MCERNDGENRSEPDDEEDRTKAGNAELGGVLIPDINPDQLPSGSSGLSLRWSVTIEDIPEDDEDPDPEGNRLVDLENG
# VNWTQEMDNEDLTLDFDATFNLDRGLSVNDLLDEQLEHELADVGMYFFRSNQCS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g296
###
# start gene g297
Scaffold_9	AUGUSTUS	gene	1348992	1349582	0.97	+	.	g297
Scaffold_9	AUGUSTUS	transcript	1348992	1349582	0.97	+	.	g297.t1
Scaffold_9	AUGUSTUS	start_codon	1348992	1348994	.	+	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_9	AUGUSTUS	CDS	1348992	1349322	0.97	+	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_9	AUGUSTUS	CDS	1349371	1349582	1	+	2	transcript_id "g297.t1"; gene_id "g297";
Scaffold_9	AUGUSTUS	stop_codon	1349580	1349582	.	+	0	transcript_id "g297.t1"; gene_id "g297";
# protein sequence = [MHVIHSSPDPTGPGTKTKKTKNATTTDSVAQKSVRVPLQDVTNELGNVSVPVPTNETRQNPDDDVHALTPVANVGNGP
# ALTPNMRTLVETNTLTPTDLEAAKAQFFKEAEDHAPERFKDLERAQKVNQPLAATAAVDAANMACTPERVVKDRQVPAAPKRQWPPIRAHKHDRGGKL
# SLPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g297
###
# start gene g298
Scaffold_9	AUGUSTUS	gene	1363354	1364487	0.88	-	.	g298
Scaffold_9	AUGUSTUS	transcript	1363354	1364487	0.88	-	.	g298.t1
Scaffold_9	AUGUSTUS	stop_codon	1363354	1363356	.	-	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_9	AUGUSTUS	CDS	1363354	1364487	0.88	-	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_9	AUGUSTUS	start_codon	1364485	1364487	.	-	0	transcript_id "g298.t1"; gene_id "g298";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VAEHH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g298
###
# start gene g299
Scaffold_9	AUGUSTUS	gene	1377448	1377777	0.91	+	.	g299
Scaffold_9	AUGUSTUS	transcript	1377448	1377777	0.91	+	.	g299.t1
Scaffold_9	AUGUSTUS	start_codon	1377448	1377450	.	+	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_9	AUGUSTUS	CDS	1377448	1377777	0.91	+	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_9	AUGUSTUS	stop_codon	1377775	1377777	.	+	0	transcript_id "g299.t1"; gene_id "g299";
# protein sequence = [MDASDLIVAVNTSDIERRDVLGKSFDLSPSLNESDLLFTVQCLSALVKDTGKTKKGLNAITFKYAGTIEQYVIACDIP
# SKLNLRILQLEFTLSPSTALDLLAGLIFLEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g299
###
# start gene g300
Scaffold_9	AUGUSTUS	gene	1385246	1385892	0.75	-	.	g300
Scaffold_9	AUGUSTUS	transcript	1385246	1385892	0.75	-	.	g300.t1
Scaffold_9	AUGUSTUS	stop_codon	1385246	1385248	.	-	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_9	AUGUSTUS	CDS	1385246	1385277	0.78	-	2	transcript_id "g300.t1"; gene_id "g300";
Scaffold_9	AUGUSTUS	CDS	1385337	1385892	0.82	-	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_9	AUGUSTUS	start_codon	1385890	1385892	.	-	0	transcript_id "g300.t1"; gene_id "g300";
# protein sequence = [MEEDQQFEYSTLYTSDGQPVQVLTPRRGQPPVVVPARGRSITRIESPILQAIARRTGKQPQRHATSESPRDLPPHFDL
# DAGDHDDQDPPVDPDDPGADNDNDNLDDDSGGLPRGEPGDLSGPGDLSGPGGPGGPGCHKVRSPYHFPFSPSRCLTCTIHHPITVKPPSITDPPDPSS
# LSTGFRHLPSNPPQPGPLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g300
###
# start gene g301
Scaffold_9	AUGUSTUS	gene	1391357	1392079	0.55	+	.	g301
Scaffold_9	AUGUSTUS	transcript	1391357	1392079	0.55	+	.	g301.t1
Scaffold_9	AUGUSTUS	start_codon	1391357	1391359	.	+	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_9	AUGUSTUS	CDS	1391357	1392079	0.55	+	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_9	AUGUSTUS	stop_codon	1392077	1392079	.	+	0	transcript_id "g301.t1"; gene_id "g301";
# protein sequence = [MAMQQQLTRFSGDPDDPIQPATFLQDFEVRMTELMTPQADLASRIKPYLKRDSRPWDWYTEDLTATDRTGPWKSFETK
# FHGCFPSQKKEKKSAKSYLNSLEGERITHEQIMTTSKDTNQPYHQWWADRLLRLAKGAEIEKTKQSIGAVWKKLPYALKKAIDEEHDNWGEFTSAIKA
# VKWSVLKVEAEHEANRKASQPVPETPQTKLAGDLAVARISSPPSPSPMRTRPAYAGSTGGRKPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g301
###
# start gene g302
Scaffold_9	AUGUSTUS	gene	1392521	1395104	0.33	+	.	g302
Scaffold_9	AUGUSTUS	transcript	1392521	1395104	0.33	+	.	g302.t1
Scaffold_9	AUGUSTUS	start_codon	1392521	1392523	.	+	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_9	AUGUSTUS	CDS	1392521	1392793	0.36	+	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_9	AUGUSTUS	CDS	1393893	1395104	0.92	+	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_9	AUGUSTUS	stop_codon	1395102	1395104	.	+	0	transcript_id "g302.t1"; gene_id "g302";
# protein sequence = [MSIEDNVQSVLEESNILDVYSVQGDESHISSPFSMDISLRDSEGRHAEVEAMVDDSAMVAAMDVAVYKELRDKLEGWG
# PTERKFRMTNGSVNVAPIQILQPKYFANKHPLGPDFFPDALDQSDNVNLFTRNDGEQGAFRPERVKEILRKVKIGAELSSDQRTRVEQLLSEYAGCFA
# LSIGEVRPVKDAIHRLNIPENVTFPKKVRQKALTPPQREYLHAKIDELLEAGVIEQCNPEDVKCVLPLTLAQKVHEGVGLTVEELMHKLNDECVAAGL
# PTSFDLPTCPLQPPMPMECTESKPAKWRICQNFMAVNKLTEIAPMLQGNIRSKQQSLSGHTYICLFDFASGFYACEVERKSRPYTAFYVEGKGYFWCA
# KLPFGLTSGPSTFANMTSLHLDNLIADGTIELFVDDGGSADDGFESMFAKLTRILNRVCERDLSLSAAKSEFFMSEGIFAGGKISKEGVTVDSAQLMA
# IVDWKRPADALKLASFMGLNPKLC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g302
###
# start gene g303
Scaffold_9	AUGUSTUS	gene	1395679	1396548	0.67	+	.	g303
Scaffold_9	AUGUSTUS	transcript	1395679	1396548	0.67	+	.	g303.t1
Scaffold_9	AUGUSTUS	start_codon	1395679	1395681	.	+	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_9	AUGUSTUS	CDS	1395679	1396548	0.67	+	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_9	AUGUSTUS	stop_codon	1396546	1396548	.	+	0	transcript_id "g303.t1"; gene_id "g303";
# protein sequence = [MSRMWEGQDRVVGDGTEWTVSEDWEAVTGLVNDVFGVSVGEGVLRDAEATDWTTLSKRFITEPVFAEVVEALRVLEGP
# AEDKATQKAKHKAARYMVEDNRLWKVGGNEGIRERARVECVTRKEAVELAKVQHGKAGHWGRDSVKLALMDRIWSPKLDESVMEAITSYPECKNFRAA
# HIHALLNPVTRCHPFELLVGDYLSMSKGKGGYKTVGLYLDTYSQRVWAFKFKVAGSGVTTTSSLTSLFNGYLPPETFMTDNGSHFANKEVEVLCAKWG
# TKQHSLRCIHPGSTA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g303
###
# start gene g304
Scaffold_9	AUGUSTUS	gene	1396751	1397146	0.51	+	.	g304
Scaffold_9	AUGUSTUS	transcript	1396751	1397146	0.51	+	.	g304.t1
Scaffold_9	AUGUSTUS	start_codon	1396751	1396753	.	+	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_9	AUGUSTUS	CDS	1396751	1397146	0.51	+	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_9	AUGUSTUS	stop_codon	1397144	1397146	.	+	0	transcript_id "g304.t1"; gene_id "g304";
# protein sequence = [MVNTRRTPVANATSVLPQKQVKIQTAYVAQQQLDGYGAFIQHAIKRKNVFDRRVLKREGKEVVFEKGDLVQVYRSDLD
# YTFKTIKKIIPKWSRPYRVAERTSTFTRCGQLMDNLLKVNNLQHDGYAGSNLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g304
###
# start gene g305
Scaffold_9	AUGUSTUS	gene	1409023	1410126	0.67	-	.	g305
Scaffold_9	AUGUSTUS	transcript	1409023	1410126	0.67	-	.	g305.t1
Scaffold_9	AUGUSTUS	stop_codon	1409023	1409025	.	-	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_9	AUGUSTUS	CDS	1409023	1410126	0.67	-	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_9	AUGUSTUS	start_codon	1410124	1410126	.	-	0	transcript_id "g305.t1"; gene_id "g305";
# protein sequence = [MLERSRQCSLVVEYHTERPDNRVLSLLAEHSVRWEDASFCIPRSSYSGFSSIKGRLPILRRLVLQATGDPFETYQKLS
# LSGFEIAPVLRLLVLHHDLVHDLSVSWARLTHLCCHSTELSSLHSLLANTPTLSKLHVSQIHHDSSHNPSKFDILTQLKELSVTDCDLLVIHSLLERF
# SDLVELSILIFSDPGDAGTNMPINLPHLYTLKIQINGVFPGLVDFLKFKAPNLSKMEFYGYHPLEESDDEWDDRLEDSIHIGRSFLQFLRSFIQGSGC
# NLTFLTLDLEVDFQAHEMVPLLGTLSSLEYLDISAVHMGCVPFHAMTPASVIFPKLQTLYLHIRPEEYSIDDLNDLITLATSNNVLKVRLLAM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g305
###
# start gene g306
Scaffold_9	AUGUSTUS	gene	1412097	1413281	0.4	-	.	g306
Scaffold_9	AUGUSTUS	transcript	1412097	1413281	0.4	-	.	g306.t1
Scaffold_9	AUGUSTUS	stop_codon	1412097	1412099	.	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_9	AUGUSTUS	CDS	1412097	1412564	0.81	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_9	AUGUSTUS	CDS	1412617	1413045	0.91	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_9	AUGUSTUS	CDS	1413126	1413281	0.54	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_9	AUGUSTUS	start_codon	1413279	1413281	.	-	0	transcript_id "g306.t1"; gene_id "g306";
# protein sequence = [MLHQVLESLGDDGQRIRSRTNTRLKEGSLKYLEQKKKEEQDRIGPVDDKRWKFYDVAFANDFMSYQSADQFLVAQYEK
# GIGEGPDASLPLSLSPGDINSRWNRRVITHFIEALSSLRDATPHRWYLPNVSDLYLRALFLNQVREAQKAWSTAQPKTRYFEDGTLREETMEEVKERI
# HVARPKRLQTVSARSFRARKFLRRLETAKEYAKQHGDVGLVWKKLVEILELLGVDGQSDEEEAVRYTPSGKRVYVIEILLCSWRAADITRYMILIDEV
# YEKGKASSSNKRGSKGQTRERVRRESGRNATPKLPRAFYDSQWLEAQDECYIEDVLRISSADFRLLEPLLQTEFSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g306
###
# start gene g307
Scaffold_9	AUGUSTUS	gene	1422924	1424380	0.3	-	.	g307
Scaffold_9	AUGUSTUS	transcript	1422924	1424380	0.3	-	.	g307.t1
Scaffold_9	AUGUSTUS	stop_codon	1422924	1422926	.	-	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_9	AUGUSTUS	CDS	1422924	1423658	0.37	-	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_9	AUGUSTUS	CDS	1423805	1424380	0.3	-	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_9	AUGUSTUS	start_codon	1424378	1424380	.	-	0	transcript_id "g307.t1"; gene_id "g307";
# protein sequence = [MDIKALHQAIILALPKDPSSVVGLELAKDPSNECWSLGSDGLLRLDDRIYVLNHRDLCLQVLRYFHDHPLSGHFGQNC
# TLEAVRRQYTWPKVRDFVHDYVTSCTTCGRNKPWHHRPYGLLKPLPVPVRPWDSISMDFIEQLPMLNGYTAILVMVDGSSKQAIFIPTFDTITSEQLA
# KLFIIHVFSKHGVPNHYIRNLLLLPTRYWLPLLPIAEFAYNNTPNASTGITPFFANKGYHPNITIRPEVDMKSDLARDFVVNLDELHVFLREEILLAQ
# SHYKEQADRKRISHPEFPIGSEVFVLAKHIRSTCPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRWTHPVFHVLQLEPVTPNPFLNRTQSPPPPIE
# VDGEEEYNVAEFLDSKLDRWYKCCPLRYYIRWLVTKVPTMNSLGLLLMNYMLTNWYPHSMLDTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g307
###
# start gene g308
Scaffold_9	AUGUSTUS	gene	1425763	1426269	0.45	-	.	g308
Scaffold_9	AUGUSTUS	transcript	1425763	1426269	0.45	-	.	g308.t1
Scaffold_9	AUGUSTUS	stop_codon	1425763	1425765	.	-	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_9	AUGUSTUS	CDS	1425763	1426269	0.45	-	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_9	AUGUSTUS	start_codon	1426267	1426269	.	-	0	transcript_id "g308.t1"; gene_id "g308";
# protein sequence = [MVMPFGLTNAPAAFQCFVNDIFSDMLDVCVIVYLGDILIYSDTPEEYREHVKEVLQHLQKHWLYANPDKCEFNMNTVE
# YLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFWVLQTSIVVLFIIIVILFVPMTRLTRKGTPWIWDNDCQEAFENLKIAFTSAPIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g308
###
# start gene g309
Scaffold_9	AUGUSTUS	gene	1432847	1433344	0.83	+	.	g309
Scaffold_9	AUGUSTUS	transcript	1432847	1433344	0.83	+	.	g309.t1
Scaffold_9	AUGUSTUS	start_codon	1432847	1432849	.	+	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_9	AUGUSTUS	CDS	1432847	1433344	0.83	+	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_9	AUGUSTUS	stop_codon	1433342	1433344	.	+	0	transcript_id "g309.t1"; gene_id "g309";
# protein sequence = [MVTSLHPDHAPHLHHNDQVRQAPKETEDGKNHHSHRVRAVHQRDPNECTPIDANQETAGSLADKRDKSDDCMHDFLHN
# DEGKADIIAVQEPYIDWKGATRALSHLHTIYPTGHLDNFTEMPTRSLIFINSSIPTEDWARLDIENGDVTAVQITGSFGMLCIFNIQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g309
###
# start gene g310
Scaffold_9	AUGUSTUS	gene	1433562	1434722	0.96	+	.	g310
Scaffold_9	AUGUSTUS	transcript	1433562	1434722	0.96	+	.	g310.t1
Scaffold_9	AUGUSTUS	start_codon	1433562	1433564	.	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_9	AUGUSTUS	CDS	1433562	1434722	0.96	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_9	AUGUSTUS	stop_codon	1434720	1434722	.	+	0	transcript_id "g310.t1"; gene_id "g310";
# protein sequence = [MALPSGLPTLRSFSTGNYTRVDNVFCSKELTDRVIICRTTPERQPIKTNHFPIVTVLDLQNRVVEKREQWNWVQVDWE
# DFRETLKEEVQILGDPGELETEAQFWEALTAFDRVVEKVVKEKVPQARPSPHQRRWWNSELDTLRHHRNALSAQSYKNRFDPENEIHEEYRRVRQTFS
# AEMRKAKLEKWAEYLEYADSGSMWDVGKLVEKGHTDGGRMRVPGLTAGRQTINDNVGKDYIFRDAFFPPPPTTTANAPTSSPYPPPAWKFEPPTNRLI
# TSAIRRMKNGKATRPGTIPNDLFKATADLIVPYLGPIYHATFTLQIYPPDWSNTETIVLKKPARTDYRLPGAWQPIVLSNGHGRLLNSCMADEIVKQA
# ELLGLLPAMQFGAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g310
###
# start gene g311
Scaffold_9	AUGUSTUS	gene	1449957	1450376	0.69	-	.	g311
Scaffold_9	AUGUSTUS	transcript	1449957	1450376	0.69	-	.	g311.t1
Scaffold_9	AUGUSTUS	stop_codon	1449957	1449959	.	-	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_9	AUGUSTUS	CDS	1449957	1450376	0.69	-	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_9	AUGUSTUS	start_codon	1450374	1450376	.	-	0	transcript_id "g311.t1"; gene_id "g311";
# protein sequence = [MLQCKLLIPNPTLRPILTQVLQNKENLPLVSNQRNRTAEAKYAREQISDRDLTRLKLGGWLNDEIINFYRALIMGCME
# KLPNTSGSNRGLLSEQSVNPTSVSKAYVNIPIPSILSEIGTQLPRCRYEVISTDSVLHTLC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g311
###
# start gene g312
Scaffold_9	AUGUSTUS	gene	1455284	1455676	0.84	+	.	g312
Scaffold_9	AUGUSTUS	transcript	1455284	1455676	0.84	+	.	g312.t1
Scaffold_9	AUGUSTUS	start_codon	1455284	1455286	.	+	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_9	AUGUSTUS	CDS	1455284	1455676	0.84	+	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_9	AUGUSTUS	stop_codon	1455674	1455676	.	+	0	transcript_id "g312.t1"; gene_id "g312";
# protein sequence = [MKARSEIKNLKQGKGQTVAEFTQKFKHIGDWTGMSDIDLWEHFFTALLPGIRQNLIIVNIAQGLAPTLKEAIKRAISV
# DVYMHDPTMTGRNSGHAPTHTGHTTPADPHAMDIDATHTSNGNTRQAFLAHM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g312
###
# start gene g313
Scaffold_9	AUGUSTUS	gene	1466443	1466805	0.37	-	.	g313
Scaffold_9	AUGUSTUS	transcript	1466443	1466805	0.37	-	.	g313.t1
Scaffold_9	AUGUSTUS	stop_codon	1466443	1466445	.	-	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_9	AUGUSTUS	CDS	1466443	1466805	0.37	-	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_9	AUGUSTUS	start_codon	1466803	1466805	.	-	0	transcript_id "g313.t1"; gene_id "g313";
# protein sequence = [MEIKKAKVEKWVEYLEYADTSSVWEIGRLMENGYTDGGRARVPGLKVNQPGTTEHIIEDNVGKKYVFRDAFFPPPPQS
# PNVPGRGLPKPVLDLHTTHQPTDHGHNPAYEKRKSHKIRDHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g313
###
# start gene g314
Scaffold_9	AUGUSTUS	gene	1468765	1469682	1	-	.	g314
Scaffold_9	AUGUSTUS	transcript	1468765	1469682	1	-	.	g314.t1
Scaffold_9	AUGUSTUS	stop_codon	1468765	1468767	.	-	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_9	AUGUSTUS	CDS	1468765	1469682	1	-	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_9	AUGUSTUS	start_codon	1469680	1469682	.	-	0	transcript_id "g314.t1"; gene_id "g314";
# protein sequence = [MSRNSLNTPKEPPPGQPRLKFPAAQPTRTVPASPANASTNGDDEHRSLMAKAVAMNLMLPGEDHTIALPTKLIQLAAG
# AKDGKPKANIWEKVGLIGKILQECSYKDRMRKFRDEIMEKIEEKFDDETCRLEGRVKAMRKEVEDASNASTRLKDKVEKLVRDADARGTTSWAGLMEL
# EAGEIEGTSTAQLSYASAAQAKSVAQHIQQPRHNPAIRDAELKDRRIIIRSEADSDWKLMEKEIVVKANLAMEKMLQDEDEGTEMKVLAATKLRGNGA
# FLLMRSAAEAEAMKMGERMARFCDAWDQRPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g314
###
# start gene g315
Scaffold_9	AUGUSTUS	gene	1474608	1475489	0.98	+	.	g315
Scaffold_9	AUGUSTUS	transcript	1474608	1475489	0.98	+	.	g315.t1
Scaffold_9	AUGUSTUS	start_codon	1474608	1474610	.	+	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_9	AUGUSTUS	CDS	1474608	1475489	0.98	+	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_9	AUGUSTUS	stop_codon	1475487	1475489	.	+	0	transcript_id "g315.t1"; gene_id "g315";
# protein sequence = [MDIEALHQAIILALPADLSSVAGLELAKDPSNERCSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLE
# AVRRQYTWPKVRDFVRDYVTSCTICGRNKPRCHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAHPE
# FPIGSEVFVLAKHIRSTHPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRQIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYTRCRNPRLQ
# AGQKVQTLSSTLLHSVGRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g315
###
# start gene g316
Scaffold_9	AUGUSTUS	gene	1482910	1483431	0.99	-	.	g316
Scaffold_9	AUGUSTUS	transcript	1482910	1483431	0.99	-	.	g316.t1
Scaffold_9	AUGUSTUS	stop_codon	1482910	1482912	.	-	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_9	AUGUSTUS	CDS	1482910	1483431	0.99	-	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_9	AUGUSTUS	start_codon	1483429	1483431	.	-	0	transcript_id "g316.t1"; gene_id "g316";
# protein sequence = [MTQTQKSNQAASSTVIMVAADQCLMSIPEQSFGDEPASNVRTPEGCQPAVQEPLLWTLGWDYHNGGIPPWVMPNLPVV
# PWEVLPIPLPGEQGTSPWTSTAARYGSASNAGGRVSGQVAIIERVQGENADPLTGLQQEKLPERRVSPAASEQSQASSRRLPTPPVQSLNPPPPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g316
###
# start gene g317
Scaffold_9	AUGUSTUS	gene	1487418	1488584	0.83	+	.	g317
Scaffold_9	AUGUSTUS	transcript	1487418	1488584	0.83	+	.	g317.t1
Scaffold_9	AUGUSTUS	start_codon	1487418	1487420	.	+	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_9	AUGUSTUS	CDS	1487418	1488584	0.83	+	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_9	AUGUSTUS	stop_codon	1488582	1488584	.	+	0	transcript_id "g317.t1"; gene_id "g317";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g317
###
# start gene g318
Scaffold_9	AUGUSTUS	gene	1488954	1490213	0.56	+	.	g318
Scaffold_9	AUGUSTUS	transcript	1488954	1490213	0.56	+	.	g318.t1
Scaffold_9	AUGUSTUS	start_codon	1488954	1488956	.	+	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_9	AUGUSTUS	CDS	1488954	1490213	0.56	+	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_9	AUGUSTUS	stop_codon	1490211	1490213	.	+	0	transcript_id "g318.t1"; gene_id "g318";
# protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP
# HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP
# AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL
# QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL
# EKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRLASPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g318
###
# start gene g319
Scaffold_9	AUGUSTUS	gene	1490564	1491526	0.42	+	.	g319
Scaffold_9	AUGUSTUS	transcript	1490564	1491526	0.42	+	.	g319.t1
Scaffold_9	AUGUSTUS	start_codon	1490564	1490566	.	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_9	AUGUSTUS	CDS	1490564	1491526	0.42	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_9	AUGUSTUS	stop_codon	1491524	1491526	.	+	0	transcript_id "g319.t1"; gene_id "g319";
# protein sequence = [MLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVH
# HVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHD
# HPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAFLA
# PAPSQPKALPIFTTERSSVSMVFLFTLNPTADPSLQLNSCDPFSLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g319
###
# start gene g320
Scaffold_9	AUGUSTUS	gene	1496529	1497035	0.55	-	.	g320
Scaffold_9	AUGUSTUS	transcript	1496529	1497035	0.55	-	.	g320.t1
Scaffold_9	AUGUSTUS	stop_codon	1496529	1496531	.	-	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_9	AUGUSTUS	CDS	1496529	1497035	0.55	-	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_9	AUGUSTUS	start_codon	1497033	1497035	.	-	0	transcript_id "g320.t1"; gene_id "g320";
# protein sequence = [MDDILIFMDNIEGHRVIVRKVLDILKANKLYLKPEKCTFEAREVKYLGIIVGNGQIQMDPEKVEAVRTWQPPEKKREL
# QSFLGFCNFFHRFIQDFSKIAKPLTRLTGHTAWEWTSLEQDVFDRLKDRLIEDVTLIIPREAGKFWVETDSSDYANGAVLSQTLMESGDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g320
###
# start gene g321
Scaffold_9	AUGUSTUS	gene	1497278	1498642	0.95	-	.	g321
Scaffold_9	AUGUSTUS	transcript	1497278	1498642	0.95	-	.	g321.t1
Scaffold_9	AUGUSTUS	stop_codon	1497278	1497280	.	-	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_9	AUGUSTUS	CDS	1497278	1498642	0.95	-	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_9	AUGUSTUS	start_codon	1498640	1498642	.	-	0	transcript_id "g321.t1"; gene_id "g321";
# protein sequence = [MFPLWQARPHCEVLSRESTEAAVCQKHVEPDDTGGSGGHGQRIGFCPAPAVDAGLPRPISESVSDFSSSSYVDSQFSF
# EFGSTGTSNKNNLSTMTTQTEEKPVRYEPNTPEWVAQQLQMDKLPMAIGILRAWMPEDRVREASEETALAIQNLSHATTTEAVTNLKSRKRFVQGTRG
# RELKLRTTIENIDNSVQIEMEALLDSGATGSCINKDFVEQHQLTVKELPVKMPVYNTNGTLNKNGSIEGYVQVQMVIGDHAEQIDMAVTNLGKTDIFL
# GIDWLCYHNPSIDWKESTLTFECCPDKCGYLLHYESPEDDGTEEKLVNGERIFWFDWDRYLSDQGHIKVQTTTTDAAAPYLAEYADVFSKKDFDQMPE
# RRPWDHAIELTPGSKPVDCKVYPLSPPEQKALDEFLEENLRSGQIRPSHSPMASPFFFVKRKDGTLRSVQDYRKLNDMTVKN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g321
###
# start gene g322
Scaffold_9	AUGUSTUS	gene	1500415	1500993	0.49	+	.	g322
Scaffold_9	AUGUSTUS	transcript	1500415	1500993	0.49	+	.	g322.t1
Scaffold_9	AUGUSTUS	start_codon	1500415	1500417	.	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_9	AUGUSTUS	CDS	1500415	1500993	0.49	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_9	AUGUSTUS	stop_codon	1500991	1500993	.	+	0	transcript_id "g322.t1"; gene_id "g322";
# protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI
# GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILLSKLPSRYL
# SLSKPCLSLKLQSSRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g322
###
# start gene g323
Scaffold_9	AUGUSTUS	gene	1501020	1502490	0.49	+	.	g323
Scaffold_9	AUGUSTUS	transcript	1501020	1502490	0.49	+	.	g323.t1
Scaffold_9	AUGUSTUS	start_codon	1501020	1501022	.	+	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_9	AUGUSTUS	CDS	1501020	1501724	0.51	+	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_9	AUGUSTUS	CDS	1501780	1502490	0.65	+	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_9	AUGUSTUS	stop_codon	1502488	1502490	.	+	0	transcript_id "g323.t1"; gene_id "g323";
# protein sequence = [MNAFSGDTIGNSQPQNANKFSNVHRKGTIPSSPNSSMVTIVQQQKGQNGNDDNKKKRKRGSGKNKKAKKNANAAQADA
# DSMDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPPNATSLHLHKKTRMAIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPPTKRTRA
# MSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSWRRHASRPFEPDLLSRLYNYRIDAKYISNEHFCVHDVSY
# SVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLIHFKDVKGRMHLARIAPVFYMKELSHRLIAQGRFLQ
# DGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSCEALTQLRKHAEGFPPSAFPMRKISVKVVPRE
# R]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g323
###
# start gene g324
Scaffold_9	AUGUSTUS	gene	1503644	1505211	0.43	+	.	g324
Scaffold_9	AUGUSTUS	transcript	1503644	1505211	0.43	+	.	g324.t1
Scaffold_9	AUGUSTUS	start_codon	1503644	1503646	.	+	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_9	AUGUSTUS	CDS	1503644	1503950	0.43	+	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_9	AUGUSTUS	CDS	1504022	1505211	0.98	+	2	transcript_id "g324.t1"; gene_id "g324";
Scaffold_9	AUGUSTUS	stop_codon	1505209	1505211	.	+	0	transcript_id "g324.t1"; gene_id "g324";
# protein sequence = [MPCSLLRTRVFDEKLFPRCKSSERHRSTRLPDRNPDPKDPIPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPA
# RDPSPPPQPRNEQPPAQEQLRRSGRRETKEGYSETRHHSQVAPRLSKNPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMA
# KAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVF
# SPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYMKTLGFKRLSSDAGIF
# VRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGKFMSHWECRDLGEAKDSFACGLIVVAKRSILTNAPTLTKSLSVAVWKMLKWLIHHFLQGSNLNP
# PKANRIPLFVASSKWLLVPSLPYVGHTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g324
###
# start gene g325
Scaffold_9	AUGUSTUS	gene	1519319	1520705	0.27	-	.	g325
Scaffold_9	AUGUSTUS	transcript	1519319	1520705	0.27	-	.	g325.t1
Scaffold_9	AUGUSTUS	stop_codon	1519319	1519321	.	-	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_9	AUGUSTUS	CDS	1519319	1519710	0.95	-	2	transcript_id "g325.t1"; gene_id "g325";
Scaffold_9	AUGUSTUS	CDS	1519787	1520058	0.96	-	1	transcript_id "g325.t1"; gene_id "g325";
Scaffold_9	AUGUSTUS	CDS	1520140	1520705	0.29	-	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_9	AUGUSTUS	start_codon	1520703	1520705	.	-	0	transcript_id "g325.t1"; gene_id "g325";
# protein sequence = [MPTFMSSTASLVTGAVGAVTGSSPRSPAASSPSLPRATSSTSPQRQPQSKTPRQHTHSPAPLSPSVLSKLAQEFAQKV
# PDEEFSVAALQGYLLRNKSRPEEAVKGVEAWVEEERRNKEKQKGGKGKGKGSEEERKKRREQRERRGSAQSNPVSAAVSVNTNQPSDPPSASPRLYDP
# HASLNLIQYLHLLTKKIKSKSKSKSRKSKSASKSDDNDGSDSDSSSSSSTDSESSSNSDSDSDSSSDSSSDDDDENTDPRPRTEHDFYGEVSTIASYT
# VIRLVCRIENAERKGNHQDQSMLTPSHNESVAMDANSQDGDEETRCSNWKSPGEISDLISTEDKPPLVDGHSEYELLSPNAIDRSQVRNLASFTSSAY
# ALQMMLQARIYAVAVYSCLLHLYASILLWFSGSIFLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g325
###
# start gene g326
Scaffold_9	AUGUSTUS	gene	1523460	1523951	0.94	+	.	g326
Scaffold_9	AUGUSTUS	transcript	1523460	1523951	0.94	+	.	g326.t1
Scaffold_9	AUGUSTUS	start_codon	1523460	1523462	.	+	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_9	AUGUSTUS	CDS	1523460	1523951	0.94	+	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_9	AUGUSTUS	stop_codon	1523949	1523951	.	+	0	transcript_id "g326.t1"; gene_id "g326";
# protein sequence = [MQSTLQSSDPEDASARELIANLLPVSGDVENDVEAAVVRNEILVVDGSDRAAVDVDDEDDDAAVDGSNRVAVYVGDED
# DRAAVDVDDEDDDAAVDGSNRMAVDDDDKAMVNVKASNTDDDDRQNKKEEVCCNGTVPQQLPTLTKPCSSSLSTAGSTIVTRTPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g326
###
# start gene g327
Scaffold_9	AUGUSTUS	gene	1531589	1532194	1	+	.	g327
Scaffold_9	AUGUSTUS	transcript	1531589	1532194	1	+	.	g327.t1
Scaffold_9	AUGUSTUS	start_codon	1531589	1531591	.	+	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_9	AUGUSTUS	CDS	1531589	1532194	1	+	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_9	AUGUSTUS	stop_codon	1532192	1532194	.	+	0	transcript_id "g327.t1"; gene_id "g327";
# protein sequence = [MKFVYGFLCLPLVAVIVIGAPLLKTREVVPVVQEAAADISLDQDYGIFYTGPGCPPSKPCQLTSAHLEDDLDIFSLDE
# NGVPSATAPVRSNSEFGNDNIAPNTDLAIPLSSDLIIHSRDAAKLQKAGDTMDKAGSVLGKVAKGADAIPEVGEIIGTAIQVVASFLKFLGHIFGAIA
# EAERESAHVSLFSPSFAYPNDSFIV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g327
###
# start gene g328
Scaffold_9	AUGUSTUS	gene	1535666	1536136	0.93	-	.	g328
Scaffold_9	AUGUSTUS	transcript	1535666	1536136	0.93	-	.	g328.t1
Scaffold_9	AUGUSTUS	stop_codon	1535666	1535668	.	-	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_9	AUGUSTUS	CDS	1535666	1536136	0.93	-	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_9	AUGUSTUS	start_codon	1536134	1536136	.	-	0	transcript_id "g328.t1"; gene_id "g328";
# protein sequence = [MPKLFASTSMIVLGCAYNAPSNAQNGTFVSCQGDDMTPVGQYVSNGVTTTWTQPAETVSITGVPYTPTPAASSNCVTY
# TSASLYTDLASVGVTGSPAGASATASASGSASGSSKAAATKSSADSSTTGTSNSAGAAMGISLVSAFAGVTLSTFMFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g328
###
# start gene g329
Scaffold_9	AUGUSTUS	gene	1545683	1547517	0.51	-	.	g329
Scaffold_9	AUGUSTUS	transcript	1545683	1547517	0.51	-	.	g329.t1
Scaffold_9	AUGUSTUS	stop_codon	1545683	1545685	.	-	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_9	AUGUSTUS	CDS	1545683	1546919	0.93	-	1	transcript_id "g329.t1"; gene_id "g329";
Scaffold_9	AUGUSTUS	CDS	1546970	1547127	0.64	-	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_9	AUGUSTUS	CDS	1547227	1547517	0.55	-	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_9	AUGUSTUS	start_codon	1547515	1547517	.	-	0	transcript_id "g329.t1"; gene_id "g329";
# protein sequence = [MVTNETYRYVTDARFHPSGEKIIATKWYTSERSLGAGEGWEYTVPSTYTNTVKAGSGKRVVGRTLPRGWTVSQYGDQQ
# VGPEQFIWNGEDSIIYSMNGIYALFSFNLTTGKTETLVGASPGGASRPELSHDRRTLAFVRRVRDHEVLVLKDLETGSISYAWDGLTFDLTTISAPMG
# TYPSFSFTPHSEGIIIWAAGKIHHVPLTVNKQGERIRSGSVSRIEFTAHIEKHVAETLRLKNAVDLVGIETHDTQRVHAFRDLRVDEAGSKVVFRAGN
# IPIVQIVGESDYIKVPTLYYDNGRTPYYSPSFIPSTDGNLIIMSRWSDLHFTSFEVSDLSKGISYEIEGLPMGRYRSAVICRCNGWKRTIAFLKTGGD
# YLTGDVIATAGAGLYLGDINLEPSPSQKLVINSIRMVPSDIDPKNAKLEFVEKNKKLLVQQPDRVFIVDLVGGPVDIEGKPSHFTIATGKMSTEIALA
# PRPRSAVDRFLHGEESQYDTDHVAFVDFFHVYVAPRKSIKQGEDVWSKPGSATAGIARLSLDGGHDIAWSSDGKNYSGSLVRYRTFDVVFQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g329
###
# start gene g330
Scaffold_9	AUGUSTUS	gene	1547561	1548247	0.55	-	.	g330
Scaffold_9	AUGUSTUS	transcript	1547561	1548247	0.55	-	.	g330.t1
Scaffold_9	AUGUSTUS	stop_codon	1547561	1547563	.	-	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_9	AUGUSTUS	CDS	1547561	1548247	0.55	-	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_9	AUGUSTUS	start_codon	1548245	1548247	.	-	0	transcript_id "g330.t1"; gene_id "g330";
# protein sequence = [MKGKVDIDTYHSVYDTRKKRRTFNILTSLVLVIVAATFSSLLPSSLHYWHLLSGHQIIIDEWKDDIWPIREQTPWDIT
# TDFPHPRVLEYKVNEGTWLRLDVHPTTGDIVFDMIGDLYCIEGHNALHGTINIAHPITLGVPYDSDPHFSPSGDKLVFRSDAGLGVDNIWIMNWLGCS
# QMNLRPSDIVSPTLQVALLSKTKDETLLRRRVPETADRRQNRLLREGRAGGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g330
###
# start gene g331
Scaffold_9	AUGUSTUS	gene	1548836	1549072	0.16	-	.	g331
Scaffold_9	AUGUSTUS	transcript	1548836	1549072	0.16	-	.	g331.t1
Scaffold_9	AUGUSTUS	stop_codon	1548836	1548838	.	-	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_9	AUGUSTUS	CDS	1548836	1549072	0.16	-	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_9	AUGUSTUS	start_codon	1549070	1549072	.	-	0	transcript_id "g331.t1"; gene_id "g331";
# protein sequence = [MEMEQADEPQSLLEWFAEKYKDFGANLEFVTNRSQEGAQFVKGFGGIGGLLRYKVDFSNLTSIDEEEEDEFYSDDEDI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g331
###
# start gene g332
Scaffold_9	AUGUSTUS	gene	1555126	1555932	0.28	-	.	g332
Scaffold_9	AUGUSTUS	transcript	1555126	1555932	0.28	-	.	g332.t1
Scaffold_9	AUGUSTUS	stop_codon	1555126	1555128	.	-	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_9	AUGUSTUS	CDS	1555126	1555932	0.28	-	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_9	AUGUSTUS	start_codon	1555930	1555932	.	-	0	transcript_id "g332.t1"; gene_id "g332";
# protein sequence = [MKKISKGKVAQVQHKEMLKRRSVFAPLPVPELVPESVSEMDHYFASPITPQVSTILFIPLAPTPNQRVPLPYDVPDHV
# TLLPFPTLASIHNSHELHSLRVSALFSRLDVAKVWEKGVLSSAYSKHGGEEGVCTILKIEFVGWTMAEVRSVIGESGTGWCALEEVVTEMQPEEEEDS
# FSDASSVLSAISGGESMSLSSTHEPAKSLVLPTLDFSSSSVHLPMSRTYANHDMFLETQSDPWADSSSDDSWVDHSHLEFSSDFVSRLHMDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g332
###
# start gene g333
Scaffold_9	AUGUSTUS	gene	1557581	1558111	0.68	+	.	g333
Scaffold_9	AUGUSTUS	transcript	1557581	1558111	0.68	+	.	g333.t1
Scaffold_9	AUGUSTUS	start_codon	1557581	1557583	.	+	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_9	AUGUSTUS	CDS	1557581	1558111	0.68	+	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_9	AUGUSTUS	stop_codon	1558109	1558111	.	+	0	transcript_id "g333.t1"; gene_id "g333";
# protein sequence = [MDLDSPDSDSQPSSAGIPEFEPFTSLLPGCPLPSPLMPDDSPDSMVNDEDGIRISPHTTSSQPLTAAKAVQSIDDSLQ
# AQPPSSIPSSPFKSILPNYSDVRSRDLKEVSRTSPIYNPFVSAGFVTEFTGETLATTQLEHIKEALSNLPDSAKVCYWHFEQSFGLFYVIILIACGCL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g333
###
# start gene g334
Scaffold_9	AUGUSTUS	gene	1558447	1559154	0.69	+	.	g334
Scaffold_9	AUGUSTUS	transcript	1558447	1559154	0.69	+	.	g334.t1
Scaffold_9	AUGUSTUS	start_codon	1558447	1558449	.	+	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_9	AUGUSTUS	CDS	1558447	1559154	0.69	+	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_9	AUGUSTUS	stop_codon	1559152	1559154	.	+	0	transcript_id "g334.t1"; gene_id "g334";
# protein sequence = [MEAHCGSREVNEKETKVRYSTTFSGISLPILSMQFIKSEAAPLFVQHKTIPTGPRNAVASSSKVMLEHAKSIPNAPRA
# PRSLRNKVDEPAPTANSLAILSSGPYTNPLSIKPSTLVPASSAPSGPKTLAGVQTKKRVLIGIGTPMSKATSEIYSNHPAAFRPQLVPKMPNLVAYSS
# PSPPPAIPVPPDSAPPVDSPKPPPPPPVQIKWKRLPSIDTTSPSVSSKGKIPSTVSCIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g334
###
# start gene g335
Scaffold_9	AUGUSTUS	gene	1564680	1565637	0.55	+	.	g335
Scaffold_9	AUGUSTUS	transcript	1564680	1565637	0.55	+	.	g335.t1
Scaffold_9	AUGUSTUS	start_codon	1564680	1564682	.	+	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_9	AUGUSTUS	CDS	1564680	1564793	0.95	+	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_9	AUGUSTUS	CDS	1564897	1565029	0.58	+	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_9	AUGUSTUS	CDS	1565147	1565637	1	+	2	transcript_id "g335.t1"; gene_id "g335";
Scaffold_9	AUGUSTUS	stop_codon	1565635	1565637	.	+	0	transcript_id "g335.t1"; gene_id "g335";
# protein sequence = [MAHQGYGFCEFLTEEDAEYACKIMNQIKLWGKPIRVNKASSDKKQLDVGANLFIGNLDENVDERLLYDTFSAFGMLAT
# TAKVYAAVESMNGQFLMNKAITVQYAFKKDGKGERHGTQAERLLAAQARKNNALPVSARPPPAAMPFGAPPMAGYQGPYQGQFAGALAQPPPPPGFTP
# QQTIMPPMQMQMPMAPPGMQMQMPGMAPMGPPQGMPMYGAFAPPPPPPGFAVQQYPGQIPVPPPPQPQF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g335
###
# start gene g336
Scaffold_9	AUGUSTUS	gene	1571862	1572818	0.23	-	.	g336
Scaffold_9	AUGUSTUS	transcript	1571862	1572818	0.23	-	.	g336.t1
Scaffold_9	AUGUSTUS	stop_codon	1571862	1571864	.	-	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_9	AUGUSTUS	CDS	1571862	1572818	0.23	-	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_9	AUGUSTUS	start_codon	1572816	1572818	.	-	0	transcript_id "g336.t1"; gene_id "g336";
# protein sequence = [MQGLPEVPKFDWASFKPQRDAYIRKLNGIYHNNFDKEGVEYHQGYGRLKTPKSVEVTLADGQKYTLEADNICIATGGY
# PTIPSEKEIPGASLGITSDGFFDLEEQPKRVAVVGAGYIAVELAGVFNALGSETHLIIRGETVLRTFDPTLQQVLTPWMEHTGVKIQKSSKVVKVEGE
# KGKTLTVTLDSGKNIEVDCVLWAIGRHAATQDMGLEKHGVKLDEKGNVVVDEYQNSSVKGITAIGDVQGKALLTPVAIAAGRRLANRLFGPEKFKDDK
# LNYENIPTVVFSYVFIPSYPQSHLFSDIASSYHRDCRFDRASSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g336
###
# start gene g337
Scaffold_9	AUGUSTUS	gene	1576819	1577220	0.99	+	.	g337
Scaffold_9	AUGUSTUS	transcript	1576819	1577220	0.99	+	.	g337.t1
Scaffold_9	AUGUSTUS	start_codon	1576819	1576821	.	+	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_9	AUGUSTUS	CDS	1576819	1577220	0.99	+	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_9	AUGUSTUS	stop_codon	1577218	1577220	.	+	0	transcript_id "g337.t1"; gene_id "g337";
# protein sequence = [MVHSRSVLKAVIAVGAASSALAVPLPSASATPGGAPAASATGLTQATAVGSDAVPPVTGIPPTPQTAAGSSLPPAPAL
# GGPSPQAKALNAREFNIIFEEDEKPHKVSPIYVPIAFSPIFLNNNNIRLTASPPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g337
###
# start gene g338
Scaffold_9	AUGUSTUS	gene	1578177	1578692	0.97	+	.	g338
Scaffold_9	AUGUSTUS	transcript	1578177	1578692	0.97	+	.	g338.t1
Scaffold_9	AUGUSTUS	start_codon	1578177	1578179	.	+	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_9	AUGUSTUS	CDS	1578177	1578692	0.97	+	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_9	AUGUSTUS	stop_codon	1578690	1578692	.	+	0	transcript_id "g338.t1"; gene_id "g338";
# protein sequence = [MGRRGDDDNTTAGTPAPTKEGSKEGGKEGGKEGGKEGGEKPKGEEKHEGHHDHDHSHNHHHNHQHDHQHQHQHQAGQG
# SQKNKEEDKKEGGQGASADGTPGVKSTSPPPATDATGATTPGSTTPGSTTTGSASGSSSGTSSGAPGTPASAARRSLTRARRSTPFPYGVDLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g338
###
# start gene g339
Scaffold_9	AUGUSTUS	gene	1581078	1583240	1	-	.	g339
Scaffold_9	AUGUSTUS	transcript	1581078	1583240	1	-	.	g339.t1
Scaffold_9	AUGUSTUS	stop_codon	1581078	1581080	.	-	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_9	AUGUSTUS	CDS	1581078	1583240	1	-	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_9	AUGUSTUS	start_codon	1583238	1583240	.	-	0	transcript_id "g339.t1"; gene_id "g339";
# protein sequence = [MPPSSASDALINSPAAPRGALFRNSDKTSQIEDMSSDVRIWKLLNPNDAALHLRIEPPTFLTFRPNTGNHHPNSAGEH
# KSPRSLARTLRSIFWLLKIMVLPIAATTFLLWLLCLYLLKDAELLDAQQNRAEAQSSPSNDDSTALEQHVSFSTLPRAFSSDVELIATSSDGRVAVSV
# GLHNEVVIWRTDSSRYFSIDTSDIILQSPTSPSFRSTLTTVAMNDSGDYCAVGTGAGVIAVWDIRNDAIRPLSHLSLPDSSAGVVEMWFVPNTARFGR
# NSNTSNPTSPVLAPSLPSQSIQLVATFEDGAVAKYAVQDLSGLTYVQPSRSDSVVRSKLVRVKPENKLIVVFCLHDGSLELLDVGDADPLVQDDFCIQ
# AGNPLDTVAAVDICCAPMAGEKRVIVAAATEAGVISLWDGKTGDCIRVLEEAYGHITQLRVSAVLGGTCWTCGQLSLDTFLLSFSVDQVVRFYKQSVT
# DSTRKCTCASATLRRKISLDKQLRQRSRSSSISSSVSTSPMVSAIRQTSNSEVSPFPVSGHGVHSRRASEKESARRNSELYSFQLDNEDGESQKTTGP
# SEVSRFPSLLWQDAYTVYVGDTTCDRGGWDVHNGKIVGIRRKPRGAFPSKITHTSNAIKIFAAQGLSITTLDRWEMWFFDPCATLLQSRSLSSILLNN
# NMEVLDMSHSLPELPSRCSIPRLPFTRVTPFVVTHSRTLAGFGNTLGVFEFLKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g339
###
# start gene g340
Scaffold_9	AUGUSTUS	gene	1586134	1587944	0.32	+	.	g340
Scaffold_9	AUGUSTUS	transcript	1586134	1587944	0.32	+	.	g340.t1
Scaffold_9	AUGUSTUS	start_codon	1586134	1586136	.	+	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_9	AUGUSTUS	CDS	1586134	1586349	0.42	+	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_9	AUGUSTUS	CDS	1586427	1586443	0.94	+	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_9	AUGUSTUS	CDS	1587320	1587944	0.94	+	1	transcript_id "g340.t1"; gene_id "g340";
Scaffold_9	AUGUSTUS	stop_codon	1587942	1587944	.	+	0	transcript_id "g340.t1"; gene_id "g340";
# protein sequence = [MKATPMDGAAIRKLIVSTMLQNSVKAKAVQSTLFLYKNGCPIIDVLSSSLVPDFDSIIADYLPPSTSAGKRMTYRVRP
# VSFIGERQAVNPVVHPLTVMYSDLKPDNILLDSQGNAHITDFNVAIHYSDRRPHTSVAGSIAYMAPEILTNKGYSWQIDWWSLGITIYELLFNKRPFD
# GKNVERMRYSISNQPLEFPTDIIPLSNHGINMLKQVSPQPSILNAVAKLRTAHRRDTTKRIGCRTIDQLDDFRDHPWFGSLEWDRLETKELIAPFIPD
# VIPLSPVVHTC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g340
###
# start gene g341
Scaffold_9	AUGUSTUS	gene	1591244	1593846	0.11	-	.	g341
Scaffold_9	AUGUSTUS	transcript	1591244	1593846	0.11	-	.	g341.t1
Scaffold_9	AUGUSTUS	stop_codon	1591244	1591246	.	-	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_9	AUGUSTUS	CDS	1591244	1592483	0.99	-	1	transcript_id "g341.t1"; gene_id "g341";
Scaffold_9	AUGUSTUS	CDS	1592603	1592702	0.36	-	2	transcript_id "g341.t1"; gene_id "g341";
Scaffold_9	AUGUSTUS	CDS	1592756	1593131	0.41	-	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_9	AUGUSTUS	CDS	1593208	1593846	0.46	-	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_9	AUGUSTUS	start_codon	1593844	1593846	.	-	0	transcript_id "g341.t1"; gene_id "g341";
# protein sequence = [MDHKQDIYSPSTNFSKPRRTAITRLIVFAVVLVASFLFSTPISGLQGFYSELSPIQSPNPDSEWQDNIYPFRQQSPWD
# ISTDFPYPRLLEYDVQEGTWLRLDVHPISGDIVFDMLGDIYCIPASEAYAYDKNTVARARPVLLGIPYDADPRFSPDGKRLAFRSDAGIGIDNIWLMH
# WTGCEEMDIRPSTAVDPLLAEALAEKDKEDHLLFIQRHFQFQLTVYHAAHRITNETYRYVSGPRFHPSGNKIITSKWYTGKVTISAPEGWEYNLPDLS
# IDQKPGTITSGSGRRVLGRTLPRGMTIDDYASQQIGPEQFIWAGDDVIIFAKNVVDEYTTSEKDVHKGVFAIFSYNITSGKQETLVDAFPGGASRPEL
# DLQTGSLRYIWYGLTFDWSSGSTLGGSYPSFAFTPNDDAVIIWAQGQIYRVPLTTNEFGEKIALGEPNPIRFTAHIETRIAETRKKQLDLLRLETKDT
# QRVHALKELALDDVGSKAVFQAAGVSIVQTFGETEATRVPVLAPDAPYYSPSFVPGVNNLVVHARWSDVNFTTFELADLDSGLAYELSGVPLGRYFTP
# VISAGPGYARRIAFVKSAGDSLTGDILATARPGLYVGEINLSSQSPPGPAVQDIPIRGLRFIPSDVVASDLALTIRFINSSNLLVQESSRVFSVFLDA
# ESELVSTIFTGKMTNEIAHASRLFADAGTVDHVAFIEYQHVYLESGTALKYKEELWAKPGNSTTGLMRLSVDGGHSLAWSRDGRRLSWLLGALPVFLQ
# SFLHLTHTNLNNHRSYYLFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g341
###
# start gene g342
Scaffold_9	AUGUSTUS	gene	1594104	1594798	0.36	-	.	g342
Scaffold_9	AUGUSTUS	transcript	1594104	1594798	0.36	-	.	g342.t1
Scaffold_9	AUGUSTUS	stop_codon	1594104	1594106	.	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_9	AUGUSTUS	CDS	1594104	1594553	0.65	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_9	AUGUSTUS	CDS	1594608	1594651	0.43	-	2	transcript_id "g342.t1"; gene_id "g342";
Scaffold_9	AUGUSTUS	CDS	1594780	1594798	0.52	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_9	AUGUSTUS	start_codon	1594796	1594798	.	-	0	transcript_id "g342.t1"; gene_id "g342";
# protein sequence = [MGKRTFSSKAKKGGNKKSPAKAVLPASQFKAKALPLHVNVTHTPPSAGDDDTVPSTSADPGQLGSLTLVPSSFNTGSY
# GWKGSKRLTVELENDTGTKEKVQVMLTYVVSNSYRLQACMILSDICVFRINATVLNSKNAPSEEEKDEAKDSNGEAAKEKEEGEDGGEKDAE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g342
###
# start gene g343
Scaffold_9	AUGUSTUS	gene	1595587	1596033	0.4	-	.	g343
Scaffold_9	AUGUSTUS	transcript	1595587	1596033	0.4	-	.	g343.t1
Scaffold_9	AUGUSTUS	stop_codon	1595587	1595589	.	-	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_9	AUGUSTUS	CDS	1595587	1596033	0.4	-	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_9	AUGUSTUS	start_codon	1596031	1596033	.	-	0	transcript_id "g343.t1"; gene_id "g343";
# protein sequence = [MAVNIDEDTELYVFEIYRELFLYSNLIQSSNDALRKHGIIPAREPTPPSPSPPPSPTFSDLLNDFTPSELREISEDAP
# DDETERMIAAYRRQRIADEKTLDKRSRFGRVYPIGRDDYTREVTEASKIDEEGDEKEEGTAVICFLYKDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g343
###
# start gene g344
Scaffold_9	AUGUSTUS	gene	1597029	1597932	0.4	+	.	g344
Scaffold_9	AUGUSTUS	transcript	1597029	1597932	0.4	+	.	g344.t1
Scaffold_9	AUGUSTUS	start_codon	1597029	1597031	.	+	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_9	AUGUSTUS	CDS	1597029	1597293	0.62	+	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_9	AUGUSTUS	CDS	1597382	1597932	0.44	+	2	transcript_id "g344.t1"; gene_id "g344";
Scaffold_9	AUGUSTUS	stop_codon	1597930	1597932	.	+	0	transcript_id "g344.t1"; gene_id "g344";
# protein sequence = [MTASPVWNSKNPAASIRTLETTLDAKVIGVREHVDELAENLPKPTEVRIQCRSEPFQAENSIIQMIKFYPPPPQDYDY
# PSPPTLGCSQRPYAASFYLFSEASYLITRLFAIYRVADDSEINEPVVPRSSSPKEIPSELFDIADVLVDYQAYFTKIDDPSSLPSSVSLEWCTPKVRT
# LAEVLRNHHSPTFQGIIFVEQRQIATYLAKILPHIPELNGLVKCGSFVGGVATSERVLSDGGQEQIARSFREKKINLRECDGTFDIPSLSNCCCS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g344
###
# start gene g345
Scaffold_9	AUGUSTUS	gene	1598129	1599082	0.46	+	.	g345
Scaffold_9	AUGUSTUS	transcript	1598129	1599082	0.46	+	.	g345.t1
Scaffold_9	AUGUSTUS	start_codon	1598129	1598131	.	+	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_9	AUGUSTUS	CDS	1598129	1599082	0.46	+	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_9	AUGUSTUS	stop_codon	1599080	1599082	.	+	0	transcript_id "g345.t1"; gene_id "g345";
# protein sequence = [MIQEDDYAYQERYQKFMDTEPKLKEAYQAQLQLFQDVLNPDDDDDDEEEEESAADLASRERYMVPSTSAFVTYDSAIS
# LISHLCSFIPHDLYTTQPAPVYTGDFQSILRLPASLPLPPEALIYQGPIKDSKKEAKRAVSFLAVKRLHELDVFDDYLLPAGSRRGKDFQDAEGKPVP
# DMSHVAYMMDVKVRDPWVISKRLWMHPIVINGKVLAGLVTGTRIDRTQIDYCDGIVETKPGRLLELHLDKDVECLRMMEEYSKLGIHLRISGSPFVGR
# PSLLLVPVTSSMDIVFMQWRNLFRTQTGILTGRLSVANAMTAY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g345
###
# start gene g346
Scaffold_9	AUGUSTUS	gene	1599157	1600669	0.29	+	.	g346
Scaffold_9	AUGUSTUS	transcript	1599157	1600669	0.29	+	.	g346.t1
Scaffold_9	AUGUSTUS	start_codon	1599157	1599159	.	+	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_9	AUGUSTUS	CDS	1599157	1600129	0.31	+	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_9	AUGUSTUS	CDS	1600182	1600669	0.47	+	2	transcript_id "g346.t1"; gene_id "g346";
Scaffold_9	AUGUSTUS	stop_codon	1600667	1600669	.	+	0	transcript_id "g346.t1"; gene_id "g346";
# protein sequence = [MNVTPEGQVQTYRDYYVDKWKRKNDRNKWTPVVPETGPMLQLSKIVRSKDTQYPLAGSGNIATDSSSKLAGTVLIPQG
# CCSWLTMSNEMSCAFGLLPALAHRITDIYRVRAAKLELRLPPILDDLMVQALTIPSALAGYNNQRLETLGDAVLEVCTTVHLLNKFPHRHEGQLDILR
# QRSISNRFLLYRALDVGLERFITSENPRIKAWRHILEESNDELSPSRCASRNYPRRSLQDCMEATLGAAFLTGGMQMALQTGNTLGLMFGGPSPWSLR
# YSQVESTPMSPMFTKLQELLGYTFNNGRLLREALTHPSFSSAAEVIPSYQRYIHTSFVAILNLVVVHHLYNKYPAADSAQLAFPRTKAVCAQALAFLA
# VKKLALHHMILLNNVDLSQAIDSYVPHLQAASPQTIIDNGWKFDPPKALSDVFESVIGAVLVDSGYNYEKTACVTEFIMEDILSILSPSVRLDPISTL
# MQWISSSMCQAQIKFM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g346
###
# start gene g347
Scaffold_9	AUGUSTUS	gene	1601286	1602920	0.72	-	.	g347
Scaffold_9	AUGUSTUS	transcript	1601286	1602920	0.72	-	.	g347.t1
Scaffold_9	AUGUSTUS	stop_codon	1601286	1601288	.	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_9	AUGUSTUS	CDS	1601286	1602920	0.72	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_9	AUGUSTUS	start_codon	1602918	1602920	.	-	0	transcript_id "g347.t1"; gene_id "g347";
# protein sequence = [MALRTFVRRREAWLMSNGSTPEGGEIDQKRRRTYERRLGVIGLKGSYHGDTIGTMDACEESGSCHSILFSSTLTDTLD
# PGVYTCEWHDCKGYWFDPPRVVIRQGQASVEVPFGMAEELLTTDSATIPKKNTKNLITFLSPAHVYDMSSRLNTPLYKLYTTYIARKLRSLQFGFLAP
# ELEREGLSENRRVEPPTELAALVLEPLLLGAGGMIFVDPLFQRALVDVVRNPNRFPVSSLSSQSSSPNLQSSTIDAQAIESHLLAEPPFPHPLPIVFD
# EVFTGFHRLGPLTPQALLGNAHPDIAVYAKMLTGGLLPTAVTLASKEVFDAFYYAPESESPGSQVLRKLGGKQHALLHGHSYTAHAIGCEVANETVKM
# MPAIVGGAEHVAMRDVWRCSKFEKSEQKEAQVNWKRSPSLLSVPLDGPMDDDVHAYSLWHPNFLSDVSQLDSVEDVMALGTVLAIRLKELGGSYTSTS
# AETVFSPLSQMLSPTSHSTTPSKFVPGTLSAPVYSIHFRTLGNVAYFMTSLNTSLDVVREVQEQIWQILCTGKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g347
###
# start gene g348
Scaffold_9	AUGUSTUS	gene	1605046	1605450	0.84	+	.	g348
Scaffold_9	AUGUSTUS	transcript	1605046	1605450	0.84	+	.	g348.t1
Scaffold_9	AUGUSTUS	start_codon	1605046	1605048	.	+	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_9	AUGUSTUS	CDS	1605046	1605450	0.84	+	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_9	AUGUSTUS	stop_codon	1605448	1605450	.	+	0	transcript_id "g348.t1"; gene_id "g348";
# protein sequence = [MVVHSFEKHMVILQIQFKHSWTLSVRTWVRSFIATIFDHFYSLEAPSTGYFSNTIGYGYTYGFTDILSPLETSYVLVA
# SLIASDTPRQINWHLDGARRNGATLEEVKAVRQIAIEAASAAGVKWKDVVPEVKDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g348
###
# start gene g349
Scaffold_9	AUGUSTUS	gene	1606620	1607708	0.86	-	.	g349
Scaffold_9	AUGUSTUS	transcript	1606620	1607708	0.86	-	.	g349.t1
Scaffold_9	AUGUSTUS	stop_codon	1606620	1606622	.	-	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_9	AUGUSTUS	CDS	1606620	1607708	0.86	-	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_9	AUGUSTUS	start_codon	1607706	1607708	.	-	0	transcript_id "g349.t1"; gene_id "g349";
# protein sequence = [MESGCPEKQNTNGRAVQHGSRDDDDDGSGMGWVRKRREAKEREAREKAEREAKEQAEKERQEREAQDKAREVDLNESD
# ASDSHSFSSITTTGTTGTTTETITAGTSRKVPAPLPLPELGEADALNTDTSAVGTPVGSPTPTFLSTMVTPTAGVGTPKPRVIESVLSTPTSPERNVT
# SPDLRAVSMSRQTSNTPTISNLNGTSSPGKDEQHHVLTAVNVPAPPPMSKHHSSHHSRGKSLQDAIPKVESNPGKFEPEANEPSISEAAIGERPAEDK
# SNNDQQGVEEEENSKKRKSRHASVSSTSSSSASSISSQSESGSDSESEKNLHDSDDEDEEEDDEDESEEEEARKTSLGAGVEKVSRHK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g349
###
# start gene g350
Scaffold_9	AUGUSTUS	gene	1608000	1609220	0.78	-	.	g350
Scaffold_9	AUGUSTUS	transcript	1608000	1609220	0.78	-	.	g350.t1
Scaffold_9	AUGUSTUS	stop_codon	1608000	1608002	.	-	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_9	AUGUSTUS	CDS	1608000	1609220	0.78	-	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_9	AUGUSTUS	start_codon	1609218	1609220	.	-	0	transcript_id "g350.t1"; gene_id "g350";
# protein sequence = [MTTIHSSALASRRTIRFAPMPDPRRSVLVTDDGTELPLLSPVILDGTNIDLLTSKLEMPSVNASELASIPAALSLSAL
# NSPAQTPSQTPQSWNVSLPEVLPSPASSSAPSPAQVQQSLSSESDSSNSSNNSTSGSSPPTSEISSSASSMYSLTPTQSIEPYPNSTGSSTPTQSVRK
# YSSLRSKLSSKYNISTDQILTLGTINLFRRGSKGKDRERDSDNESIQSSQGWGDALTRWTSAGSGGPRSGRDGVGVPMYRTQSTQSYKGENVRVSRYR
# FSSDAHAHFVRCQNAKRSSSPASLNSRTKPRSGSASSKLNPAHENGMLSTLHSGQSKKGTRMLNGEFMEPNEEALAVSTSISIHRPNGCHPVIIRTDG
# SSLFLVTIKMIEGSMSQCFLTLNTQMVYWHCPCG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g350
###
# start gene g351
Scaffold_9	AUGUSTUS	gene	1614110	1615098	0.31	+	.	g351
Scaffold_9	AUGUSTUS	transcript	1614110	1615098	0.31	+	.	g351.t1
Scaffold_9	AUGUSTUS	start_codon	1614110	1614112	.	+	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_9	AUGUSTUS	CDS	1614110	1614238	0.31	+	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_9	AUGUSTUS	CDS	1614337	1615098	0.87	+	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_9	AUGUSTUS	stop_codon	1615096	1615098	.	+	0	transcript_id "g351.t1"; gene_id "g351";
# protein sequence = [MAISPRSSNYERLEGGMGPSRMGNKKRFAWKKIAIAAVVLVGLLAVLNLSSVVYTTPHPNVDPIDPVVPPIPEADKPT
# PPNNSESNKPSSPNTHPTSFEEDTDPTKTTHCTTPYASHLPLVQYALMIDAGSTGSRIHVYKFNNCGSSPSYEYEVFKQRQPGLSKFAGQPNDAAESL
# DVLLDEAVRVVPSSLRACTPVAVKATAGLRLLPGSQSKDILDAVARRIQEKYPFQLHEPDGVVIMDGKDEGVYAWITANYLLNTIRADTPLTPRHTLY
# SILEELRLRLSLSRHSLKRAER]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g351
###
# start gene g352
Scaffold_9	AUGUSTUS	gene	1617270	1617953	0.47	+	.	g352
Scaffold_9	AUGUSTUS	transcript	1617270	1617953	0.47	+	.	g352.t1
Scaffold_9	AUGUSTUS	start_codon	1617270	1617272	.	+	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_9	AUGUSTUS	CDS	1617270	1617324	0.47	+	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_9	AUGUSTUS	CDS	1617394	1617953	0.98	+	2	transcript_id "g352.t1"; gene_id "g352";
Scaffold_9	AUGUSTUS	stop_codon	1617951	1617953	.	+	0	transcript_id "g352.t1"; gene_id "g352";
# protein sequence = [MVSSFSYNYTTIDLFTLSKSTVPKSLPPFPPLPHRTTTSSSLPWLSLAEIDGYLKPLRAHIPWTFTTANTISAATGNK
# TKAGPGWSYHGKYAFRAREFGLQFAARVRDVLNDEGIPYSGLQSTDFDLHIASRLDRRDSTESTTSDSDAAPKLPLNDPNVDQPKMKESREDETVVIL
# KIKTHLAYIPEEILSLRPQLPATKDTRT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g352
###
# start gene g353
Scaffold_9	AUGUSTUS	gene	1620095	1620430	0.93	-	.	g353
Scaffold_9	AUGUSTUS	transcript	1620095	1620430	0.93	-	.	g353.t1
Scaffold_9	AUGUSTUS	stop_codon	1620095	1620097	.	-	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_9	AUGUSTUS	CDS	1620095	1620430	0.93	-	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_9	AUGUSTUS	start_codon	1620428	1620430	.	-	0	transcript_id "g353.t1"; gene_id "g353";
# protein sequence = [MTNHSTAELYKAIYQYVLSQPRIGELTVEDPAEAFEDLRDKNDLKMLLSTKQFMEEGFGQNSYSHGGGRVGKVGKALS
# GSSKGKMGPPVEKGWAEKWRLKLKIAGVSLRYG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g353
###
# start gene g354
Scaffold_9	AUGUSTUS	gene	1622239	1622985	0.82	+	.	g354
Scaffold_9	AUGUSTUS	transcript	1622239	1622985	0.82	+	.	g354.t1
Scaffold_9	AUGUSTUS	start_codon	1622239	1622241	.	+	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_9	AUGUSTUS	CDS	1622239	1622985	0.82	+	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_9	AUGUSTUS	stop_codon	1622983	1622985	.	+	0	transcript_id "g354.t1"; gene_id "g354";
# protein sequence = [MSTHYYFSLDPLAFRPNPQNLLDTNVDDKDNDRTLASPHSRNGDSNADGIYRPPRVAPMPYVPQTSAKTKRQQRAPIP
# TSLASVLHTDGSMPHVESTSGLGNTPSLNNTSSRAKYLKHLTEFEEEQFGRVMMGKKEARRRVRDEEALALGGGLSGLGEEGKGRRQRTAGGWEDEFG
# DVLRDVERGSGRGLGGDGYDELRQRSKRSGVLQRSRENKKRSADSVVADADVPQKRKKSRFERERKGIKVKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g354
###
# start gene g355
Scaffold_9	AUGUSTUS	gene	1625399	1626058	0.3	-	.	g355
Scaffold_9	AUGUSTUS	transcript	1625399	1626058	0.3	-	.	g355.t1
Scaffold_9	AUGUSTUS	stop_codon	1625399	1625401	.	-	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_9	AUGUSTUS	CDS	1625399	1626058	0.3	-	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_9	AUGUSTUS	start_codon	1626056	1626058	.	-	0	transcript_id "g355.t1"; gene_id "g355";
# protein sequence = [MIEFSQPMTSVIGLDAFTASSILDVLNGLAAEGRTVIITIHQSRSELFPQFGNLLLLAKGGRVAYSGKASLMMPYFGR
# LGYQCPSNCNPSDWALDLVSVDLRDEKAEVASRLKVEEILDAYEPNPPAGIELNISDESKQRKYRPLPPNLVRLKKEPAPFYVAFPILIRRGLINFQR
# QPSLGIARIGQVLGLGLVQALFFAPLKRDYIAASVNIVGAVRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g355
###
# start gene g356
Scaffold_9	AUGUSTUS	gene	1646113	1646987	0.47	+	.	g356
Scaffold_9	AUGUSTUS	transcript	1646113	1646987	0.47	+	.	g356.t1
Scaffold_9	AUGUSTUS	start_codon	1646113	1646115	.	+	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_9	AUGUSTUS	CDS	1646113	1646368	0.59	+	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_9	AUGUSTUS	CDS	1646434	1646617	0.99	+	2	transcript_id "g356.t1"; gene_id "g356";
Scaffold_9	AUGUSTUS	CDS	1646684	1646987	0.83	+	1	transcript_id "g356.t1"; gene_id "g356";
Scaffold_9	AUGUSTUS	stop_codon	1646985	1646987	.	+	0	transcript_id "g356.t1"; gene_id "g356";
# protein sequence = [MMFNEHLFTGEIDIVEGVGDNTNDQATLHTLEGCSLASSSSSALDITGSVITSTDCVSTGGGCGIRSSSTVSYGAAFN
# GNGGGVSMTLNSSGIAVWFFERSAIPSDITAGTPLPALWGTPFAWWSSPSCNITEFFGYQSTIFDTTLCGDLAGSVWADAGAPGQEQSCATRTGVSDC
# NTFVQNNGAAFQDACAYSISHSHLLITSKLDGVQIGNSTVSKSIKFPVKTESLKLNQTFCYELSRKTRETR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g356
###
# start gene g357
Scaffold_9	AUGUSTUS	gene	1647823	1648170	0.85	-	.	g357
Scaffold_9	AUGUSTUS	transcript	1647823	1648170	0.85	-	.	g357.t1
Scaffold_9	AUGUSTUS	stop_codon	1647823	1647825	.	-	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_9	AUGUSTUS	CDS	1647823	1648170	0.85	-	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_9	AUGUSTUS	start_codon	1648168	1648170	.	-	0	transcript_id "g357.t1"; gene_id "g357";
# protein sequence = [MAIVNDRLNAAKPTPPQSDPKTGKLAPGVINNNKDLDVEAKKDETGFFGSFFTSSGRNSRAGTAKKTGGTSTPSTMEA
# PPPVIKPQAALSERETMETEVISALFIHAHFSTSITS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g357
###
# start gene g358
Scaffold_9	AUGUSTUS	gene	1649359	1650234	0.25	-	.	g358
Scaffold_9	AUGUSTUS	transcript	1649359	1650234	0.25	-	.	g358.t1
Scaffold_9	AUGUSTUS	stop_codon	1649359	1649361	.	-	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_9	AUGUSTUS	CDS	1649359	1649801	1	-	2	transcript_id "g358.t1"; gene_id "g358";
Scaffold_9	AUGUSTUS	CDS	1650072	1650234	0.25	-	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_9	AUGUSTUS	start_codon	1650232	1650234	.	-	0	transcript_id "g358.t1"; gene_id "g358";
# protein sequence = [MSTGPAGLGSEIVTIVNKLQDVFNAVGTSTASIDLPQICVLGSQSSGKSSVLEVSPELGKDGDAAANADEWGEFLHLP
# GQKFYDFHKIRDEIVRDTEAKTGRNAGISPQPINLRIYSPKVLTLTLVDLPGLTKVPVGDQPKDIEKQIRDMLMKYISKPACIILAVSPANVDLANSD
# GLKMARDVDPEGNRTIGVLTKIDLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g358
###
# start gene g359
Scaffold_9	AUGUSTUS	gene	1667385	1667681	0.7	-	.	g359
Scaffold_9	AUGUSTUS	transcript	1667385	1667681	0.7	-	.	g359.t1
Scaffold_9	AUGUSTUS	stop_codon	1667385	1667387	.	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_9	AUGUSTUS	CDS	1667385	1667681	0.7	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_9	AUGUSTUS	start_codon	1667679	1667681	.	-	0	transcript_id "g359.t1"; gene_id "g359";
# protein sequence = [MTSSSKATGIKLWDGSSGHGVATVNNVTFNDITVDSSDYAAQIQVCYESTGTCVPSAHMLTDIVFSNFKGTTYAFYIF
# IEILFLIWTWFIARELKGPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g359
###
# start gene g360
Scaffold_9	AUGUSTUS	gene	1669493	1670017	0.96	-	.	g360
Scaffold_9	AUGUSTUS	transcript	1669493	1670017	0.96	-	.	g360.t1
Scaffold_9	AUGUSTUS	stop_codon	1669493	1669495	.	-	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_9	AUGUSTUS	CDS	1669493	1670017	0.96	-	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_9	AUGUSTUS	start_codon	1670015	1670017	.	-	0	transcript_id "g360.t1"; gene_id "g360";
# protein sequence = [MAINIVFKAISKLYPEHELEDFSTEFENRRLLYSFCFIIIMSGEIFNPNPTVFRSSAKSHSSRSLSTAKKSLWINEPE
# WSQPDQETDEEEEAIDQDEIFGALFFFYLIMLLTSELHCLDLIRNIYDPEHPNTLEELHVVSAPQIDIGENRVKVEFTPTVPHCGMSTLIGEPTPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g360
###
# start gene g361
Scaffold_9	AUGUSTUS	gene	1673781	1677238	0.34	-	.	g361
Scaffold_9	AUGUSTUS	transcript	1673781	1677238	0.34	-	.	g361.t1
Scaffold_9	AUGUSTUS	stop_codon	1673781	1673783	.	-	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_9	AUGUSTUS	CDS	1673781	1675232	0.92	-	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_9	AUGUSTUS	CDS	1676219	1677238	0.35	-	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_9	AUGUSTUS	start_codon	1677236	1677238	.	-	0	transcript_id "g361.t1"; gene_id "g361";
# protein sequence = [MRPQTEARPSTRPQEKKSSAKLASQETLSRPPTPASTLPLAHPSLPPKPPSPVTRKKKEPIVRAPSPSPTPSAAGDSE
# STGSQENGPGSPKIHPQSDESIQSSIPSNPSAPPGLPAVPPGLSAPPGLPPPPGLAGPSHPSRIATASPQTPILAQQTSYQMSNAARALLDDVTSRRE
# SLLPTVVAQSPFPDFDRTLENLSQADGGLGGFSFSLDLNLAGDEATHDEFADLEPESQTPFLGSFLDAFPSLRSSASTSSYIPPGLPYPHNPAHAIYD
# PTVVQRTVTPIENQSSNKPNYMGSFNPFADGADDSPTVSAPIKPNTPNAIGDDSAPRVSRLVLPVMDTPSLSTITPIEQDFKSQEKAERKAAKKAAAA
# AKAAERQKIAQEKSAAKAVVKARMAAEKAAEKERAAVLKAQLEKEKAEKVRLETENARLEKEKERLLRAERERVAQAEREKAAQAEKDKAAKKAGVTS
# ARAANTQKATNKRVDIKATNVKEALPGSSEFSTQVPLLSKKPKKNKPVTRPIRVPHKEEELGTNENSSFPSATASDTAHTSGFKGPSTNTSSNNSRSQ
# SVERHVPTSLEDLMEDIHIMNASMDLLKHPFFDLHKINPAAKMPLEYGPLVHALSALSVGGGSFANNVPSGSIDNAVSSFQQLLETLTQTISDLLRLL
# PHTTSSFDCGVLGDMLKGDDLFDEGAAVVTFGEDGHGREDEVAALTLGLERRARWMEVQLSKLEELHRDINNAAVRAVLAFNDSGWDRHGFMPRVGNT
# VRRFENIGVVDDCDGQRPMTAEELEKKLEVAKEAAVFAETELREMMEKMQDVKPYEDDY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g361
###
#
# ----- prediction on sequence number 2 (length = 1585523, name = Scaffold_10) -----
#
# Predicted genes for sequence number 2 on both strands
# start gene g362
Scaffold_10	AUGUSTUS	gene	5422	6015	0.99	-	.	g362
Scaffold_10	AUGUSTUS	transcript	5422	6015	0.99	-	.	g362.t1
Scaffold_10	AUGUSTUS	stop_codon	5422	5424	.	-	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_10	AUGUSTUS	CDS	5422	6015	0.99	-	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_10	AUGUSTUS	start_codon	6013	6015	.	-	0	transcript_id "g362.t1"; gene_id "g362";
# protein sequence = [MLKRQRAPSPPPSSSSNVPLIFDSTPVENARSTKRRRTQPPVLDGQMRGWGTPQDVLYETSDREEDDGEENLVDDDQL
# YSAPDISGGANPNSPYKSANGFLHELHTLQRHRLLYSSNISPQSPSSNNLVSHSFPQQVHAYNPHLYPPGKGLSPLISPPTSGHAYSQQDMHALLPYA
# TDPGKQHELTSIKGHYEEKNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g362
###
# start gene g363
Scaffold_10	AUGUSTUS	gene	6323	6776	0.73	+	.	g363
Scaffold_10	AUGUSTUS	transcript	6323	6776	0.73	+	.	g363.t1
Scaffold_10	AUGUSTUS	start_codon	6323	6325	.	+	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_10	AUGUSTUS	CDS	6323	6329	0.74	+	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_10	AUGUSTUS	CDS	6367	6776	0.97	+	2	transcript_id "g363.t1"; gene_id "g363";
Scaffold_10	AUGUSTUS	stop_codon	6774	6776	.	+	0	transcript_id "g363.t1"; gene_id "g363";
# protein sequence = [MSCFAPIHASVTASVAGSFLPAEYKGEKSDEENDVGPSPAPQTSTKDDNEEEPEYDPDDMENDDVDSEAPQFPTTHEL
# ILKDHTKVVSALALDPSGARIVSGSHDYDCKLWDFGGMDTRCKPFKSWEPSGSYHVRRGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g363
###
# start gene g364
Scaffold_10	AUGUSTUS	gene	8840	10878	0.64	+	.	g364
Scaffold_10	AUGUSTUS	transcript	8840	10878	0.64	+	.	g364.t1
Scaffold_10	AUGUSTUS	start_codon	8840	8842	.	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_10	AUGUSTUS	CDS	8840	9548	0.64	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_10	AUGUSTUS	CDS	9620	10878	0.9	+	2	transcript_id "g364.t1"; gene_id "g364";
Scaffold_10	AUGUSTUS	stop_codon	10876	10878	.	+	0	transcript_id "g364.t1"; gene_id "g364";
# protein sequence = [MNDAPVISSDVDLSGDQASLIDADAEHQPLGNEVLGSPPASPSTPVSNQITPEVKIDVHYEDQESDAHNELLPIEPIN
# DTQDETPKDVLTVSEVAAELDSGTSCFLFVADYIFSISTCIFNSIAGSLPPDIPMETNHSHDATAVPINDINGLNGVNGVNGVNGVHVDSDIIMEEHT
# PATTPGVSGGSFSGTNGSTAHTTPNDILDDDDDKPPPAKRARVHSDADQASIAHVSLFSSSTTLATPVPPPSASHDPSAPVTSTGSSTLTVGQYRFCQ
# STIRSLKKLKDASPFLRPVDPVALNIPHYPSIIKNPMDFSTIERKLTASNPVKPDPNSLNPRYRTAEEFVADIRLIISNCVTFNGPDHVITAMSRRVE
# EVFDKQVKNMPTVDVSHSRTSSFSMTYLCLQAPVVKKQSPPPPPPQRPVAVAPPPVSTPALVKKAPPVRRPSTSLPTIRRNEAQEVIGRPKREIHPPA
# PKDLPYADAPKKQRKVKHVKDSAGSVEQLKYCSKILSDLHKKQYYTIANPFYQPVGRCSILYTIKSLLKHARTDWMKLEIPSYPKIIKRPMDMSTMRR
# KLDAHEYRTASSFWDDFKLMIRNCFTFNPAGTPVNQAGQELQRVFDEKWKNLPPEPMSEDEEEEEEEDSEEERARKLIGGRCVFPFN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g364
###
# start gene g365
Scaffold_10	AUGUSTUS	gene	11288	11575	0.68	+	.	g365
Scaffold_10	AUGUSTUS	transcript	11288	11575	0.68	+	.	g365.t1
Scaffold_10	AUGUSTUS	start_codon	11288	11290	.	+	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_10	AUGUSTUS	CDS	11288	11575	0.68	+	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_10	AUGUSTUS	stop_codon	11573	11575	.	+	0	transcript_id "g365.t1"; gene_id "g365";
# protein sequence = [MLPTAVLTRLYNVVVRPLKAAPPKRNRPGKGTGTGGLKRKSMDEEVEAEKIRQLEQRMRLFDQGANGAAPSGAHAHDS
# DRSSDSSSDDSSGSDSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g365
###
# start gene g366
Scaffold_10	AUGUSTUS	gene	12073	12702	0.93	-	.	g366
Scaffold_10	AUGUSTUS	transcript	12073	12702	0.93	-	.	g366.t1
Scaffold_10	AUGUSTUS	stop_codon	12073	12075	.	-	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_10	AUGUSTUS	CDS	12073	12702	0.93	-	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_10	AUGUSTUS	start_codon	12700	12702	.	-	0	transcript_id "g366.t1"; gene_id "g366";
# protein sequence = [MQASSRIKPQEEIEKRKEKEQKREEKQLRKIAAASGVKMAKTTLPPSGAPVLAPVASGSSGFQPSGWASVSGSGDSTL
# SSSGGGFKKAGWASVGPSSSPETLAPVSGVITTSGGGGFKKAGWTTVGSTYSSTAQAVPPAAASSDSWKTVTSSSGSSLDASSLPANVPIPSAAPSTA
# VEPISQPAPPHPPSKSHLSRVGWQQFQKKNKKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g366
###
# start gene g367
Scaffold_10	AUGUSTUS	gene	14054	14500	0.76	+	.	g367
Scaffold_10	AUGUSTUS	transcript	14054	14500	0.76	+	.	g367.t1
Scaffold_10	AUGUSTUS	start_codon	14054	14056	.	+	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_10	AUGUSTUS	CDS	14054	14500	0.76	+	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_10	AUGUSTUS	stop_codon	14498	14500	.	+	0	transcript_id "g367.t1"; gene_id "g367";
# protein sequence = [MYTIKEEREIEPETFAHLVSSTLYERRFGPYFIEPVMAGLSKSATGGYKPFIAATDLIGCLNFAKDFVVAGTASSKLY
# GVAEGLWEPDLDADQLFETISQTIMNAVDRDAYSGWGVIVHVMYVMFSTLDPVLTILCFTVRKTRLPVVH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g367
###
# start gene g368
Scaffold_10	AUGUSTUS	gene	20484	23194	0.08	-	.	g368
Scaffold_10	AUGUSTUS	transcript	20484	23194	0.08	-	.	g368.t1
Scaffold_10	AUGUSTUS	stop_codon	20484	20486	.	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_10	AUGUSTUS	CDS	20484	21198	1	-	1	transcript_id "g368.t1"; gene_id "g368";
Scaffold_10	AUGUSTUS	CDS	21282	21628	0.51	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_10	AUGUSTUS	CDS	22181	22540	0.83	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_10	AUGUSTUS	CDS	22596	22861	0.94	-	2	transcript_id "g368.t1"; gene_id "g368";
Scaffold_10	AUGUSTUS	CDS	22981	23194	0.43	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_10	AUGUSTUS	start_codon	23192	23194	.	-	0	transcript_id "g368.t1"; gene_id "g368";
# protein sequence = [MCYDDLEAYARGPDSTDGMKPSEKAKATKAKKVHTNPLFLSLMNEIRAQNAQGFKMHPKMEKMKNLIMQHFAPHSGYT
# LYRSRDRQERKERAGTARAVGGATMMPVYFWQKLMHFFQIIKKFKNNEFNILVATSIGEEGLDIGEVDLAICYDTQKTPIRLLQRLGRTGRKRSGHVH
# VLLADGREEANFDKAQSSYEDVQASIIYGSHLEFYADVERLLPDNVQPQCLEKEMEIIPYVRDEAPKKRDNSPKKGVKRKRNDDIGRNIPQGASTGFV
# SVADLLDPWSQSPPRVSPSRNVQNIAWLLEDEDEDVQLDFDIVNSSPVVERTQQPLVPDNSVLDLDDSDSSPGRSPSQGRMSVDDSLKFMNDASSPTR
# SAYTRISSLSATPIDDSIEFMEYGDEGTTYSIQNSPRRYASPDLPSSPVDSSSISIHTSPQAPEPSFAVRPVGKKRITTLAFTNSSPLIESPAQTHRR
# LHRRHESSGSEMPPPTIPGIKRSQDKHKRRKRPRVPMKHNPLYDYEATHSGDEESEGSSGSEDVESESDRMFLEELPETQASPSYDQSLAYRQSLLTQ
# APDGGPSFASKPVRKGRFGRNSIRTQNSNRRRPGVSSSPTREDETDLYEFGSFVVSDDAEISYEM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g368
###
# start gene g369
Scaffold_10	AUGUSTUS	gene	24538	25134	0.98	-	.	g369
Scaffold_10	AUGUSTUS	transcript	24538	25134	0.98	-	.	g369.t1
Scaffold_10	AUGUSTUS	stop_codon	24538	24540	.	-	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_10	AUGUSTUS	CDS	24538	25134	0.98	-	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_10	AUGUSTUS	start_codon	25132	25134	.	-	0	transcript_id "g369.t1"; gene_id "g369";
# protein sequence = [MSSDGYFDDDIDDETLEQLNAIEAQYQQSDEQRPVSARAPSPINIDSSDYGESIDLDESALDALKAIEDGTFQQLPRK
# AAPSLARSSSKGTLQTTLFGEVIPAGVSTTKSKPRAQRTRSKQEPRKTKQWDHTAFAKTGVKIGNARGKGKNKQQDEDRKGKKRKSSSLNSFHPLLYL
# VSIIRLLSRPQLTLFCATSWVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g369
###
# start gene g370
Scaffold_10	AUGUSTUS	gene	26199	27206	0.33	+	.	g370
Scaffold_10	AUGUSTUS	transcript	26199	27206	0.33	+	.	g370.t1
Scaffold_10	AUGUSTUS	start_codon	26199	26201	.	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_10	AUGUSTUS	CDS	26199	27206	0.33	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_10	AUGUSTUS	stop_codon	27204	27206	.	+	0	transcript_id "g370.t1"; gene_id "g370";
# protein sequence = [MGSGPAAAYDPREAQMDMRLMGSSRNNQARPAVLPRMQQEEGASRVVHKSTISGELPVIQDLTPEVPHNAVTPNPATH
# STHSPANSSTSPIQNPPLQSLPNHPEPSYMPNVLPTLRNFPQDVDMEMSLAGHIPIGNWRGGRGGGRANGRGRQPGAFNGDHATFQPERRKDKTLVLE
# KIPEDKLSLTQVNDWFKRFGTVTNVAIDQGQQKALISFSTHEEAHAAWKSEDAVFNNRFVKVFWHRPMEGHGDAGRRALAASAPVLAKTSANKITSPT
# PTTAPPRKSSVTSTAAALAEKQQLLDKQIAEQKSLMTSLISASSIEEKKKLWIVSNNWMKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g370
###
# start gene g371
Scaffold_10	AUGUSTUS	gene	27749	28075	0.32	+	.	g371
Scaffold_10	AUGUSTUS	transcript	27749	28075	0.32	+	.	g371.t1
Scaffold_10	AUGUSTUS	start_codon	27749	27751	.	+	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_10	AUGUSTUS	CDS	27749	27751	0.32	+	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_10	AUGUSTUS	CDS	27836	28075	0.98	+	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_10	AUGUSTUS	stop_codon	28073	28075	.	+	0	transcript_id "g371.t1"; gene_id "g371";
# protein sequence = [MGLAKGTSIPMVGSVKVAWLTGQPTSSPIGSVSTDSRAVETSLQEASKVDLEELEPDSLVEEAEDVVVSGWGREDDGM
# GM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g371
###
# start gene g372
Scaffold_10	AUGUSTUS	gene	32845	33414	0.58	-	.	g372
Scaffold_10	AUGUSTUS	transcript	32845	33414	0.58	-	.	g372.t1
Scaffold_10	AUGUSTUS	stop_codon	32845	32847	.	-	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_10	AUGUSTUS	CDS	32845	33414	0.58	-	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_10	AUGUSTUS	start_codon	33412	33414	.	-	0	transcript_id "g372.t1"; gene_id "g372";
# protein sequence = [MTIENVNGRDRCVMEFKQSGYWGETNLVSGHVHDASGKVASQLEGKWDEHLSQAVDASHFTLLWRAHPWPKHTHEYYG
# FTSFSMTLNEITPDLAEKLPVTDSRYRPDVRALEEGDIDRAEAEKVRVEEMQRSRRREGKEPQARWFKLEGDEWVYNGGYWEARARMERRQNRSALVM
# YYRFNAYLTYSPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g372
###
# start gene g373
Scaffold_10	AUGUSTUS	gene	34114	34989	0.42	-	.	g373
Scaffold_10	AUGUSTUS	transcript	34114	34989	0.42	-	.	g373.t1
Scaffold_10	AUGUSTUS	stop_codon	34114	34116	.	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_10	AUGUSTUS	CDS	34114	34752	1	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_10	AUGUSTUS	CDS	34876	34920	0.42	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_10	AUGUSTUS	CDS	34981	34989	1	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_10	AUGUSTUS	start_codon	34987	34989	.	-	0	transcript_id "g373.t1"; gene_id "g373";
# protein sequence = [MGTTLLELEDAFANLRNTTGHHHGTHESHNDVPRPEVIDPTSYQRIHVALESLKVQHGTLLKSLQSISILDTTQSSHP
# SAQVSPLPRTTEEEERGESSPDSASERKITSSIIRRSKRTSVATTITDSLNEWFDASEGEGVQEFVLDEQTSPDNGEMPSRITTTDSQSSLDHAEESS
# IDTDIEDVGGEPSVLDQVARTSPAQVVRRTHLPAPITGDEGSLFAVLKKNVGKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g373
###
# start gene g374
Scaffold_10	AUGUSTUS	gene	36516	37252	0.3	+	.	g374
Scaffold_10	AUGUSTUS	transcript	36516	37252	0.3	+	.	g374.t1
Scaffold_10	AUGUSTUS	start_codon	36516	36518	.	+	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_10	AUGUSTUS	CDS	36516	36635	0.31	+	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_10	AUGUSTUS	CDS	36713	37252	0.66	+	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_10	AUGUSTUS	stop_codon	37250	37252	.	+	0	transcript_id "g374.t1"; gene_id "g374";
# protein sequence = [MPGGSPAAWPHIKEIFQKTAAQAYGEPCCDWVGETGAGHYVLNTVTCSLLLRHTIFSSARLGLSEDEIADIFLKWNKG
# VLDSFLIEITADILKFKDDDGEPVVAKILDKAGQKGTGKWTAIAALDAGSPGLFLHSVAYRVSYPFAIVTLIGEAVFARTLSALKEERTRASKVIAGP
# QKEPFRGDKQMFIDDLEQALYASKIISYTQGFMLMRQTASDVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g374
###
# start gene g375
Scaffold_10	AUGUSTUS	gene	38171	38554	0.81	+	.	g375
Scaffold_10	AUGUSTUS	transcript	38171	38554	0.81	+	.	g375.t1
Scaffold_10	AUGUSTUS	start_codon	38171	38173	.	+	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_10	AUGUSTUS	CDS	38171	38554	0.81	+	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_10	AUGUSTUS	stop_codon	38552	38554	.	+	0	transcript_id "g375.t1"; gene_id "g375";
# protein sequence = [MASVTTLTQQLSSLDISRKQEPAADISKLLTKYAAPNPPTKLKPSASSSNLRSKASVSSLKTQSHKSVHTTASQSSLQ
# PKSKHTKTGSVDGSKTIDIGRYDGGLEADNVAHVSVDEAPDLALDSSKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g375
###
# start gene g376
Scaffold_10	AUGUSTUS	gene	39679	41748	0.49	-	.	g376
Scaffold_10	AUGUSTUS	transcript	39679	41748	0.49	-	.	g376.t1
Scaffold_10	AUGUSTUS	stop_codon	39679	39681	.	-	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_10	AUGUSTUS	CDS	39679	41748	0.49	-	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_10	AUGUSTUS	start_codon	41746	41748	.	-	0	transcript_id "g376.t1"; gene_id "g376";
# protein sequence = [MDSVSSLQADYGGTEIPTALRTVFTSLQRPLRKPVAVFLLTDGSSWDVSACVSVITDALRDLPGPLPQSDDPNAQSFI
# RVFTLGIGAGASSSDMCESIARAGEGVAVYAQEGEEMVGKCARLVSAARTPPISIEVEWMGVRESDETSEYQKEPDKIASVGHENDTSAEKDTDTEDD
# DDAKTLRNEPSSSSSSSPVNLFNPFITNLSRETGPSTKAKLNPKLPPPPTIQQAPLVVPTIFPGTRTCIYAIIKSGSASFLNLKHSDDPLPTYVKVRG
# TVKVTGRRVELKVPITRLLQLQPSQSSPSSTSSKLYSGLSSLFTPPPPLTKPKPFLHILAAKALITDRQEGKHAFPSSIAESNSFKLDAEVRRSYIKK
# DIIRLGTTYGLTSEHTSFIAVDDREHMVSVSQNYHAQERSSKQNSARTSYQYLTGGFTESYDPMTEDISSHPDEYPYIQEEYGTRGGSSHYNPNTGIM
# HPPSPQLGSDHTPVTSSSLPPTPASKNKLQGWFGKRQSVDGIRRPNMKGGASFFKRMSLSISMPSNTSDISNSETTSKTATPTSSPLVLRTVVAPSGQ
# NSSTTTTPSTTVDTSLMSSGERLASIARLQRFDGGFAWSTTIFSVLQLSFNDLDNMKRQLSEQNITADIAATVLAWVWLERNGGYEATEMAKKAGEWV
# GIQLGTQENEELKNKVLAVIPLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g376
###
# start gene g377
Scaffold_10	AUGUSTUS	gene	41784	42509	0.49	-	.	g377
Scaffold_10	AUGUSTUS	transcript	41784	42509	0.49	-	.	g377.t1
Scaffold_10	AUGUSTUS	stop_codon	41784	41786	.	-	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_10	AUGUSTUS	CDS	41784	42509	0.49	-	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_10	AUGUSTUS	start_codon	42507	42509	.	-	0	transcript_id "g377.t1"; gene_id "g377";
# protein sequence = [MYGVDSLQVFSISVGNIQPFETVTINLRFIQALTDDENHDEVKFIFPRTYAQRYGVVPTVPSAARETETAIQPFDMKV
# AVQQAGLIKSISCPSGHPISFKIKSAKATSAEVTLKDTSGFLTQDVILVVSAANLDSPRCFIEAYPSSPKHNTTAMALTFVPRFEVPDVSQGMEYIFM
# IDRSGSMYGRNIQLVKDALVVLLRSLPTKDTTFNLVSFGSRATTLWRHSREYTQSTVDEATNHVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g377
###
# start gene g378
Scaffold_10	AUGUSTUS	gene	43924	44757	0.27	-	.	g378
Scaffold_10	AUGUSTUS	transcript	43924	44757	0.27	-	.	g378.t1
Scaffold_10	AUGUSTUS	stop_codon	43924	43926	.	-	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_10	AUGUSTUS	CDS	43924	44477	0.71	-	2	transcript_id "g378.t1"; gene_id "g378";
Scaffold_10	AUGUSTUS	CDS	44592	44757	0.31	-	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_10	AUGUSTUS	start_codon	44755	44757	.	-	0	transcript_id "g378.t1"; gene_id "g378";
# protein sequence = [MSHHPPNPPIIHSFASPEVLISSLASFILKAQKEAIDKKGRFTIALSGGSLPKQLNERVVPLTDPDSNHLLCSTELFN
# KVPIPKENIHTIDTSLLSDLEELSDAYEKELIKEFAQKDAARFPVFDVILLGMGPDGHTASLFPGHELLAEEDRWVAYIEDSPKPPPNRITLTYPVIN
# HALRVVFVAVGAGKAEILSEVLDSPEKGLPASRVKPVHPGQLFWFVDEAAAAKLQVASAEFKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g378
###
# start gene g379
Scaffold_10	AUGUSTUS	gene	46569	47117	0.89	+	.	g379
Scaffold_10	AUGUSTUS	transcript	46569	47117	0.89	+	.	g379.t1
Scaffold_10	AUGUSTUS	start_codon	46569	46571	.	+	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_10	AUGUSTUS	CDS	46569	46712	0.91	+	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_10	AUGUSTUS	CDS	46794	47117	0.98	+	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_10	AUGUSTUS	stop_codon	47115	47117	.	+	0	transcript_id "g379.t1"; gene_id "g379";
# protein sequence = [MTETLREKEELSRVDAEALRKSKDELTILRRKVDQHNEIMTEKDRTVQHSPTRARPNRRAERDPHQRQRQTPPAVARR
# QTDRGEQMNEANDFYEDMRSKHQAVLTWRDGSAAGETGTNPSSVSGNGEARDPDLSAEMKDGIPSTMQKHADQTQNG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g379
###
# start gene g380
Scaffold_10	AUGUSTUS	gene	47964	49193	1	-	.	g380
Scaffold_10	AUGUSTUS	transcript	47964	49193	1	-	.	g380.t1
Scaffold_10	AUGUSTUS	stop_codon	47964	47966	.	-	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_10	AUGUSTUS	CDS	47964	49193	1	-	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_10	AUGUSTUS	start_codon	49191	49193	.	-	0	transcript_id "g380.t1"; gene_id "g380";
# protein sequence = [MLTEIFAVAGPVQHVKIIPDRNYQHGGLNYGFVEYMDMRAAETALQTLNGRKIFDTEIRVNWAYQGQQNKEDTTGHYH
# VFVGDLSPEVNDEVLAKAFSAFGTMSDARVMWDMNSGKSRGYGFLAFRDKTDAEQAIATMNGEWLGSRAIRVNWANQKTQGSPAMTSSPQHPGAGNLG
# TAPAPINFQGGPLSYESVVQQTPAYNTTVYVGNLVPYCTQADLIPLFQSIGYLSEIRMQADRGFAFVKLDTHEHAAMAIVQLQGQMVHGRSIKCSWGK
# DRADGAAPAPISPTAGAAAPYGNMVSSGIFIQYKNESKKLMISLLQPMYGMPQPNTFGQYAYGGYGGFPNQAAGTPGAGAPGAGGMPQPAAGAAGLGL
# APGGQAPGADAAAAGQAGQAQWAADPSSYYSNYWGGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g380
###
# start gene g381
Scaffold_10	AUGUSTUS	gene	58236	59339	0.08	-	.	g381
Scaffold_10	AUGUSTUS	transcript	58236	59339	0.08	-	.	g381.t1
Scaffold_10	AUGUSTUS	stop_codon	58236	58238	.	-	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_10	AUGUSTUS	CDS	58236	58515	0.68	-	1	transcript_id "g381.t1"; gene_id "g381";
Scaffold_10	AUGUSTUS	CDS	58771	59339	0.08	-	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_10	AUGUSTUS	start_codon	59337	59339	.	-	0	transcript_id "g381.t1"; gene_id "g381";
# protein sequence = [MENGMADFAHRAATAGATYIDKVEDYDLYCHYVAGLVGEGLSRLFSASKKEVSWLGTQLEISNSMGLLLQKTNIIRDY
# REDCDDKRYFWPKEIWGKKEYGFQEMKDMYLPGAEERAQWVQSEMILDAMRHLTDALDYLRLLKNQSVFTFCAIPATMAIATLDLCFMNPAMFQRNVK
# IRKAEAASVNFLRSMPSTAGNPPTFDPEDARTSILKKSQEIDQTITQRKRVAQLQEKQGSNGEAKPALAQQGVPWELFAVVGAIFGILLISILGVVWI
# VVMFSDKF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g381
###
# start gene g382
Scaffold_10	AUGUSTUS	gene	70418	71242	0.79	-	.	g382
Scaffold_10	AUGUSTUS	transcript	70418	71242	0.79	-	.	g382.t1
Scaffold_10	AUGUSTUS	stop_codon	70418	70420	.	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_10	AUGUSTUS	CDS	70418	71242	0.79	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_10	AUGUSTUS	start_codon	71240	71242	.	-	0	transcript_id "g382.t1"; gene_id "g382";
# protein sequence = [MVQQHKRFVAVCEEFPKYTSLGAREFERRVVRVITPGTLIDESFLNQYENNYLLAVSVPEGDSAKNPTLGLAWIDVST
# GEFYSKRSSHESVRDDIARIGPREILLDKIMETQISHPTMKVVTEESSVVSFVVPSHSVDGTDNLSARSPSSTQKQQSSSQAYKPKTANVTDEIVTAQ
# NGSPATPFLYTPEETCAIDLLTTYLRANLLEHMPILSLPNREDTEARMQIDSHTIKALEIRENIREGGVRGSLMSSVKRTITSSGTRLLARWLCACFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g382
###
# start gene g383
Scaffold_10	AUGUSTUS	gene	71579	72204	0.46	-	.	g383
Scaffold_10	AUGUSTUS	transcript	71579	72204	0.46	-	.	g383.t1
Scaffold_10	AUGUSTUS	stop_codon	71579	71581	.	-	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_10	AUGUSTUS	CDS	71579	71991	0.98	-	2	transcript_id "g383.t1"; gene_id "g383";
Scaffold_10	AUGUSTUS	CDS	72087	72204	0.48	-	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_10	AUGUSTUS	start_codon	72202	72204	.	-	0	transcript_id "g383.t1"; gene_id "g383";
# protein sequence = [MKARLSPSKLPRRLITQSKSQKQRRNSLNYPQFRVLPDGMESLNPDYANARDLLQQVQIGQFSIQTGIEENNVDAEGP
# YSQGKRTSRDRVEEIADAGERQLMFVVQFHSSRPDEVVPKKSIRKKIQEIAEEERTTKNRKRTRKKKDIENAENESVVQTKPKRAVKARKDPLLDEGQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g383
###
# start gene g384
Scaffold_10	AUGUSTUS	gene	74737	77284	0.22	+	.	g384
Scaffold_10	AUGUSTUS	transcript	74737	77284	0.22	+	.	g384.t1
Scaffold_10	AUGUSTUS	start_codon	74737	74739	.	+	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_10	AUGUSTUS	CDS	74737	75452	0.94	+	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_10	AUGUSTUS	CDS	75541	75839	0.43	+	1	transcript_id "g384.t1"; gene_id "g384";
Scaffold_10	AUGUSTUS	CDS	75929	75961	0.35	+	2	transcript_id "g384.t1"; gene_id "g384";
Scaffold_10	AUGUSTUS	CDS	76638	77284	0.61	+	2	transcript_id "g384.t1"; gene_id "g384";
Scaffold_10	AUGUSTUS	stop_codon	77282	77284	.	+	0	transcript_id "g384.t1"; gene_id "g384";
# protein sequence = [MSWATGDSRELGGLAISAYPSPPQTSSTFSQRRRSSAAHTRPAAPPPNLPIPSIPNIPQDPAESLEEVSSTNGFSRLN
# RSSLFVGNVVQPRLTVQSPANFPVSSSIDDLSDPPPQSILPNPSSRFHEPPPAPVPEHLANGGHLMPPDVRTETRIPSPRRALTRALELAREAVQLDS
# MNDNPELAVAAYGRSVALLSEVMERVRNGEESTESTRRRNGRRRSVFAQEDEIRRLQSIVSFHIQPVPYHSTNIYSPTTATPSTSLGSTAPTSPTNSS
# SPVSDDNPDQIPVRISHSDNTEDDYQGVHQADEGMTAIGAAMFMRDLASPTRSEISGLPSSGAPLPSDGQQQQGRNERPPLPSTANGVFGVPAVHPQR
# FSRSPLNAQSLTVQTDLTTNSLAAPLSAMAGVPLTPTSPLPPVPPTDPLRKPYHLMNLLRTTMISGTGGYITRRLHVPQEVWSQGGAKLGNLMEKVRV
# VDILCTALEDLQGFSSECFGAGNVSSGMALGIGSVGRKEGEAWIAKLEDFSTVCDGVVANFGKKLGVGEGFVIKKTTWGDKLGRRFDKLTNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g384
###
# start gene g385
Scaffold_10	AUGUSTUS	gene	84079	84753	0.6	-	.	g385
Scaffold_10	AUGUSTUS	transcript	84079	84753	0.6	-	.	g385.t1
Scaffold_10	AUGUSTUS	stop_codon	84079	84081	.	-	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_10	AUGUSTUS	CDS	84079	84753	0.6	-	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_10	AUGUSTUS	start_codon	84751	84753	.	-	0	transcript_id "g385.t1"; gene_id "g385";
# protein sequence = [MDALVDGMNGGEEIGLSSRSRFGIPNHHPLYQPPLPTPPPGVVLGGGKSRRQKKPPRLVHRSSFSDQDDDQDNGPPTA
# TPKRRRPFSPGRSTSNATITLASPSSRSPQSSAPPTPIDTESSLYSARPRTAPSTPSSADKRKSLAPSISDIIRAHAPQEAQARARASPLSRAPSYSR
# SVGHTTVREESEPEPEPITAEEEADLLSRSSIDSIATRFDEPFVIKLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g385
###
# start gene g386
Scaffold_10	AUGUSTUS	gene	85987	86418	0.92	+	.	g386
Scaffold_10	AUGUSTUS	transcript	85987	86418	0.92	+	.	g386.t1
Scaffold_10	AUGUSTUS	start_codon	85987	85989	.	+	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_10	AUGUSTUS	CDS	85987	86418	0.92	+	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_10	AUGUSTUS	stop_codon	86416	86418	.	+	0	transcript_id "g386.t1"; gene_id "g386";
# protein sequence = [MPDFIDYLRSEVVTNFPISIPEITFDLFKQAVLPNVGESSVEKAHQKLREWGILIDEGWKGINFGADEQEQQQEAEEE
# EEEELKVTMEIEVEEIEVQKESLFYAPLFEGLNSIMGADSAVKFLKNSYTNLLSEGDHSHYSLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g386
###
# start gene g387
Scaffold_10	AUGUSTUS	gene	92662	96134	0.53	+	.	g387
Scaffold_10	AUGUSTUS	transcript	92662	96134	0.53	+	.	g387.t1
Scaffold_10	AUGUSTUS	start_codon	92662	92664	.	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_10	AUGUSTUS	CDS	92662	94894	0.61	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_10	AUGUSTUS	CDS	94936	96134	0.85	+	2	transcript_id "g387.t1"; gene_id "g387";
Scaffold_10	AUGUSTUS	stop_codon	96132	96134	.	+	0	transcript_id "g387.t1"; gene_id "g387";
# protein sequence = [MDPSSSSSSSLSSGANRASRFSTLKVFGKLGKNKEKDSPPPPPPPKDPYYLNSNRSFVSISTQYAQRTSPGSIHPASS
# TMSLASSATTADSDALLNPPSSARVKQKKSGFFSLKKRVAEENEPVKPPEDENISMPWNFQVKEYHLCKSLSNKIAQHNIHIDEGYGGMPPSWTVSLA
# EAGFTPDEIAAIYSRKQGGTFALDQTRSPAVLINPAPRSTSLPRQYSDTSLRSASSLASPPPVPLNPLIGRKVQQRSRNNSSSSSSHALSISLDSTSD
# AKLRPNVVIEQSRDEAEPHHRSNGSFSGQPQMQKSSPLGTNAPVNLSGPSTPPRRAYFVANANVVQSPPPAYHAGNVASQDGYIAEKNEQTDESCNEV
# EGDSYSDSGSHRHHTSPPNYDRNVPSIIPLTPLTLPDIGSGLGLGNLGFDFDLTLSDGRGDSSSNSLQLPSMFAVPPVVIDDTATKRTTITPSSMSIS
# PIYSSYLGHGSSSLLAAPLFSTGPPASPTDPFPRSPSPPLTPLSSPQSVSVSEDPEPPLTGSTVSTMTSVGMPSTSTHASGLFNEIQGMLAPGGMTST
# ESDFPGRQKKQSRGINGKNRDKELTPIERLRGYNGLDDEDHEDEDDFKDEGQDPLAEERWTSPAISESLSPTLPPPSPDFIRQYQSKAPAFQTQGQGE
# KREHDDDSSSRNHDGDATSDSSTLSLSANHHNFRNSSRSSTSTVSTLSAATVTQATRVTATSTVIQRAVATKITVGVPESASIGSSFFAVSPSVSSAA
# STAIHGPCFSPKLYIWGSEEEEASASSSRMSGSTSTSTSSSLSPKTDTQTEDDEDGIGLVYYLDSPLPTQTVFDRTTTQVHKPESVIGVPHEQHRLPT
# SRSDTFGVYPDEEDSYDTLEGNEDQALITEKAEQKTLSPISSRSTGNSDSCLPSMTSAPVRPSILISNNTNMTLGGPFTAPPIPGSSPFSSVTPITPN
# QRYRGWLSEIVKPLEEFIDEPIDPRDYYLDLTEVAEGESGSVYAARISDNANLARLSKLPPLIKARDVEGQANGETMFVAIKTVPILPSGSAKLDELR
# KELNMIRGIMHGNILAMHALYVDSVEDSLWIRMELMERSLADVVVLCEEGLVLQERVIARFTHDVCLHYCQQGYQKLTFVATDRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g387
###
# start gene g388
Scaffold_10	AUGUSTUS	gene	112240	112746	0.31	-	.	g388
Scaffold_10	AUGUSTUS	transcript	112240	112746	0.31	-	.	g388.t1
Scaffold_10	AUGUSTUS	stop_codon	112240	112242	.	-	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_10	AUGUSTUS	CDS	112240	112524	0.47	-	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_10	AUGUSTUS	CDS	112606	112746	0.38	-	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_10	AUGUSTUS	start_codon	112744	112746	.	-	0	transcript_id "g388.t1"; gene_id "g388";
# protein sequence = [MRVQPGDKPAAGFSWGDYEDVVGGDGPSGEPDADGAEADREDDGWGVKIRSLPPLTDRSNKQNCDCTGDDEQRQRQNA
# ARREAEKSAKADSERERIAALARHQRELDSARMEAQYGKSGGKKTTSGGMKAVIDEKGKLVWD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g388
###
# start gene g389
Scaffold_10	AUGUSTUS	gene	112945	113937	0.86	-	.	g389
Scaffold_10	AUGUSTUS	transcript	112945	113937	0.86	-	.	g389.t1
Scaffold_10	AUGUSTUS	stop_codon	112945	112947	.	-	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_10	AUGUSTUS	CDS	112945	113937	0.86	-	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_10	AUGUSTUS	start_codon	113935	113937	.	-	0	transcript_id "g389.t1"; gene_id "g389";
# protein sequence = [MGTTQSYLSPEALVTAAVVAGAVGFGYKQVTSSEPANGSTSPKTVGGGGGKKGKGKKKPNTTSGTSTPITEGIKTPEN
# ISILPFPAVVPGQFDDGAPDSSAGSGAEGKPKAKKGKKKKAGKAADAQAKSSAAPDTAVEESVVSPAAAAALADSNSSHVTNSSTKLSTKSKKKKQQA
# PSQVKPSASFSSTSTRDVPTPSKANTAQQLQESTASLASLATDTDGEWTRVTHRADKIHTSSIAGGTSDVGQATSITTGSSSPVDTRTEEEEDGEDEE
# EDVLGGSSERHPLAKRLLPKPRKTGVEEWVFFIFTFRSLLPLTFSFFRSFPRIPCI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g389
###
# start gene g390
Scaffold_10	AUGUSTUS	gene	119210	120439	1	-	.	g390
Scaffold_10	AUGUSTUS	transcript	119210	120439	1	-	.	g390.t1
Scaffold_10	AUGUSTUS	stop_codon	119210	119212	.	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_10	AUGUSTUS	CDS	119210	120439	1	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_10	AUGUSTUS	start_codon	120437	120439	.	-	0	transcript_id "g390.t1"; gene_id "g390";
# protein sequence = [MVLAAELPQISISLAPPEQPIVEPFSPFSWVKAAVNDDDGFRSTHLTPPPTHVKFSTNLPSPLGPTDNKAKGLERDRF
# EALLKATRERNAFSGGKKDSDLRKEIALKAHKNKQGSCHEFAVSYLQTHFEPVERRALFLSKVLAPPSPTATNQPVTPPESPAVFHFRFPSPGLVSPL
# ALFESLNEDSPTGPLSYPVDPWVEQVDYRLPYQESFVKVKGPKYTNSKQSLPSLEQISARLGPNHVRIMSSESNGRTTRLPNFLAQRQVSAPVGERSP
# LISGIGRSQLPIKTPQLSKVEPATVLPPPKSPSSPLTPQLQVTTLVVPSFSSRSPTELSESNLNALQSRERKAKDMLSTLRRRVAPSDDGVLQGHESV
# PKLMLDRRWKRHSAPADIASRPRAGFEHPVLSIKGAF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g390
###
# start gene g391
Scaffold_10	AUGUSTUS	gene	122287	122849	0.99	-	.	g391
Scaffold_10	AUGUSTUS	transcript	122287	122849	0.99	-	.	g391.t1
Scaffold_10	AUGUSTUS	stop_codon	122287	122289	.	-	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_10	AUGUSTUS	CDS	122287	122641	0.99	-	1	transcript_id "g391.t1"; gene_id "g391";
Scaffold_10	AUGUSTUS	CDS	122692	122849	0.99	-	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_10	AUGUSTUS	start_codon	122847	122849	.	-	0	transcript_id "g391.t1"; gene_id "g391";
# protein sequence = [MTRPAFWLRCEKKEFERRAALTPTTAKKLIDAGFQIIVERDEQRIFDDSEYEAVGCELVKNNSWPSAPKEIPIIGLKE
# LPASTDPLPHSHIQFAHCYKNQAGWADILSRFDRGNGTLYDLEFLEDANGRRVAAFGFHAGFAGAAAGALALAAERRGENLANLTHTQMKRP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g391
###
# start gene g392
Scaffold_10	AUGUSTUS	gene	125140	125610	0.3	+	.	g392
Scaffold_10	AUGUSTUS	transcript	125140	125610	0.3	+	.	g392.t1
Scaffold_10	AUGUSTUS	start_codon	125140	125142	.	+	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_10	AUGUSTUS	CDS	125140	125610	0.3	+	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_10	AUGUSTUS	stop_codon	125608	125610	.	+	0	transcript_id "g392.t1"; gene_id "g392";
# protein sequence = [MSSFKRKSTSKTEILPGTRTSPGSITNIITSTGVPSLDDILGGGLPLSCSLVVAAPDPHSSYGELVQKTFVSQGLACT
# QDVLVVGSNQDALEWVKGCMWFHNSVSSNSSLEEGNEGQEPENAEQKIKIAWRYEQMKQFQTTVGSASYVSLPRCTGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g392
###
# start gene g393
Scaffold_10	AUGUSTUS	gene	126390	126701	0.39	+	.	g393
Scaffold_10	AUGUSTUS	transcript	126390	126701	0.39	+	.	g393.t1
Scaffold_10	AUGUSTUS	start_codon	126390	126392	.	+	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_10	AUGUSTUS	CDS	126390	126701	0.39	+	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_10	AUGUSTUS	stop_codon	126699	126701	.	+	0	transcript_id "g393.t1"; gene_id "g393";
# protein sequence = [MHLDVEGGVGERRITPAPVTNVIDNSARVTTVVPVSETSLASVKIEVELEPVAEVKAARISSETAFDNNGGSVVEEAQ
# ERKQRLKKPKKTVAFFSDRPDLYDF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g393
###
# start gene g394
Scaffold_10	AUGUSTUS	gene	130432	133551	1	+	.	g394
Scaffold_10	AUGUSTUS	transcript	130432	133551	1	+	.	g394.t1
Scaffold_10	AUGUSTUS	start_codon	130432	130434	.	+	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_10	AUGUSTUS	CDS	130432	131017	1	+	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_10	AUGUSTUS	CDS	131078	133551	1	+	2	transcript_id "g394.t1"; gene_id "g394";
Scaffold_10	AUGUSTUS	stop_codon	133549	133551	.	+	0	transcript_id "g394.t1"; gene_id "g394";
# protein sequence = [MHAQLPDPSTYPDPYPSRNTPYAVSSAESSTASTRSSAYTSFGSTINDLAHVHILESDDLVGLGITSDSVVQLLGGDT
# VPGQSRAPIDQTRWSDLYSSGARSRSSSVASNHPVEHAPPKLREQSSYDMSWSTVDERDEVGISEDETDDDHLLTEDDFDDELGEEERTSAVIVAEEG
# RGLIVQANNMPVPQLQVQSGTTHLLIGSSTTPNAMPSFLTSTIPQISISLLALDISANFLGALPPVLALCHSLEELNIASNPLRVLPVFLADLTNLRV
# LIADATGIATLPDPLADLDKLHTISVRRNKMHALPSWLCLLPALQALYVDGNPFQGPWNALVEPLLARIPMTPVYPLSTPTFPLPSSSAQSSSFDTSD
# IDPDELSEPPSSAQNDNRFALRGDDSEDHTITPDKAPLLARRMPSQVESVNSQSTSQSSRISSRALRNQPQQLSPRPLTRTRTTPNRSYYQNRGNKSP
# ISPNHPPSNTSSTMPSPLPSTIDSHHSEDSGYFGDHEIRKMKSAGDLRRGRSATAGLEPSPPERPTLSHYATTSRSSSNLLNTGSPGRSLTDSERPGM
# PKRFASLGAATTLSTPEPVQRPNKSSRPALTNSIWDDISETDDSVGGSPSSNRGSQATLPARIEISSARTSPPSRSSGTGKEGLDSKTPSRSRKDGKE
# KGSRWGFFKKMSMGKMRPDIPPSRPGTSNGPLSPGSGINTTSRPQLRNGNGVIGSPERSNQLPQIDMRISTTGALDVMTRHLPTVVAPEIEQVAEDED
# EPPPSIARKISRENLNIYPNPSLLASTNDRSGSASSLLHPPSPTPRSSKRRSFLPIDINGPGSLNIPIPDNSRFVPAVTATNGEGLDHNDHVSEDNRE
# PTPSQYMYTIDHDDYLRKEEERARESYTRALRSVMAYLKDMNDLGLSQSGGASAPEGPRSRRPTMAIDVPGSRENSMALSGSTAVSNSEALRTLSVAT
# TDSTGSNEERKIKDDKAKRAMVAKEILTYVVCSLLLNNFVSHSAPLSELSEPMSRDYKN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g394
###
# start gene g395
Scaffold_10	AUGUSTUS	gene	139351	140778	0.66	-	.	g395
Scaffold_10	AUGUSTUS	transcript	139351	140778	0.66	-	.	g395.t1
Scaffold_10	AUGUSTUS	stop_codon	139351	139353	.	-	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_10	AUGUSTUS	CDS	139351	140778	0.66	-	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_10	AUGUSTUS	start_codon	140776	140778	.	-	0	transcript_id "g395.t1"; gene_id "g395";
# protein sequence = [MQEWQDWVAAPSLPRLFIVPGQSLQQRKGAYEAFLKSLESVQTSADFYSGTFDNKPNNGSSSSPHEEVAQTGLREANL
# PLTELMELSPRPPSAQSRPPGASYSILGTERKQGTHNAIDTPPRGLDPFHSKLNQAPHPSPSAISERLALLHSLAESPIQAPGDLLPSLARQLLNTEM
# TKVQRSWLTRKRTASSDIQDSERPIKRTRLDDEVSKSSVPFTVATKGPSLTSAAVPSPAGWDTVNPETSSSSEPGSILISESDRLGLGTYDWLANLRY
# PSLPPSQRKHETWTRVAMQNLGNCALQELPHPDLIQLYPHHPRWAEPDVQVFLGRLHKVEKGLAWAALQNPDRRITGPRHPRSLGNLKRTLSEIQHNL
# EQSSAGALIRGQEHSRHEMNDAHDAAECAVLGPSDTDMAKVKRPNHLSSPYDAPLDYDGLPRKVRFASPTSNAGSENTKTPHGCSQPWYQRPFSLLTQ
# VFNWV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g395
###
# start gene g396
Scaffold_10	AUGUSTUS	gene	142284	143282	0.97	-	.	g396
Scaffold_10	AUGUSTUS	transcript	142284	143282	0.97	-	.	g396.t1
Scaffold_10	AUGUSTUS	stop_codon	142284	142286	.	-	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_10	AUGUSTUS	CDS	142284	143282	0.97	-	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_10	AUGUSTUS	start_codon	143280	143282	.	-	0	transcript_id "g396.t1"; gene_id "g396";
# protein sequence = [MRPSISNSFHALPPILSGSSVHFNFQSLMISSGKTPRSRRASRLSENPPALPPLPSLSQPLFPPAAETAQKDLFQMPS
# LRHPNSPYVPWDSPMRRQIFPPLTTESSESLSSRSECSRSGARAPEPPNISDDDHKLVRVSRGIRKVHRTVKHVAGVAKRMFMRQKHVQASSVPPLTI
# NTHIPAHSVHPPAYPPSPGVASLDSSNTRSLALWLDARHQEILDWDADSCHFMSLEDYERRGSWINLAGERTFVCSLPGCSIHSRLSNAVTSFELEPD
# TLCYEQRADEQNEQANTGSGRASHDSDKTAISEILLDQKTKDFSRTTLLVQTSTCGPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g396
###
# start gene g397
Scaffold_10	AUGUSTUS	gene	154306	154770	0.92	-	.	g397
Scaffold_10	AUGUSTUS	transcript	154306	154770	0.92	-	.	g397.t1
Scaffold_10	AUGUSTUS	stop_codon	154306	154308	.	-	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_10	AUGUSTUS	CDS	154306	154770	0.92	-	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_10	AUGUSTUS	start_codon	154768	154770	.	-	0	transcript_id "g397.t1"; gene_id "g397";
# protein sequence = [MFDSFQTYEKGNISRHFSLLKIGDRIRVKGPKGAFIYNNKLTGHLGLIAGGTGISPMYQIIRSSIWDHSDATTINLIY
# ANVNEEDILLRDELEHLHHNSAGRFNIFYVLNNPPPGWKGGVGFVTKEQVAHYMPSQDKDCKILMCGPPPMMSAMK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g397
###
# start gene g398
Scaffold_10	AUGUSTUS	gene	155714	156397	0.39	+	.	g398
Scaffold_10	AUGUSTUS	transcript	155714	156397	0.39	+	.	g398.t1
Scaffold_10	AUGUSTUS	start_codon	155714	155716	.	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_10	AUGUSTUS	CDS	155714	156397	0.39	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_10	AUGUSTUS	stop_codon	156395	156397	.	+	0	transcript_id "g398.t1"; gene_id "g398";
# protein sequence = [MQRKKGPPSAIKTDMPQHSRIAVALGDPASASDSDHTSSPRPMSLRNMKKLSLTLPSAQSSSLSLGLQSEPQSANSTA
# QPELPGPRPRRPSVISLPPPTANPTVVSFLQRNREQEGDPAVPYADGPIQIIPGIWLGSEDNARDWTGLIERGIKSILNVAKEVASPFEPAKPHSLRV
# AVSTPNLNKTLDSTATYHPPHPATGRPGLHYLKLPWSHGQRIWLQTVFLLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g398
###
# start gene g399
Scaffold_10	AUGUSTUS	gene	156666	157185	0.27	+	.	g399
Scaffold_10	AUGUSTUS	transcript	156666	157185	0.27	+	.	g399.t1
Scaffold_10	AUGUSTUS	start_codon	156666	156668	.	+	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_10	AUGUSTUS	CDS	156666	156670	0.27	+	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_10	AUGUSTUS	CDS	156720	157185	0.99	+	1	transcript_id "g399.t1"; gene_id "g399";
Scaffold_10	AUGUSTUS	stop_codon	157183	157185	.	+	0	transcript_id "g399.t1"; gene_id "g399";
# protein sequence = [MSLIYQLLDYERKLKGQDANSPSSDRSSMIADEEAEWSRRRQMMEDEDEDDHESRLVMQEAQALDKAMEDRVVARKNS
# ASSMSSHGSSFSGVGMGPAWRSRYSRKRTGSVASNTTNGSLISEDLVEEEEEQELLGVGGGFESTAQIPIWSAMKKKM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g399
###
# start gene g400
Scaffold_10	AUGUSTUS	gene	165458	166576	0.31	+	.	g400
Scaffold_10	AUGUSTUS	transcript	165458	166576	0.31	+	.	g400.t1
Scaffold_10	AUGUSTUS	start_codon	165458	165460	.	+	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_10	AUGUSTUS	CDS	165458	166576	0.31	+	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_10	AUGUSTUS	stop_codon	166574	166576	.	+	0	transcript_id "g400.t1"; gene_id "g400";
# protein sequence = [MQLLSIDVSKPVIGMILTTGLNSNEIERDFLPDYVVEYVSYIVGHPVDHPSDQLIMLFPMTRGRSQSRRHRRPAKISP
# CSDATSFVERVLHKARVKMSEVLAALAYIDRARPFLQISSDTKYPFERVFLGALIIATKVCFSPVYLGPCMASLQVELTVGCSFSMILVSRICTGHNA
# VACSGSTISVASNENSSRFLTGTLTLTEEDLLVHYDSLILIDFPEAPDITPSSIQYPSKSVASCPHNEEEETDGLCPSSPLSFPYQRSKTTLPVCLPQ
# VGSSCSPTVSLPSSVPLSPSTPDLELDSAYSSFDTDIESSSSPLLPTPPSSGLSLEGDEDNRSGGRKSSESFWYTYFANMRIQEALSPIVRSQKAGNL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g400
###
# start gene g401
Scaffold_10	AUGUSTUS	gene	167170	168148	0.57	-	.	g401
Scaffold_10	AUGUSTUS	transcript	167170	168148	0.57	-	.	g401.t1
Scaffold_10	AUGUSTUS	stop_codon	167170	167172	.	-	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_10	AUGUSTUS	CDS	167170	168004	0.95	-	1	transcript_id "g401.t1"; gene_id "g401";
Scaffold_10	AUGUSTUS	CDS	168075	168148	0.57	-	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_10	AUGUSTUS	start_codon	168146	168148	.	-	0	transcript_id "g401.t1"; gene_id "g401";
# protein sequence = [MGSGPWGAVIQKTEENDWDSVIASATASAPAASATIAGAIGNSPPSSSVSSAAVSTTEPISSSAISSSSSPVSTSPSI
# SISNATFSVSLSSSIASSSDTSILLAPTTSSTEELSSTSQFTPPATTFSADSSAAEAPSPATTSTPAPAPPLTTSSTPAPAPTTSSVVAAVTSSSSST
# SSGSNGSGASDSDVQEYLSAHNSVRAQHGASALTWSNDAATKAQQWADNCVFQHSGGTLGPFGGLLVCVFFREQDPDRSFRKFGCWHWEWLWNCSSDR
# LLVKRSLYVPFLFVTFRQSHDIYFLSTI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g401
###
# start gene g402
Scaffold_10	AUGUSTUS	gene	171012	171410	0.54	+	.	g402
Scaffold_10	AUGUSTUS	transcript	171012	171410	0.54	+	.	g402.t1
Scaffold_10	AUGUSTUS	start_codon	171012	171014	.	+	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_10	AUGUSTUS	CDS	171012	171410	0.54	+	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_10	AUGUSTUS	stop_codon	171408	171410	.	+	0	transcript_id "g402.t1"; gene_id "g402";
# protein sequence = [MEQKALTSTTPAEKALLASSSPDPPPKKKRGPKGPNPLSIKKKKASNMPTRPVKSLVQVHSDGKSKRNGINIGKLVEG
# NGEKHVSNELSLEAGKRKRTEESEADAVVDDSNIIIGEATGSSRKRKRRRKAKE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g402
###
# start gene g403
Scaffold_10	AUGUSTUS	gene	171488	172297	0.65	-	.	g403
Scaffold_10	AUGUSTUS	transcript	171488	172297	0.65	-	.	g403.t1
Scaffold_10	AUGUSTUS	stop_codon	171488	171490	.	-	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_10	AUGUSTUS	CDS	171488	172297	0.65	-	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_10	AUGUSTUS	start_codon	172295	172297	.	-	0	transcript_id "g403.t1"; gene_id "g403";
# protein sequence = [MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ
# IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
# NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLGESYNIVGFPFVSNNPLHSASSAWWELMSLCYIDSVTFVPYTAYTYSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g403
###
# start gene g404
Scaffold_10	AUGUSTUS	gene	176960	178036	0.81	+	.	g404
Scaffold_10	AUGUSTUS	transcript	176960	178036	0.81	+	.	g404.t1
Scaffold_10	AUGUSTUS	start_codon	176960	176962	.	+	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_10	AUGUSTUS	CDS	176960	178036	0.81	+	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_10	AUGUSTUS	stop_codon	178034	178036	.	+	0	transcript_id "g404.t1"; gene_id "g404";
# protein sequence = [MSRPNILVLGLMDEDYLSDLFSPLMSSMRAVATVKSVTRIKEAKAILSSNTPPTAVLSIDAAPTQSKYRSLNEQLVRF
# ARAGGVVVFGCNFSNHFSFDTAERFFRAWGVPWKLGDYHRTTVYLNADGVQGMDLTGLESSYSVKALNLAQVLPTSAVYSPSQDSRTQSHVFAATSVD
# TSQTPAAYSAIGDGYMGYTGDVNAEEPTTKVIMAMLHLPINQIVPDTSDRIVGVSFGPGGVMRQIRQSEMNARTTAASENPGAASSSPQAETSEPGDS
# ESESSSNSSYEKYEKGRRGTARGIPPRIVSSVPRPREAEVKARAVRRNQVNERKKAAAEKLKDKVQFPATYRGHFWRSYCLSVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g404
###
# start gene g405
Scaffold_10	AUGUSTUS	gene	178419	178769	0.66	+	.	g405
Scaffold_10	AUGUSTUS	transcript	178419	178769	0.66	+	.	g405.t1
Scaffold_10	AUGUSTUS	start_codon	178419	178421	.	+	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_10	AUGUSTUS	CDS	178419	178769	0.66	+	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_10	AUGUSTUS	stop_codon	178767	178769	.	+	0	transcript_id "g405.t1"; gene_id "g405";
# protein sequence = [MDPNCAEFKTELEAARKERDEENKRQGYNEDDADRYDVDSDYEAKLVFNLGRDFAPERTVHVLDCPSDSEEHQHKGKG
# KGKGVKLPCRYYNHKGCQFGKVCRYKHAPDDRSIRDEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g405
###
# start gene g406
Scaffold_10	AUGUSTUS	gene	178899	179315	0.89	+	.	g406
Scaffold_10	AUGUSTUS	transcript	178899	179315	0.89	+	.	g406.t1
Scaffold_10	AUGUSTUS	start_codon	178899	178901	.	+	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_10	AUGUSTUS	CDS	178899	179315	0.89	+	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_10	AUGUSTUS	stop_codon	179313	179315	.	+	0	transcript_id "g406.t1"; gene_id "g406";
# protein sequence = [MYLPPNGWWNEENLGGWQELYDLVKDDMDDGVFDRIGSAMNGTADIWRIRDNLDMLVDDWQNAADDGSDDDSDDDFYG
# LGMTRGRRARDMQFEREMEERAGNLGFTEDEVNELLCQGVKPWDDDAWVFNKRLRFTIID]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g406
###
# start gene g407
Scaffold_10	AUGUSTUS	gene	181785	182618	0.39	-	.	g407
Scaffold_10	AUGUSTUS	transcript	181785	182618	0.39	-	.	g407.t1
Scaffold_10	AUGUSTUS	stop_codon	181785	181787	.	-	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_10	AUGUSTUS	CDS	181785	182260	0.77	-	2	transcript_id "g407.t1"; gene_id "g407";
Scaffold_10	AUGUSTUS	CDS	182609	182618	0.41	-	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_10	AUGUSTUS	start_codon	182616	182618	.	-	0	transcript_id "g407.t1"; gene_id "g407";
# protein sequence = [MRKYERDDEEAQIGGAFEEEEPEDFEEEDLQTPTVLSSQNDVFVDQFQWDDFDNTQASGEAPTISYAPRRRASERQPA
# AHEGTPLLKSKASRLSTASGTPAVNEGPSYGLNDSGEVSHSHTIISARRLSTTTKAESRHHSGGKSTFGQTVCSLAVHKFTHR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g407
###
# start gene g408
Scaffold_10	AUGUSTUS	gene	183437	185905	0.33	+	.	g408
Scaffold_10	AUGUSTUS	transcript	183437	185905	0.33	+	.	g408.t1
Scaffold_10	AUGUSTUS	start_codon	183437	183439	.	+	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_10	AUGUSTUS	CDS	183437	183810	0.6	+	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_10	AUGUSTUS	CDS	184580	185172	0.78	+	1	transcript_id "g408.t1"; gene_id "g408";
Scaffold_10	AUGUSTUS	CDS	185229	185905	0.77	+	2	transcript_id "g408.t1"; gene_id "g408";
Scaffold_10	AUGUSTUS	stop_codon	185903	185905	.	+	0	transcript_id "g408.t1"; gene_id "g408";
# protein sequence = [MAAVQPPTDGPLITDNDHELEPPKSESQSSPDASEDVNKEPAQVYSQPSPSLRIYSRPQILALSKSPLVCVPPNMPEL
# RDWFGFVILSTTQFFRFNEPSFSAENEQNLSRKESEPLTPNSGRERRDRGDDDESRRWRDDGRRDERLASRRERERGPNSNGKDKDPNAGNPNDRRWT
# VVEERDARSKRNTGRDKRSFPEEARTDDRRGDREKEKEPAWMDTYVPSSSTGGILGSKGNEGELDGIQAWKKNLKEKEQKAKTAPVASGVDSSNDSPT
# MTIIEEPMDEIQRFKKMMEVAQKQSSDPPMMVGPILGLTDTPKLSSTRDNDNVSIPKLPDANPGGEVIAASASSKLDIASVPDPSRSLLSLLNSNHDV
# PLSADTDLTAPKLHSRLPLADNPADRLNIDTSFNPPQGSRLLALGNRAPAKPVAPSSQYMPSAIPNGGPTSASTITPKPQIPPPLTGFVNLSNPLTLA
# TESSKVAPRTPSSFSPFEEQRELGDTLRRQVGERSPFVTDSAGTWPDPSPSILPMQGMLWGRAVGLPNSSTGKGRRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g408
###
# start gene g409
Scaffold_10	AUGUSTUS	gene	186364	187149	0.82	+	.	g409
Scaffold_10	AUGUSTUS	transcript	186364	187149	0.82	+	.	g409.t1
Scaffold_10	AUGUSTUS	start_codon	186364	186366	.	+	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_10	AUGUSTUS	CDS	186364	187149	0.82	+	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_10	AUGUSTUS	stop_codon	187147	187149	.	+	0	transcript_id "g409.t1"; gene_id "g409";
# protein sequence = [MYAADPLDDALLLNAQQRLPIQQQRGVEQLFGGSIPASFAQQQQQLARSAGIPVQAPQFRGGPSPVSASQNMLHTAQQ
# QRMPPGLANLGARPPHDPAQFIPAPLHNGLHINGPPQQPQQSFNNFHPTGGFGGPQGPLRPPVHQLQNTMNHHQLAGLGHPGTLDSRNANQHAQLLAL
# GLGGAGGLRNISGGGGGGGFNHQAGNSLQNQMLAMRQQAQQQQLHPQMLPHHLLPPHLQQGPPVPTAQTTSAQDLMALLMGAHRE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g409
###
# start gene g410
Scaffold_10	AUGUSTUS	gene	191471	192496	0.61	+	.	g410
Scaffold_10	AUGUSTUS	transcript	191471	192496	0.61	+	.	g410.t1
Scaffold_10	AUGUSTUS	start_codon	191471	191473	.	+	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_10	AUGUSTUS	CDS	191471	192496	0.61	+	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_10	AUGUSTUS	stop_codon	192494	192496	.	+	0	transcript_id "g410.t1"; gene_id "g410";
# protein sequence = [MSSTQSMDQQPEIRWHMRPCLVDFLVEIHFSFRLRPETLYLTLNIVDRYVSRRIVFIKHYQLVGCAALWIAAKFEDAK
# ERVPTVQDLVQMCHDAYEESAFLQMEGHVLSTIQWTLGHPTAEAWLRLMCCGPCMEEPKVQHVARFLMEITLFYREFVKYAPSSIALAALTLARFLCG
# KPARVWEETDECLEIVDLLDTRLAKHVNDLSETLVKKYSYAFYSKAATFVVQYYLQGGKFNRIATAAFPVTPTRSVPISAVSTPMSCSTSVSDGSDDF
# PLTPITPVLHPSSDYDDKENRPTTFEPVYNKHRIDSPPEQFLPHDFVTFSRPALHSLNVSSSPRAYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g410
###
# start gene g411
Scaffold_10	AUGUSTUS	gene	197559	199336	0.02	+	.	g411
Scaffold_10	AUGUSTUS	transcript	197559	199336	0.02	+	.	g411.t1
Scaffold_10	AUGUSTUS	start_codon	197559	197561	.	+	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_10	AUGUSTUS	CDS	197559	197734	0.12	+	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_10	AUGUSTUS	CDS	198328	198362	0.18	+	1	transcript_id "g411.t1"; gene_id "g411";
Scaffold_10	AUGUSTUS	CDS	198447	199336	0.73	+	2	transcript_id "g411.t1"; gene_id "g411";
Scaffold_10	AUGUSTUS	stop_codon	199334	199336	.	+	0	transcript_id "g411.t1"; gene_id "g411";
# protein sequence = [MASPLHSQPYALKLDNSSFVPRKEFQIAPRRNPSSFSLLCFAGSNMLRLYAFPSSVVSACKNSLQPICRCDAHSFTLQ
# ASISLTNRSRNKDFWIFTGPPPPDELNSQAPSIHDTSHTDFHGQQQHASGLHTRTATEPILSSSPLPPSYHARIATDNVGRNSPSGSSGSLPSPGLRK
# AAPRAQVPVSVHDTDIDIPETLGYRVDLPSVVPDGVENMTGVGAASQTPDVFYSTSPFGDLSAAPIPLSSSPHAGVAASPPASPRKTQPLQHSHTSSE
# STPIDPSIKSLEMEGDLLSPGVFKNSGIYRDSAFSSNSDVSAEIPIKWTGAHRESQQSGKRSVFQKDRNSLEVGRPRPLKRRRKSMPQGECL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g411
###
# start gene g412
Scaffold_10	AUGUSTUS	gene	201674	202939	0.51	-	.	g412
Scaffold_10	AUGUSTUS	transcript	201674	202939	0.51	-	.	g412.t1
Scaffold_10	AUGUSTUS	stop_codon	201674	201676	.	-	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_10	AUGUSTUS	CDS	201674	202939	0.51	-	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_10	AUGUSTUS	start_codon	202937	202939	.	-	0	transcript_id "g412.t1"; gene_id "g412";
# protein sequence = [MLATFGVGMVPLGWFTAIELGMSQWAAHLVALMVLFDVGWLCISRFILLDSMLLFFTFLTVFCLSKFHNQQSHPFDFD
# WWTWLAMTGISIGLVTSVKMVGLFVTALVGIYTLQDLWDKFGDLHLTPREQAKHWGARVLCLIIIPILVFMATFKIHFLILNHSGPGDAQMSSLFQAN
# LYGNDFHNNPLEIAIGSKVTIKNMAFGGGLLHSHVQTYPTGSNQQQVTCYHYKDENNEFWFWPGWDQKDTVWDPKYGSHDPNDEEVRFLKHLDVVRLV
# HVPTTRNIHSHTIPAPVTKANWEVSGYGNATIGDVQDHWVVEVLGDVVRGDVNRYLEPKSATVDPRARIHALTTRLRFRHQVLGCYLSAGRTSLPQWG
# FKQIEVSCAKEEAGSKPAEGTIWNVESHWNTKRKSSPLRSENYIILTFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g412
###
# start gene g413
Scaffold_10	AUGUSTUS	gene	207302	207946	0.8	+	.	g413
Scaffold_10	AUGUSTUS	transcript	207302	207946	0.8	+	.	g413.t1
Scaffold_10	AUGUSTUS	start_codon	207302	207304	.	+	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_10	AUGUSTUS	CDS	207302	207946	0.8	+	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_10	AUGUSTUS	stop_codon	207944	207946	.	+	0	transcript_id "g413.t1"; gene_id "g413";
# protein sequence = [MNVLMGEAKEEPVDEDARIEDPSDMSDVPASDNGSDSGKSKKSTSKSKDLRQKAQLQAHSKQREAARAKQASAKQAMA
# EHRRLDEEVNKLERRLEAIEREFRKLLGGVRVKPMGKDRFYNRIWWFDGLGSASLVGSGGATQYGAGRVFIQGPSEFDLELMMRRTDDEVPVQIRRLE
# EEGQEGMLGPGDWAVYSDMDEVCPFSLMAGIVDHIVIT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g413
###
# start gene g414
Scaffold_10	AUGUSTUS	gene	209985	211161	0.3	+	.	g414
Scaffold_10	AUGUSTUS	transcript	209985	211161	0.3	+	.	g414.t1
Scaffold_10	AUGUSTUS	start_codon	209985	209987	.	+	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_10	AUGUSTUS	CDS	209985	210581	0.35	+	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_10	AUGUSTUS	CDS	210634	211161	0.46	+	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_10	AUGUSTUS	stop_codon	211159	211161	.	+	0	transcript_id "g414.t1"; gene_id "g414";
# protein sequence = [MLTFLELYQTLLGFVFFKLYTDVGLVYPPPLDAKRDESAAGVGAYLLQEASQKSDKPAVTKVKVVEVEGRQVSGRDVY
# KTIKNIASSSSNADDMDVDAPTVENNFGETEEEFIVQPSKSDAEMASSLPTLQSLKALPQSINTSLFAPYTFWLSRETSRPIFEFLVRSFGGKIGWPA
# SSGGGSPFDESDDSITHVIIDRPRRYVQPQWVVDSINAGKILLEAPYAQGQTLPPHLSPFGEYEGAYDPAALANEEAAADEDESEIEGEDVEIEDADL
# ENEVLQAVATAATEDSATLRAAELAAEAAGIDPSTFEKEVAKSRRKSKKSSSNGVDEAETDMNKMMMSNKQKKLYEKVKHSQDKRNLEVCLQRRFFES
# VG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g414
###
# start gene g415
Scaffold_10	AUGUSTUS	gene	213402	215657	0.18	+	.	g415
Scaffold_10	AUGUSTUS	transcript	213402	215657	0.18	+	.	g415.t1
Scaffold_10	AUGUSTUS	start_codon	213402	213404	.	+	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_10	AUGUSTUS	CDS	213402	213657	0.28	+	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_10	AUGUSTUS	CDS	213775	214241	0.41	+	2	transcript_id "g415.t1"; gene_id "g415";
Scaffold_10	AUGUSTUS	CDS	214297	214612	0.67	+	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_10	AUGUSTUS	CDS	214714	215657	0.68	+	2	transcript_id "g415.t1"; gene_id "g415";
Scaffold_10	AUGUSTUS	stop_codon	215655	215657	.	+	0	transcript_id "g415.t1"; gene_id "g415";
# protein sequence = [MTKADYIKNTRMPGVAPEVLDYFYDNIVFAPFIFVEDPVDVNGQHIYNVDGNRGLPSGSSFSNVNGSTLLGKGNKVDP
# YYLISNVTQGTGGPWNEEELQRAFVNPNVIVMGPLDSSRAPPSSPFFSSGGSTSGPFATGSDLYAPGTETWRLKVTKVGSLNRKEDILEGGKKASNRK
# WKSFSVVLTGSQLLFLRDPAWATMFLNQNGTSTESGFFPQTAIFTPNEVISLKNAVAVYDQSYLKHDNIFRLALADGRQFLFGTDSEFEMNEWISRIN
# YASAFKSTGVQMRPVGMSGKDVQLTGVAAATSHLHDLQHNQTKSEWGSEASRDLMDMLSGESDSPFKRALPKRESNLAAGRCASPDSEPPIEEHNVER
# TDSLPEDDSHLPPRSRIVLSKIRELDTKISASQSQLESDLRFAKNVATLTPFQRSTRERLSMAVQNIAKRVMQVRLDLAKYTCHRKVLLNDMTTESQN
# WSRANKIALRAALETLQSHQRPPVPRMTLSFHESNGLASPEVSIPPKMYTPSVHQSESTAGSLQSFHSAFDFGPEWNSNDDIFSPEGPDPYELDISLR
# NSSSGSLNPELFREEDDVVPLPSRTAELLSNVTSPRASHDEINHHEKYYSARESAEEQAEEWNKTRCAHRVSLVRVPSAIGLARKFERDPSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g415
###
# start gene g416
Scaffold_10	AUGUSTUS	gene	216327	217768	0.25	+	.	g416
Scaffold_10	AUGUSTUS	transcript	216327	217768	0.25	+	.	g416.t1
Scaffold_10	AUGUSTUS	start_codon	216327	216329	.	+	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_10	AUGUSTUS	CDS	216327	216771	0.25	+	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_10	AUGUSTUS	CDS	217341	217768	0.98	+	2	transcript_id "g416.t1"; gene_id "g416";
Scaffold_10	AUGUSTUS	stop_codon	217766	217768	.	+	0	transcript_id "g416.t1"; gene_id "g416";
# protein sequence = [MERYTPTSSFSGPKTLFRVNSGGSIPIIPRSPMRIDANFSDEPIPPTTNELDAKEKARLLKKARKLSRVFGEVPDLLP
# TSNNSRVPNKTPRHRRSISTHGSDSELQLKQHTGRKFSSQSDLASSSESGNRIEISDREAIPPVPSLPRETETGGTSILSAATSLGDCDIQSNLDVDH
# SISPSSTSIHSAESSSIDSNIDENFRERRRRAAKLTQFFGVEYQDITASMPPTGHALEPMHHIAPSEKWEPVRVEPSVQVGVRTNTRRFWGGRGNLKE
# AEVGDVIPKLRELRAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g416
###
# start gene g417
Scaffold_10	AUGUSTUS	gene	218315	218581	0.37	-	.	g417
Scaffold_10	AUGUSTUS	transcript	218315	218581	0.37	-	.	g417.t1
Scaffold_10	AUGUSTUS	stop_codon	218315	218317	.	-	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_10	AUGUSTUS	CDS	218315	218581	0.37	-	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_10	AUGUSTUS	start_codon	218579	218581	.	-	0	transcript_id "g417.t1"; gene_id "g417";
# protein sequence = [MDLTLDYNIELFPLAVNQNFALALASSLARGPPTTNPDANEDEDKDRDVWRPDGKGRRGLEEDYDYVMYGKVIEKRLS
# TAFSLSLIHI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g417
###
# start gene g418
Scaffold_10	AUGUSTUS	gene	219048	219563	0.74	+	.	g418
Scaffold_10	AUGUSTUS	transcript	219048	219563	0.74	+	.	g418.t1
Scaffold_10	AUGUSTUS	start_codon	219048	219050	.	+	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_10	AUGUSTUS	CDS	219048	219563	0.74	+	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_10	AUGUSTUS	stop_codon	219561	219563	.	+	0	transcript_id "g418.t1"; gene_id "g418";
# protein sequence = [MYSEKGYTSLDTDLSLSTDASSVNRMQDFESGAYHSHVSIDCSNIPSTELKSVVRGSFNPFPPVFFARGAACLITQTY
# ISSNPASRLVLISPPASNHSLLSKSLLSHALPEFNFEVKFPIAIVDTPQGMANLQVAGNRLAKDDRVDRIVVNDVEGQDAFVKIEQWMDEIGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g418
###
# start gene g419
Scaffold_10	AUGUSTUS	gene	225003	225797	0.99	+	.	g419
Scaffold_10	AUGUSTUS	transcript	225003	225797	0.99	+	.	g419.t1
Scaffold_10	AUGUSTUS	start_codon	225003	225005	.	+	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_10	AUGUSTUS	CDS	225003	225797	0.99	+	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_10	AUGUSTUS	stop_codon	225795	225797	.	+	0	transcript_id "g419.t1"; gene_id "g419";
# protein sequence = [MSESTAGPSTPSRKRSRWQNSDDDIEEAQQLTINPVKRRIKPKPSKWPTASAVPPVAQIPRYPLHSIYVPPRTHHPPM
# VPSRSVYCYERLNQIEEGTYGVVFRAKDKQTGDIVALKKLKLEEEKNGFPITSLREINALIACRHENVVGIREVVVGDTLTQYVPSPIYKLHVSSSVV
# FYVKSLYRHGFIEHDLKSLLTLMPSPFLQSEIKTLMLQLLSAVKHCHANWILHRDLKTSNLLMNNRGTIMVADFGLARRYGDPVGVGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g419
###
# start gene g420
Scaffold_10	AUGUSTUS	gene	231843	233093	0.66	+	.	g420
Scaffold_10	AUGUSTUS	transcript	231843	233093	0.66	+	.	g420.t1
Scaffold_10	AUGUSTUS	start_codon	231843	231845	.	+	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_10	AUGUSTUS	CDS	231843	233093	0.66	+	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_10	AUGUSTUS	stop_codon	233091	233093	.	+	0	transcript_id "g420.t1"; gene_id "g420";
# protein sequence = [MISLVPTRSRSRGGSVSDVLSVPPLSRLTTEATRPRDVDAKDWAESSDDEAINVVAAGHSGSQALDERTSATAPRHNP
# SFSQSTLSAHTPSGSQSLLHAHSPSIARRTRPANLDLSLVRSGSGIPAPEPSPAPTLLTLRQALAHPPVSRDDRTPEPDTPRGDVDVDDDENDGGSNS
# ISLSQALLESRLPELPPPGTRRPQLPILISSSHPVASPDDEPTSPRNSVSQNSDISRTGSSETQNSSRNRRRRWSLMLTQSLSSPSNDVPPHSAAPDI
# SLSREQTPTRSGRSGSFHSQSRSGTPRRPSSANTDITPTTAFSLAPPLPSGAAAIASTSAASVASASSSRSRFIPRIISHAIQSMKSDSERPSTTGGV
# DSDSKRNNNAPMLSHAPPPKLEYVKLPGTKGSLMIKAVETAKKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g420
###
# start gene g421
Scaffold_10	AUGUSTUS	gene	238423	240338	0.13	+	.	g421
Scaffold_10	AUGUSTUS	transcript	238423	240338	0.13	+	.	g421.t1
Scaffold_10	AUGUSTUS	start_codon	238423	238425	.	+	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	CDS	238423	238447	0.39	+	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	CDS	238530	238691	0.29	+	2	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	CDS	238760	238984	0.6	+	2	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	CDS	239124	239512	0.75	+	2	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	CDS	239637	239796	0.63	+	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	CDS	239884	239974	0.65	+	2	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	CDS	240062	240338	0.96	+	1	transcript_id "g421.t1"; gene_id "g421";
Scaffold_10	AUGUSTUS	stop_codon	240336	240338	.	+	0	transcript_id "g421.t1"; gene_id "g421";
# protein sequence = [MPFTYIIGYGGNETNTGPDDPPPDQDPGPGDTGDDNDYDDASYAQARSLHVDSILELASRHNHSVLDVLPLPQAPFGT
# LSSIPTTGLSTGSLPTPTSHTTSQHIAGSSTAPQAAVQTNKSSKSACTPSPTKSIPPSASQVNPDVRTLAGAGAINDASDGFLSNVLASLISGNRQYI
# KAAINILNAFFLDQDTRMNPNMDFGQVIRGPGNDVGTFTGPLDMRGLVKVINAIMILKRSNSTEWTPELDQQMQAWMSHYLDWLKNSEIGKLYSNHGT
# FYYMSMSALSIALNKPQDAVNAMEEFFGTTFQEQIAKSGEQPFESVRGFNCKPQIPTSGITSHRAISGFGEDWRLSCATIKTAIDFTMGVKPGNENIE
# ELVPHVAAAMAAYGPSQAYTNFLSKESAQNQPFWFYDQPAALLHAPASKAGSSKRSTVVWDEMTTKLLAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/7
# CDS introns: 0/6
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g421
###
# start gene g422
Scaffold_10	AUGUSTUS	gene	241135	241722	0.98	+	.	g422
Scaffold_10	AUGUSTUS	transcript	241135	241722	0.98	+	.	g422.t1
Scaffold_10	AUGUSTUS	start_codon	241135	241137	.	+	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_10	AUGUSTUS	CDS	241135	241722	0.98	+	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_10	AUGUSTUS	stop_codon	241720	241722	.	+	0	transcript_id "g422.t1"; gene_id "g422";
# protein sequence = [MYYRNAQAAVVVYDITKASSLDKAKSWVKELQRQANPNIVIALAGNKLDLVQPSTSQSGTPSSESEDEADDATATPGE
# TPSSPGEPESLRQVPRDEAQAYATEAGLLFFETSAKTGEGIVDIFTEIGEPHTLYLTNNSLNDCYLSVAKKIPIEHILAAGGGVRRPGAPGGRSGNAQ
# EGAVNLEENANKPKDACNC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g422
###
# start gene g423
Scaffold_10	AUGUSTUS	gene	242390	244024	1	-	.	g423
Scaffold_10	AUGUSTUS	transcript	242390	244024	1	-	.	g423.t1
Scaffold_10	AUGUSTUS	stop_codon	242390	242392	.	-	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_10	AUGUSTUS	CDS	242390	243758	1	-	1	transcript_id "g423.t1"; gene_id "g423";
Scaffold_10	AUGUSTUS	CDS	243810	244024	1	-	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_10	AUGUSTUS	start_codon	244022	244024	.	-	0	transcript_id "g423.t1"; gene_id "g423";
# protein sequence = [MSEPIPPPTYDVSASSDVTDSADGHSEPQLLIVPTVDTVNFQKGYLGAEDERAAIEGELQIKGAISEVWDKVTVSLRT
# IETAFDKEIELGICEIILWSRSASPSVTTVPSSLLFAIPLMPDAPQSIVTPCSSLSHILTATLHPVSPDLPVLSKALNVHTKRFTSHLHSVPIAPETH
# SLDQPARVHAEVPRTIYQVGEPIPVYITIPPPPREIVVEDGLRLRNVKTELVQMIKVKRDDADDRLIQQSPSDPNDDAEGTSTSTITMLAPEKSSQCS
# KSPVSPPMEDCSFRSTLARSGASCRFHSSRPVRLRFVMHQTSPFSSPVNNILTLPSPEYEHLDGDTEYASITQHTLLHSVMFQINVHVSFVHVGTRTE
# RISTISIPVTLLPPSASLPQVGSSTDEAYQKKHDRPPVQTNRYEDDLVPHYTEGEAGPSGLPHGAPPPFEERDAPPPFSSSALEASSSARLPTFLESE
# REIIIPSDSDQTFTNLPQSMHLVNGEGSLFGFTVSDVFDGHSEDMQRSTTTALVGDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g423
###
# start gene g424
Scaffold_10	AUGUSTUS	gene	244626	245873	0.54	-	.	g424
Scaffold_10	AUGUSTUS	transcript	244626	245873	0.54	-	.	g424.t1
Scaffold_10	AUGUSTUS	stop_codon	244626	244628	.	-	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_10	AUGUSTUS	CDS	244626	245873	0.54	-	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_10	AUGUSTUS	start_codon	245871	245873	.	-	0	transcript_id "g424.t1"; gene_id "g424";
# protein sequence = [MKGQTPTSGFPINNCPDLFEEVLDLVEDLAFDDVIDSPEAINLQDNPHIVTNREIVDIVYELETQPFAVLERRQGSKH
# PDLGPRQRPANLILTVINIIRNLSVFGDNVPFLANQPRLLDLLLRVCGVSEKASSYVPTSPVLSLTDCLAIRKDVLHILSLLAPAIRLPEGTTSLSTV
# RRIFNLVTSYLVDPAEAVSPIACVQLAGVPLGGNLRPPSLADVALEVFTRLAHSDGNRLVFSKAVSRPSLWCLFVSLVHRLPLQDLDFQLISREIWLS
# YVEKIVMALYTLGFIFPPELKSRAKTDRSLGFKNVMMRIIQKLFVQNGAESRQFFIIIVRRIIETLKIIDDAEDSFDNTKGVVSTLSFGMGYGEVGEN
# DIERGTGLLGGYTDIGWNILLCREVQHDDVMFSELESLIRIEY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g424
###
# start gene g425
Scaffold_10	AUGUSTUS	gene	246240	246668	0.84	-	.	g425
Scaffold_10	AUGUSTUS	transcript	246240	246668	0.84	-	.	g425.t1
Scaffold_10	AUGUSTUS	stop_codon	246240	246242	.	-	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_10	AUGUSTUS	CDS	246240	246668	0.84	-	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_10	AUGUSTUS	start_codon	246666	246668	.	-	0	transcript_id "g425.t1"; gene_id "g425";
# protein sequence = [MEQQKKAQAMRQAAASSTPSANNQHPPTSTNTVSQQRGSGMGFPPSQPPSSSVPSSSMQITTGLPPIDGGSAILDGPT
# LDQDLQGLKRKLEQEEEVKRTRQKTGSFIFFIPNPYRSRTYIFATPETADSVLVSPSTKPSLFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g425
###
# start gene g426
Scaffold_10	AUGUSTUS	gene	247676	248020	0.48	+	.	g426
Scaffold_10	AUGUSTUS	transcript	247676	248020	0.48	+	.	g426.t1
Scaffold_10	AUGUSTUS	start_codon	247676	247678	.	+	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_10	AUGUSTUS	CDS	247676	248020	0.48	+	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_10	AUGUSTUS	stop_codon	248018	248020	.	+	0	transcript_id "g426.t1"; gene_id "g426";
# protein sequence = [MAKSEIDDIFASKGKTRVGPVASTSSPTKSSKKDKKRKRKNESDEKDSAIAEKPKKVPETIIDSSASMHIAKRVKISK
# SNEKAGTVRETKSGKAKKEEDNFKDSRGIGPRGCIG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g426
###
# start gene g427
Scaffold_10	AUGUSTUS	gene	254647	255165	0.44	+	.	g427
Scaffold_10	AUGUSTUS	transcript	254647	255165	0.44	+	.	g427.t1
Scaffold_10	AUGUSTUS	start_codon	254647	254649	.	+	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_10	AUGUSTUS	CDS	254647	255165	0.44	+	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_10	AUGUSTUS	stop_codon	255163	255165	.	+	0	transcript_id "g427.t1"; gene_id "g427";
# protein sequence = [MITVCCATVAIIAVVGVTSEGLLWFMGWACLYCKFANLTDLLTSDLAPGTITSILATHSLGRAVDRHEKETVLQAAAL
# HTRRWETERTRVTGVDRNFASSNRIRRFATRNTDSENPFDDTRALASAYSDSMLSSPSDTPSSPRSFSLRSGFPLCPSPTLQLPTSGRTTRWFP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g427
###
# start gene g428
Scaffold_10	AUGUSTUS	gene	257048	258349	0.39	+	.	g428
Scaffold_10	AUGUSTUS	transcript	257048	258349	0.39	+	.	g428.t1
Scaffold_10	AUGUSTUS	start_codon	257048	257050	.	+	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_10	AUGUSTUS	CDS	257048	257852	0.46	+	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_10	AUGUSTUS	CDS	258063	258349	0.39	+	2	transcript_id "g428.t1"; gene_id "g428";
Scaffold_10	AUGUSTUS	stop_codon	258347	258349	.	+	0	transcript_id "g428.t1"; gene_id "g428";
# protein sequence = [MNEQDEIINRIPIRLSNRLSLQIHQFPLLSRPLQAPPSAEASGKRITARIKPQSRVLEIHVPADTRTEVYNSERGHEF
# GKGQLDDDREKNQERKGGKGREGEEPRLAEIRLRSEEIPHRGVQMLGIVHESKHASHYAPLFRDSLTHQDELHLHPISATHQFRPTLTYLDILSRKSK
# RRGGDDSDSDSDDGPPPDPDEPVPVTAAKKKEKKATAGDAKEVQVSARRTDDKAGNLSQLSNARKEMLAIIRAEQDESWQDLQFCGMTVRCPYHRILE
# CSSLGLLPSLRVFIMLGDDSETDDSDVESSMVAWLNLSSSAPSSSTPEPSTYNLCEAVTTAIRTLQDAQLVDIVAVSQITATEPKTCFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g428
###
# start gene g429
Scaffold_10	AUGUSTUS	gene	262329	263177	0.93	+	.	g429
Scaffold_10	AUGUSTUS	transcript	262329	263177	0.93	+	.	g429.t1
Scaffold_10	AUGUSTUS	start_codon	262329	262331	.	+	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_10	AUGUSTUS	CDS	262329	263177	0.93	+	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_10	AUGUSTUS	stop_codon	263175	263177	.	+	0	transcript_id "g429.t1"; gene_id "g429";
# protein sequence = [MYSTTTTSVLDPSIHAQSPSSSSYSDLARIRSNAFWELRRSVAENGEGFVRRMRDYEQSRARSGTFSKVKDAQKRGRK
# RSSLLARRSQTLRRDSDSEEDDVQIFSGNLSEAFLSKEISSPSMSRSPRQSSLNDMDEDPRDPIQRPERSPSSSSSSYHIFESSSNSPYVFSSDLAQT
# ASLSPPTQLDVTPSSSNSASSTSSSSTSSISFQLPSIPSANLHLTGDISSSSTSAYASASRSEKALAALSLAMANGAGSITEDYEALRALQPILTMDD
# AQIGEMWH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g429
###
# start gene g430
Scaffold_10	AUGUSTUS	gene	265719	266717	0.97	-	.	g430
Scaffold_10	AUGUSTUS	transcript	265719	266717	0.97	-	.	g430.t1
Scaffold_10	AUGUSTUS	stop_codon	265719	265721	.	-	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_10	AUGUSTUS	CDS	265719	266717	0.97	-	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_10	AUGUSTUS	start_codon	266715	266717	.	-	0	transcript_id "g430.t1"; gene_id "g430";
# protein sequence = [MVPRVTSWIIPSRRQSNVGRQNQQNTEDVEAALTLPSSQPIQQPKQPLSVRQSLQEIRDPARQSVWVPPQPEPVDDSD
# LFVRPIPTPTPAISSSVLLPEKDQMESGSEDRTSTGVSLRYYGVGHDSLMSYPNPSFMANDESSLKSSGTDSPIYGLDGIVKQQKNRNSAGSSLRPPR
# RPSVSSFDELIQQQAELDRSIAALRLFSPPTSFAEAENPSAGIPDGTSLSTTNNRTVSTLTSSSARSEFSLSIFPDPPIADFPLRASFSTMRANRTKR
# QSRRDLPTSLDNVSLDVPSLPDTPMRLAPGRSFGSNATQYDVTSFIGRESTYCLCVTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g430
###
# start gene g431
Scaffold_10	AUGUSTUS	gene	266993	267668	0.59	-	.	g431
Scaffold_10	AUGUSTUS	transcript	266993	267668	0.59	-	.	g431.t1
Scaffold_10	AUGUSTUS	stop_codon	266993	266995	.	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_10	AUGUSTUS	CDS	266993	267545	0.6	-	1	transcript_id "g431.t1"; gene_id "g431";
Scaffold_10	AUGUSTUS	CDS	267643	267668	0.6	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_10	AUGUSTUS	start_codon	267666	267668	.	-	0	transcript_id "g431.t1"; gene_id "g431";
# protein sequence = [MLFMKRVTFFVAAVIDLAQLLVRGSVKVNMNTGITSGVTALINTREVGLSIAIGLRFLFFWAFVSERPRGEPPPTTDL
# TDPRVYVYHAQNSHSARWERWGYLGIFLKWLILASVISIPILQIIWRIAVRHFGVVYMVESTIEIDLCSSSVENDPQRFPVAGLSMVETIQVLHRTSD
# CAAHQPRHRNWRIGLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g431
###
# start gene g432
Scaffold_10	AUGUSTUS	gene	274541	276518	0.34	+	.	g432
Scaffold_10	AUGUSTUS	transcript	274541	276518	0.34	+	.	g432.t1
Scaffold_10	AUGUSTUS	start_codon	274541	274543	.	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_10	AUGUSTUS	CDS	274541	275191	0.67	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_10	AUGUSTUS	CDS	275241	276518	0.56	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_10	AUGUSTUS	stop_codon	276516	276518	.	+	0	transcript_id "g432.t1"; gene_id "g432";
# protein sequence = [MHSECEIFIAQHTSKFPLRQGTKQEPGKRSVSTRMSSRSTRTSSMIVHDVEGDEEGSVEGAEEEEKIQPGVQEVPRSP
# PLPRIRKAKETQFRLGVGRPLAAGGKGARAVTKSVSASRAKKGKGSRSVKPSEATIEEGSCRFECSYDWILTFTRARIRNYRATPCRRTSTQYVVPQY
# PFSYVDLSNSNVHRRASSNITTESPSVPVMSTEIDTHVMQALKPLYEQLKSLKAELQQMQSLRNELMQLRNQAADIDVWKQKVDTLSTEVEDLRKKAA
# LADSLNNELQQLRELITTQRTSSPISEEAASGYRTPIMTRTSIPKYVQCIHLFGFYRIDILCLSALSIPRAPALMSEPQPSTSNNAHHSSHPGIAPVM
# LGKRHRDSTGSNVAGVVEQGQGTGLSEEDLAKTVLRPNKKRVKLSAGPDADGEDDSLKSPEENGEAPRGSSFTVFSGPEPDGSYVDPPPPTTPLPAFY
# TASTPPNNIAGPSRPRVTSTQDASENMPPFSFSFLPVPPTPGAGNPYSMPGFSYPEPPQSPTPVRDSNPTGFSSSNRNRTDVFQAFGLPPPTRPRSRL
# EPALRTSSQDAEMGQYLNPAAFDNREGGESAAHPEDSSDAMKRTMYGTELEVETRFGDFGLEGVASDYNWSGSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g432
###
# start gene g433
Scaffold_10	AUGUSTUS	gene	279975	280247	0.99	-	.	g433
Scaffold_10	AUGUSTUS	transcript	279975	280247	0.99	-	.	g433.t1
Scaffold_10	AUGUSTUS	stop_codon	279975	279977	.	-	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_10	AUGUSTUS	CDS	279975	280247	0.99	-	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_10	AUGUSTUS	start_codon	280245	280247	.	-	0	transcript_id "g433.t1"; gene_id "g433";
# protein sequence = [MSVPEESSPVKEEKDKKKRKRKSDAVEDADASMAVDEDDAEKAEKKKRKKEKKAAKEAKEAEATEGDDEARRERKRLK
# KEKKAKEEATSD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g433
###
# start gene g434
Scaffold_10	AUGUSTUS	gene	286631	288401	0.28	-	.	g434
Scaffold_10	AUGUSTUS	transcript	286631	288401	0.28	-	.	g434.t1
Scaffold_10	AUGUSTUS	stop_codon	286631	286633	.	-	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_10	AUGUSTUS	CDS	286631	287054	0.8	-	1	transcript_id "g434.t1"; gene_id "g434";
Scaffold_10	AUGUSTUS	CDS	287182	287505	0.32	-	1	transcript_id "g434.t1"; gene_id "g434";
Scaffold_10	AUGUSTUS	CDS	287977	288401	0.61	-	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_10	AUGUSTUS	start_codon	288399	288401	.	-	0	transcript_id "g434.t1"; gene_id "g434";
# protein sequence = [MHVLNQGFHNPDTPAQEPSTSSAVSSTNPPGSSVNLVVASFALSSSSVPSPVPSPAPSPAPGISSAVLDSSISNPLPE
# MVPQSSFDNAGYQALKRKFLEDTKPLSISSLSKYAKDLLVRLCRSLVFQHMETKHYWLKICYCGITASIWVNFCKPWVHFMLEIPQHLNESTMNCKTQ
# LQIDGLVGFFDLDISPVALLTAYDIGQAENTMLRSYCRLGNLRLLIDNRQELHDRIGETLEVLDDIACEDHRGINGPLTWTTEVTEVDGVSVGRAIYT
# SFHHQHRNSFIILELQQNQYFAARIQQIFYHAHQHPHDPHLSVSEIYTSVDLLNPLDTDVLPDWYRQFKMGWLCCDPSNPSTPTPVQVTVPLKYAVSH
# CVWTPFEINNQATCATCA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g434
###
# start gene g435
Scaffold_10	AUGUSTUS	gene	296832	297890	0.55	-	.	g435
Scaffold_10	AUGUSTUS	transcript	296832	297890	0.55	-	.	g435.t1
Scaffold_10	AUGUSTUS	stop_codon	296832	296834	.	-	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_10	AUGUSTUS	CDS	296832	297890	0.55	-	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_10	AUGUSTUS	start_codon	297888	297890	.	-	0	transcript_id "g435.t1"; gene_id "g435";
# protein sequence = [MNEGNTKRDSQLQRQEGQLQRQEARMAELQRTQEQILSHLHLASPLASTTRAVPVHTSFEPSRPFAPAAVGVNTQSSI
# PSGFRPFAPSASGPVPVPGGASGSVPDDSTGPTTATGTPGPGGFRSTGIANPVGSDSAPAGATGVPNADNLPSGNEWGKFPAGYRVTNSPITGPNSLW
# NVELQVKDRTPVHKSPDQIARQVSALIESDLFHGLSLISLSEIDATMGRHGLGGRANRLRLTVTTEELDDFEEEYEEDPSQRPCTMDNFRVSVNGHPR
# CAWNHAAGYVFVQLVESKGWVTPQNDVEREMLRQFFLQRMTNIHKEWKRKVTTGGDYARQQQENIVGRQRRVCFYVSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g435
###
# start gene g436
Scaffold_10	AUGUSTUS	gene	302000	303067	0.18	+	.	g436
Scaffold_10	AUGUSTUS	transcript	302000	303067	0.18	+	.	g436.t1
Scaffold_10	AUGUSTUS	start_codon	302000	302002	.	+	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_10	AUGUSTUS	CDS	302000	302028	0.23	+	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_10	AUGUSTUS	CDS	302400	302578	0.75	+	1	transcript_id "g436.t1"; gene_id "g436";
Scaffold_10	AUGUSTUS	CDS	302637	303067	0.96	+	2	transcript_id "g436.t1"; gene_id "g436";
Scaffold_10	AUGUSTUS	stop_codon	303065	303067	.	+	0	transcript_id "g436.t1"; gene_id "g436";
# protein sequence = [MFLRRLHHFXPICLTSRPNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHS
# KDSDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSRQVVVSEDDSASNEVESEDE
# EEDEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g436
###
# start gene g437
Scaffold_10	AUGUSTUS	gene	303684	304341	0.35	+	.	g437
Scaffold_10	AUGUSTUS	transcript	303684	304341	0.35	+	.	g437.t1
Scaffold_10	AUGUSTUS	start_codon	303684	303686	.	+	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_10	AUGUSTUS	CDS	303684	303732	0.35	+	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_10	AUGUSTUS	CDS	303794	304341	0.68	+	2	transcript_id "g437.t1"; gene_id "g437";
Scaffold_10	AUGUSTUS	stop_codon	304339	304341	.	+	0	transcript_id "g437.t1"; gene_id "g437";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDKHGHLVEASPPPDSATEALEGLKEVERGSADEGASSPVGGSVPMELDLP
# TIESLAERTLSPEKGAESAQIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g437
###
# start gene g438
Scaffold_10	AUGUSTUS	gene	307080	309544	0.56	-	.	g438
Scaffold_10	AUGUSTUS	transcript	307080	309544	0.56	-	.	g438.t1
Scaffold_10	AUGUSTUS	stop_codon	307080	307082	.	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_10	AUGUSTUS	CDS	307080	308362	0.91	-	2	transcript_id "g438.t1"; gene_id "g438";
Scaffold_10	AUGUSTUS	CDS	308614	309544	0.57	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_10	AUGUSTUS	start_codon	309542	309544	.	-	0	transcript_id "g438.t1"; gene_id "g438";
# protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMLESKDAHVKSSVGILVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLLK
# APPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGI
# RISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQ
# ALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFR
# VLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g438
###
# start gene g439
Scaffold_10	AUGUSTUS	gene	311449	312852	0.78	-	.	g439
Scaffold_10	AUGUSTUS	transcript	311449	312852	0.78	-	.	g439.t1
Scaffold_10	AUGUSTUS	stop_codon	311449	311451	.	-	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_10	AUGUSTUS	CDS	311449	312852	0.78	-	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_10	AUGUSTUS	start_codon	312850	312852	.	-	0	transcript_id "g439.t1"; gene_id "g439";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID
# DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP
# FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g439
###
# start gene g440
Scaffold_10	AUGUSTUS	gene	312882	313202	0.49	-	.	g440
Scaffold_10	AUGUSTUS	transcript	312882	313202	0.49	-	.	g440.t1
Scaffold_10	AUGUSTUS	stop_codon	312882	312884	.	-	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_10	AUGUSTUS	CDS	312882	313202	0.49	-	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_10	AUGUSTUS	start_codon	313200	313202	.	-	0	transcript_id "g440.t1"; gene_id "g440";
# protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE
# LSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g440
###
# start gene g441
Scaffold_10	AUGUSTUS	gene	313542	314276	1	-	.	g441
Scaffold_10	AUGUSTUS	transcript	313542	314276	1	-	.	g441.t1
Scaffold_10	AUGUSTUS	stop_codon	313542	313544	.	-	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_10	AUGUSTUS	CDS	313542	314276	1	-	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_10	AUGUSTUS	start_codon	314274	314276	.	-	0	transcript_id "g441.t1"; gene_id "g441";
# protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g441
###
# start gene g442
Scaffold_10	AUGUSTUS	gene	317553	318017	0.65	-	.	g442
Scaffold_10	AUGUSTUS	transcript	317553	318017	0.65	-	.	g442.t1
Scaffold_10	AUGUSTUS	stop_codon	317553	317555	.	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_10	AUGUSTUS	CDS	317553	318017	0.65	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_10	AUGUSTUS	start_codon	318015	318017	.	-	0	transcript_id "g442.t1"; gene_id "g442";
# protein sequence = [MNGLYKLTTEGRSTSESTKEALDEKSCRKERLEKNEYQIEVSMREEASSAASSHEARGPSGSFVHPSAPRDSAISPAP
# KMASHTNRKHLPHPTHTSFKMFFSPTIISCDPHASLLINASAAEETPILTNEPTHNSCTQSFVDDLLDPGDGFSTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g442
###
# start gene g443
Scaffold_10	AUGUSTUS	gene	327255	329817	0.6	+	.	g443
Scaffold_10	AUGUSTUS	transcript	327255	329817	0.6	+	.	g443.t1
Scaffold_10	AUGUSTUS	start_codon	327255	327257	.	+	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_10	AUGUSTUS	CDS	327255	327438	0.61	+	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_10	AUGUSTUS	CDS	327734	329817	0.96	+	2	transcript_id "g443.t1"; gene_id "g443";
Scaffold_10	AUGUSTUS	stop_codon	329815	329817	.	+	0	transcript_id "g443.t1"; gene_id "g443";
# protein sequence = [MQTFQSFDTTSIISSTKSTNSKRQNAPSDAQSTISLGIKNPSTLSYSNYPLNNHANHFAHPAHVTRDLVESHKVFSAT
# ETVFSALPANTISNRDRSVSRQRYNISNDTSFVTFEDDSPPASPTSSPTITSGWVSGNGWISPDVRSIQSSTSGTITPTTTRRALSADSTWTRRSGGS
# AVSGVVSPSPVTASKSTSIPENTISRLPLAPPAYSEVPLHITTDSTESALHRTATNEAPKSPESPESPEEAPVYTESRISFQTGVNQSRVHAPSGIHH
# HGNGRRAKSTSKAALRGEPNAPLPETPTMSSSVMGNFSHPYASPTALPNVFGPSESSSSISREGNENVENADNGNVVDVAATGYEYAQAHARAHSDRL
# RSQQSLGHLPSQVQSHQSPTIHDNEDEAEPTRGRKKTRSRFSFANLGLGKIVHALSRSRSRSKSTMHTESHSERSERSESPSRVSTRSGVSARSGVSG
# ITTISTDTKNTKKSKRSISLPWRRRRRGSTSTTASSVSGVSTGTTGTTNTTNTTGTNNNQTDELGFLDISNGAHKNAHSPLPPPLPSPLPPSITPSNR
# SYSTSSEASTSASHSTRSVSQSSRSVSHTSSASTSPSHSPRLPSSPSPPLPANRRSPSSDAQSHISFADLADYDPPSIPPTPPSPSILSSITRPSSVL
# SRYSASSKDKDRDRSQDRSRDRDASGSNISAVSGPSGPGWKEFPKGIYTYPILFSIPGHAPPSLDTATAHRKAVWSRFGEYYECWSPWE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g443
###
# start gene g444
Scaffold_10	AUGUSTUS	gene	330972	332174	0.55	+	.	g444
Scaffold_10	AUGUSTUS	transcript	330972	332174	0.55	+	.	g444.t1
Scaffold_10	AUGUSTUS	start_codon	330972	330974	.	+	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_10	AUGUSTUS	CDS	330972	332174	0.55	+	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_10	AUGUSTUS	stop_codon	332172	332174	.	+	0	transcript_id "g444.t1"; gene_id "g444";
# protein sequence = [MDFEDLENIHDLDPCDGREPSDSSEPEEEISSIDGSGDNKDKDDLDDSDDSEISDSLDDIDEFLTSDAESKPLSEYND
# ANVHSQYSSQRLLRRSRNSSERSRRGHHHPRKDIRKPSPSALSSLASSLMGPGPWSMSLALPLPLAHASNLTTKQVQEYEEKMEVYRRQQQEGQQHGF
# GGGAFSGYSGYSKRDSNGARKTEKEWEKKQAKNDKASKREKKPELVDIGRGLLPSNKNKRSNVTISHLLKCVIRVERGELEEDEEVGEGEKEEGSTEG
# DRNSPETSAFPPLQMRYETGDSRAFGGASAGMSASALADADRSGWADEWEYVQSNKEIRQQRESRERKVRVQEPLKPRPKQKPKKKRKLFDIVVQTPI
# QVLSVSVSLPVSLSLLFFHSPVVGSVSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g444
###
# start gene g445
Scaffold_10	AUGUSTUS	gene	332239	333420	0.88	+	.	g445
Scaffold_10	AUGUSTUS	transcript	332239	333420	0.88	+	.	g445.t1
Scaffold_10	AUGUSTUS	start_codon	332239	332241	.	+	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_10	AUGUSTUS	CDS	332239	333420	0.88	+	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_10	AUGUSTUS	stop_codon	333418	333420	.	+	0	transcript_id "g445.t1"; gene_id "g445";
# protein sequence = [MSPTIPSTASTSSSFNTSSIPSTSMPSSTPSTPGAESSTRVVISTAPNASDACPCILKARLKQARRERRLRRRELKRE
# LREQRMEMMKFMERRRSRMHDAEGADGARGREDGQRGASHLREEVGDRDGLRNYQDNGTNGGARDENEVEESLERTQRKERERRDRAKIRRREALVAL
# SSPPAAPLPPPPPLPSPSPHPPTGLPLAPLPPPPPTAMDSFAPSSMQGTHQRTSFSSARTNSTANTATTTYSSSTSHTNASITSAPSAYLAQGPSILR
# SGKTKRSSGFSGLGFGGIITARPTQGTVERRLTGGSQISHLSYQSQLSQLSHLTQSTSASASSSIPGLEIGGGAVGSGLIYSSQEFEDLVAGHMDEAG
# EAPPTYEHVALVLAGRRENTW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g445
###
# start gene g446
Scaffold_10	AUGUSTUS	gene	340400	341182	0.84	-	.	g446
Scaffold_10	AUGUSTUS	transcript	340400	341182	0.84	-	.	g446.t1
Scaffold_10	AUGUSTUS	stop_codon	340400	340402	.	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_10	AUGUSTUS	CDS	340400	341182	0.84	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_10	AUGUSTUS	start_codon	341180	341182	.	-	0	transcript_id "g446.t1"; gene_id "g446";
# protein sequence = [MVEAHFPSWSCPLCRSFADLEEDVEVEAEMDYDIEEKDQDQDADVELEADGIAAQPNGAAALGVPIAEDDDSAVEEMS
# DDPDLHAAIAASRVTANNSNSTNPSPHSNNPFLNMVNGRSPNFSSSAREPRDGAETEVESDHIGGSTLRPARNQRRGHGRNPSAQLVDPIATEGMDEE
# QDEDGRENDVEMLVDADGQPDHDLQAHPRVGHAEADAMNHDEDMEFGGVAEVRDDAELEGRSSGSGMSGEGDAAVGAAGAKRKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g446
###
# start gene g447
Scaffold_10	AUGUSTUS	gene	341263	342474	0.99	-	.	g447
Scaffold_10	AUGUSTUS	transcript	341263	342474	0.99	-	.	g447.t1
Scaffold_10	AUGUSTUS	stop_codon	341263	341265	.	-	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_10	AUGUSTUS	CDS	341263	342474	0.99	-	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_10	AUGUSTUS	start_codon	342472	342474	.	-	0	transcript_id "g447.t1"; gene_id "g447";
# protein sequence = [MDPPFVSSDSPPLRSTILGSFLGRGRPRNSSQSHPNASSPNPDPLRRETSPSPNPPSPIGQAAGSINHRRGRPAGPSN
# ATSAVSAEVGNGVQPSTSAPGAGLAFSMLRRRRSAGTMANANNVNTAGAPAVPTGVPSRPPTAPSASATNLRSISTNAAANRIPASLNSPPHRLRLVP
# HLESRRSLRFDAITRDMRVGDPALRIGRFTDRSGNNPHGGGVNNNNPNSFKLAFKSKVVSRAHAELWTETSSPSSAASPANVKFFIKDTKSSSGTFLN
# HVRLSPANTESRPFQIKDGDILQLGVDYQGGSEDIYKSVKIRVEIGREWQSGANKFKYVGFHSFLCCSLFAYNSTTAIKNLKSLAQAVSGVTGTSGPG
# KSKSAGLPDCCICACLPWLLSESSSHSNRPV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g447
###
# start gene g448
Scaffold_10	AUGUSTUS	gene	355496	356224	0.37	-	.	g448
Scaffold_10	AUGUSTUS	transcript	355496	356224	0.37	-	.	g448.t1
Scaffold_10	AUGUSTUS	stop_codon	355496	355498	.	-	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_10	AUGUSTUS	CDS	355496	355908	0.55	-	2	transcript_id "g448.t1"; gene_id "g448";
Scaffold_10	AUGUSTUS	CDS	356017	356224	0.37	-	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_10	AUGUSTUS	start_codon	356222	356224	.	-	0	transcript_id "g448.t1"; gene_id "g448";
# protein sequence = [MAKRGAHAPSFLVSAPEGIKSFEELYGAENLADSEDWLMSTGSESGVRIITAAPEVPGVMGTVEELTKRAVQHGARLI
# THLFNAMPQLHHRDPSIIGLLGASPHLYSPFSPITSKALYTGDVMSPVALTPMKPNKSNITGLKSPVGSEALDEVETPPQTPIFKAHSGKNSTLKKTQ
# SIAGFSLDSSELQGLLRDDRGWCSFTSQFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g448
###
# start gene g449
Scaffold_10	AUGUSTUS	gene	359689	361253	0.34	-	.	g449
Scaffold_10	AUGUSTUS	transcript	359689	361253	0.34	-	.	g449.t1
Scaffold_10	AUGUSTUS	stop_codon	359689	359691	.	-	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_10	AUGUSTUS	CDS	359689	360459	0.55	-	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_10	AUGUSTUS	CDS	360514	360808	0.77	-	1	transcript_id "g449.t1"; gene_id "g449";
Scaffold_10	AUGUSTUS	CDS	360949	361253	0.74	-	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_10	AUGUSTUS	start_codon	361251	361253	.	-	0	transcript_id "g449.t1"; gene_id "g449";
# protein sequence = [MRVAVPDRHDGQEMCISTHKLFESHGVHQPHSPSSPSFESTASRPSIDEQPVVTSPIASTATLKRSASPTPSASRKRS
# VGERISTKDFIPPDVSGLSKREARRVAELEQENARLLAISQMTESFTHPKSQSESELASEVDMLRAQLADARQRELELSQELATRSTPRDPPVKIEAA
# EPSFPLSSPRSQSPHKSAASLGLMVLLCALPTLLSMPTQSSFPTSFSLPSAFPASPSSSDFNSIFPPNFDWSRNSIMDLETDEHGRIMPAPQKLEFSN
# PELSKSLGALGGLDISFDAVPQENGKIRVRIHPSSSASSRAGSPGLSNPVSHSNGHGALGLDLWGLPDSDNPTLQAAFSSDPSYYGGASSSFTTYSSS
# SSNGDPFLGVGGPSHNDFGGLSPFSSTSSFGSGDMDYDFGRASDYSPSLTGSDSLSGNKRRVRIALKSMPATGGEGGEWEVQFC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g449
###
# start gene g450
Scaffold_10	AUGUSTUS	gene	374563	375075	0.98	-	.	g450
Scaffold_10	AUGUSTUS	transcript	374563	375075	0.98	-	.	g450.t1
Scaffold_10	AUGUSTUS	stop_codon	374563	374565	.	-	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_10	AUGUSTUS	CDS	374563	375075	0.98	-	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_10	AUGUSTUS	start_codon	375073	375075	.	-	0	transcript_id "g450.t1"; gene_id "g450";
# protein sequence = [MRAFVGWAGFTDIKPLPQGTPILEQGDAVDHPLMRHAVSNYAGFLRMRNPLELPPVPTSNPATVGLPSTPSEKVEVQA
# DSTHAVASDLPISIASDAFEEVTPIPSAEPVVDPLVTPASDPSPLPISTVSNPTPTPKPTPAPSQVGQFTRGHRSIKDGQLDPQENPQPEKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g450
###
# start gene g451
Scaffold_10	AUGUSTUS	gene	375964	376452	0.92	+	.	g451
Scaffold_10	AUGUSTUS	transcript	375964	376452	0.92	+	.	g451.t1
Scaffold_10	AUGUSTUS	start_codon	375964	375966	.	+	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_10	AUGUSTUS	CDS	375964	376452	0.92	+	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_10	AUGUSTUS	stop_codon	376450	376452	.	+	0	transcript_id "g451.t1"; gene_id "g451";
# protein sequence = [MPKLHLKRTPEEEAVRRVRKLEKREAKRRRKHDHYGYGSSSSKRQQRTAIVEEDNSCDEEDGEEFIGPVPGPSNYQPD
# YETIRAEIEEQRFREKMAMAFDDDERLDSIEARFNSFAHVPMHWGGKNSSKPRINYDNDEFLAVDPMTMDDEEYAEWVRMGMYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g451
###
# start gene g452
Scaffold_10	AUGUSTUS	gene	376544	377161	0.91	+	.	g452
Scaffold_10	AUGUSTUS	transcript	376544	377161	0.91	+	.	g452.t1
Scaffold_10	AUGUSTUS	start_codon	376544	376546	.	+	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_10	AUGUSTUS	CDS	376544	377161	0.91	+	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_10	AUGUSTUS	stop_codon	377159	377161	.	+	0	transcript_id "g452.t1"; gene_id "g452";
# protein sequence = [MKAERAAKRAQEKAIRAETERLQKVAAAERWSHKLKKENKRLELLRLEYQNRWKLLLSNTQPADIADIGFNDIPWPIL
# LAYKHKSDKKSVSDTVSSLSLDDFTPDAISTFLFTSPPSANTSIDTDTDIGKTSSSSSSASAQRLSEAETENPKKGRKEKLRETLLRFHPDKFEGRLM
# SRVRPEEKEKVTQALGIVVRVLNDLMGEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g452
###
# start gene g453
Scaffold_10	AUGUSTUS	gene	377899	378714	0.26	-	.	g453
Scaffold_10	AUGUSTUS	transcript	377899	378714	0.26	-	.	g453.t1
Scaffold_10	AUGUSTUS	stop_codon	377899	377901	.	-	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_10	AUGUSTUS	CDS	377899	378714	0.26	-	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_10	AUGUSTUS	start_codon	378712	378714	.	-	0	transcript_id "g453.t1"; gene_id "g453";
# protein sequence = [MKLRAAKVHSERADHKGNRLERRFGHPALHTELFTPMLHAKMMPLLSQVYRGRIGKDQAKLDEYGGQKMEAQVVEGGI
# KIAAIEQRDLEYDPALYRRDRGELDWDARSIASTTLMNDAASIAPSQMQGGASLPGYDKYLASGPGAYELSRLDSQQEPLLSGKIYEGMYPSQNSLSM
# PPAMYRDASSDGLSREAPLHRPQDYFGDYPQRSNSPYMDTRSNTPVSQYPPQPNRQYTASPQAQYSPRPSPHHDSPSQLYPPQDQNMAGRGTYRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g453
###
# start gene g454
Scaffold_10	AUGUSTUS	gene	384737	385699	0.38	-	.	g454
Scaffold_10	AUGUSTUS	transcript	384737	385699	0.38	-	.	g454.t1
Scaffold_10	AUGUSTUS	stop_codon	384737	384739	.	-	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_10	AUGUSTUS	CDS	384737	385699	0.38	-	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_10	AUGUSTUS	start_codon	385697	385699	.	-	0	transcript_id "g454.t1"; gene_id "g454";
# protein sequence = [MTLKVGLFIPSLHAISELSVYSIGLTSSLEPGGMMDALPQLLETLHRLQVIPSPNIPNLYDSDPKCPSNKRKRTNVPQ
# SATEKVQQWQACQNQVVPEEQDNTVAEVESQNKRSRSMAPPPPSTNMIEYHEMGPDQNPVRPSQKQVRVVLRKLKEFPNARIRVKNQLEETKEMLNIV
# ESVHQQTEGKLTEMRWTRYIIEEDVLRHQKQDRTLVDGTTKLGSTSLQAREWRDWIQENTISQKLQQASVGVPENLAGASSVAREPIPINAIAYRSEG
# KGWGYWKNMYGPRADDEEYQEGVEEEDEEKQGEDEEEEYSESEVEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g454
###
# start gene g455
Scaffold_10	AUGUSTUS	gene	386572	388158	0.56	+	.	g455
Scaffold_10	AUGUSTUS	transcript	386572	388158	0.56	+	.	g455.t1
Scaffold_10	AUGUSTUS	start_codon	386572	386574	.	+	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_10	AUGUSTUS	CDS	386572	386822	1	+	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_10	AUGUSTUS	CDS	386869	387164	0.57	+	1	transcript_id "g455.t1"; gene_id "g455";
Scaffold_10	AUGUSTUS	CDS	387296	388158	0.95	+	2	transcript_id "g455.t1"; gene_id "g455";
Scaffold_10	AUGUSTUS	stop_codon	388156	388158	.	+	0	transcript_id "g455.t1"; gene_id "g455";
# protein sequence = [MAIEAYDLIQEDALTQLTRAELQALGKVRIVEYPSSLHVISYSSSVFTHVPLVPQAHNVKANLKSATIISQLLKKFPD
# GVPNPNPHSTDPALAPRKRGRIKRGDAKKKKAQVKKEESVNASVMFSNGDSELEHNEGRTSASLLGNPPVTNDEVTTETVSRPTKSRPTRATSRKQTA
# FKSLLVQIATTPLPKEPATGEPPQIPTPQIELEAAGGEESEIVPGKTYHIGYGDALTDTRLLVEPTGDENEVDMDNLSEVSEITHNPSESSRGASPQP
# LANDATLKYVVDIIKANTEKDKQMRDEIKILQERAANAKKLLQEQNYLLTAEREHRDRIISFFLYHIRNNNRWIGQSLNPGELEANVLKEFVSNGGRG
# WRDMGEWEYGEVWSGPMVVSDSNIEITASNLDEYLRDMWDIHQRERKEGKMKANHSSINRLVQHDIDVSCSCFSHSMMYSQCPAALTPCRYSRCSRE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g455
###
# start gene g456
Scaffold_10	AUGUSTUS	gene	389098	390114	0.73	+	.	g456
Scaffold_10	AUGUSTUS	transcript	389098	390114	0.73	+	.	g456.t1
Scaffold_10	AUGUSTUS	start_codon	389098	389100	.	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_10	AUGUSTUS	CDS	389098	389217	0.73	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_10	AUGUSTUS	CDS	389471	389593	0.81	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_10	AUGUSTUS	CDS	389641	390114	0.81	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_10	AUGUSTUS	stop_codon	390112	390114	.	+	0	transcript_id "g456.t1"; gene_id "g456";
# protein sequence = [MPFNPPGGGGGPGPGGSGGSFQFTGSPFFDATLTTLVGLGGSKILIQSHGLSIYEDASRIELTEWSKGEEVGHYYVLL
# GPKGSGKGTMIYDSMSAIKADGVAMCDAHPDLEVFRLRLGKALNYEYNEDSQTGLFQRRDPREGGAALDIERGTQPSFCVISSAQIPLALNKLEKVAL
# RCARRRHKPLVLIINNVHYFNNDEAGRNMLLQLQQRAEAWAASGMLFVPFLNPGFMEVSQGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g456
###
# start gene g457
Scaffold_10	AUGUSTUS	gene	392436	393284	0.44	-	.	g457
Scaffold_10	AUGUSTUS	transcript	392436	393284	0.44	-	.	g457.t1
Scaffold_10	AUGUSTUS	stop_codon	392436	392438	.	-	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_10	AUGUSTUS	CDS	392436	393284	0.44	-	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_10	AUGUSTUS	start_codon	393282	393284	.	-	0	transcript_id "g457.t1"; gene_id "g457";
# protein sequence = [MRRTEPPTGPRAMHRDGQLSNNSRSLLDRVGGPAVGGQQDEIQARIDTIVNTGDPNMMMAGGFPGMNGMDMNAMAAGM
# ANPMMIQELMMNQMALMAHFSGIMNPGQFGGFPMQGVMPQEMGMPQQNMGVNGFQGQSSGPNRGRGTGGRGGRGASRGRGGPPISSVTSKIEEVPTES
# PAISTPIAAPTPSTTIKAPMSDATPSAAPSRPAYAVPERPQSPTLCKFGLKCTNAHCRWSHPSPVATAESGVVLSNDPCENGKHCKDKDCIKAHVSPA
# TLKPQGMC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g457
###
# start gene g458
Scaffold_10	AUGUSTUS	gene	396392	396883	0.45	-	.	g458
Scaffold_10	AUGUSTUS	transcript	396392	396883	0.45	-	.	g458.t1
Scaffold_10	AUGUSTUS	stop_codon	396392	396394	.	-	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_10	AUGUSTUS	CDS	396392	396883	0.45	-	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_10	AUGUSTUS	start_codon	396881	396883	.	-	0	transcript_id "g458.t1"; gene_id "g458";
# protein sequence = [MCNYLDWELTVDNPILADFTTMVKEDFSSSQGPYPTYPLKVVSKRAAKAASTSTKSTPIPEHNSTTSPIPIGHPSSPR
# KPPQSLVPPRKGSPTIDMSPDTPASSYSDTTSPATSSSPQTPIGDEDFSAKIRDNDYPLGFSITEKHMGAALKSKTFAFAVPAVW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g458
###
# start gene g459
Scaffold_10	AUGUSTUS	gene	400526	401202	0.42	+	.	g459
Scaffold_10	AUGUSTUS	transcript	400526	401202	0.42	+	.	g459.t1
Scaffold_10	AUGUSTUS	start_codon	400526	400528	.	+	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_10	AUGUSTUS	CDS	400526	400548	0.44	+	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_10	AUGUSTUS	CDS	400617	401202	0.67	+	1	transcript_id "g459.t1"; gene_id "g459";
Scaffold_10	AUGUSTUS	stop_codon	401200	401202	.	+	0	transcript_id "g459.t1"; gene_id "g459";
# protein sequence = [MYGTTDSTTQRTLWFNAAKKDEDRRTLNNNDARSELRQSANNFAERFTGASFPLDRMMAESTVSNLDSFVQRNRPLPE
# PKAISQEIRDRSSTFVATIFSAATPEEAKSHVQYLRKVLHASRPATHEISAYRCMMLKPGKTGLAGPDDFELKTGYEDDGEQWAGIKVLKVMESLAVL
# DAVVICSRWYLYKLCLLSAVVVNLSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g459
###
# start gene g460
Scaffold_10	AUGUSTUS	gene	401312	401542	0.69	+	.	g460
Scaffold_10	AUGUSTUS	transcript	401312	401542	0.69	+	.	g460.t1
Scaffold_10	AUGUSTUS	start_codon	401312	401314	.	+	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_10	AUGUSTUS	CDS	401312	401542	0.69	+	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_10	AUGUSTUS	stop_codon	401540	401542	.	+	0	transcript_id "g460.t1"; gene_id "g460";
# protein sequence = [MLSTLDDILKQLRDELALLSGPLTSSNDDSSPHLRLKPPDYTLWTESDLPKAKRLVIAREKAIASVKNMIAKRRSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g460
###
# start gene g461
Scaffold_10	AUGUSTUS	gene	404453	405921	0.31	+	.	g461
Scaffold_10	AUGUSTUS	transcript	404453	405921	0.31	+	.	g461.t1
Scaffold_10	AUGUSTUS	start_codon	404453	404455	.	+	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_10	AUGUSTUS	CDS	404453	405039	0.99	+	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_10	AUGUSTUS	CDS	405128	405594	0.94	+	1	transcript_id "g461.t1"; gene_id "g461";
Scaffold_10	AUGUSTUS	CDS	405659	405921	0.31	+	2	transcript_id "g461.t1"; gene_id "g461";
Scaffold_10	AUGUSTUS	stop_codon	405919	405921	.	+	0	transcript_id "g461.t1"; gene_id "g461";
# protein sequence = [MRARRVKGKARDPREGPGLAAGTINEPIELGSEDEGSDEGVELDVGSDDEELDEEEKYYDSEGEDDPEYERDSARASH
# RSTRSPTPSRRRRTVVEDPAEEEEDKDEEGQRSSQGGPEEIEDEQEEEEVSGEISTEDSVNTHARPYDLEDEDGDCFGSPLRPLTFENEHAHRRNSPE
# DDRQEIHDVDEEATRFRKYCSQPLSLPDIWEGPQTYAEDYYSGGDVMHDSVFPLSADALNEHDVNEKASDSGFFLTPGLLTPNGFNVSSPAASDEEQV
# AVPSSKEKTKSPQLLQDIHDENGKAYNERSNSPLPGSSPLPMSPEFDPEDQYVNNQPSPVYILSDEEEQEQNQFDMRERSSPPPEYEIDDEVDATPDN
# DYQDVFADTDADVLAVDTVIPLGTSDLDIIDEVDVEAENATIYENELSIEEDKLPALEGKLLACYV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g461
###
# start gene g462
Scaffold_10	AUGUSTUS	gene	406204	406572	0.51	+	.	g462
Scaffold_10	AUGUSTUS	transcript	406204	406572	0.51	+	.	g462.t1
Scaffold_10	AUGUSTUS	start_codon	406204	406206	.	+	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_10	AUGUSTUS	CDS	406204	406572	0.51	+	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_10	AUGUSTUS	stop_codon	406570	406572	.	+	0	transcript_id "g462.t1"; gene_id "g462";
# protein sequence = [MVSQSVEIEADVSHSSPLLIGTDVGIAVTVQDIESEETPELMYPEDGDVYSVVSVISEEQDELDEDGEYDLDVESIPG
# TDVVINLYEVEEILTEGRLTIVSFACSFSLPHIIKVLFSGAGNQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g462
###
# start gene g463
Scaffold_10	AUGUSTUS	gene	406946	409867	0.99	+	.	g463
Scaffold_10	AUGUSTUS	transcript	406946	409867	0.99	+	.	g463.t1
Scaffold_10	AUGUSTUS	start_codon	406946	406948	.	+	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_10	AUGUSTUS	CDS	406946	408206	0.99	+	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_10	AUGUSTUS	CDS	408303	409867	0.99	+	2	transcript_id "g463.t1"; gene_id "g463";
Scaffold_10	AUGUSTUS	stop_codon	409865	409867	.	+	0	transcript_id "g463.t1"; gene_id "g463";
# protein sequence = [MLDVSASGPGTPQPSLPLLSPAESSHALGDNTSVNDIIDARKHDLGVSTTPDIVQVLDHEKSSVQSIAATISETPALG
# SQTELSTISSDADDISTTHALAPGTIEEKSFGPPVQLPDTFIAELLTRKGIPVLHADPYPASLSTPTDEAEDGSVTDDEVDEIDQDSIISTEVSSSNS
# SLEEDKSLTISSELPVQTANEELDETGEDMDMDLQYPPSDEEKTAPASSSGIAHTVADELDFDAEGDIDPDFVESHDVATSGMHIQDDSQVTTEQILA
# EHTAEPFISSSIPTASQVADIDSHHGIPIYPSVELEENQSEDLPPEIRADIDDAAARISEPVELVTADINDEVVRSDVVESQSELPSAAAPVLTDSTE
# FASAHVFSSEKPKEKMEEEAIIAQAVNDGSKESMVSAAEEPIGKSERYHDVDPNRSLSHDTKSPDTGTTRRTKRKRKTPITLRNGSSAALAKDNNIPI
# ISKGKGKKTVVPQDISDTTSTSGASTAAQFLTGSRASSIVSTSTGDGSGQHNPSPTPHRVKDSSPSSTRFAAPPLPPPPPPLPQLMFHNHSKNKAAPI
# RRPALSVQTELPRAVSRAPSLSQPLAVSSSQAHSPDVGTPDSRSVTPAPSQSPHILRREPSSNSPVTRSHCRYHKISLPEEEDGGTHIFFLVPGCSLV
# DRKLIKEEEIVDHGDATYDDSIRKVADIETLGINEYVIGVIRMLVGPDKEHEVYFMPKPGEERARKVIHRKSRLRSSISSSASLHSPRTSISNINGNL
# LSPSSSSVAPVSAAGSSSTNRSSKQWRRQHDREKEADSSLWSEAYSTETDGEESDGEYKGPSKKPKLVHPTDVAETSSQNSHKSLSQGSTQLRESASA
# GPGPRNKTKRKRPLDPSAAEYKPHEDEGNESFDEALVKPKKNALKRARTSEPNPSTTSKEPERKRKKKTLKMVPYGFHH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g463
###
# start gene g464
Scaffold_10	AUGUSTUS	gene	409947	410171	0.84	-	.	g464
Scaffold_10	AUGUSTUS	transcript	409947	410171	0.84	-	.	g464.t1
Scaffold_10	AUGUSTUS	stop_codon	409947	409949	.	-	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_10	AUGUSTUS	CDS	409947	410171	0.84	-	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_10	AUGUSTUS	start_codon	410169	410171	.	-	0	transcript_id "g464.t1"; gene_id "g464";
# protein sequence = [MDVSAASADKPKTKRKQKDIFASDDDDDNDGEQKRRAELMQKKKATAVSKRRSDKDKDSDEDQEKPKRKAARRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g464
###
# start gene g465
Scaffold_10	AUGUSTUS	gene	419841	420353	0.88	-	.	g465
Scaffold_10	AUGUSTUS	transcript	419841	420353	0.88	-	.	g465.t1
Scaffold_10	AUGUSTUS	stop_codon	419841	419843	.	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_10	AUGUSTUS	CDS	419841	420353	0.88	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_10	AUGUSTUS	start_codon	420351	420353	.	-	0	transcript_id "g465.t1"; gene_id "g465";
# protein sequence = [MDQSQLDTFLKQKPRSNVDSLHSSSSIPLLSLPQMDTTLTTRLETTPQYTDVPAPYSDQESGAAQGNDQNGPGDGSES
# GHSVFLPSPYSHHGHDGNGDNVPELTQPRFVTPPPRPESQFYAPIPVQAGDFSMKALEASASGSRSSTPVSLSMIHGKKDTSSPPLHPANAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g465
###
# start gene g466
Scaffold_10	AUGUSTUS	gene	420460	420870	0.64	+	.	g466
Scaffold_10	AUGUSTUS	transcript	420460	420870	0.64	+	.	g466.t1
Scaffold_10	AUGUSTUS	start_codon	420460	420462	.	+	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_10	AUGUSTUS	CDS	420460	420870	0.64	+	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_10	AUGUSTUS	stop_codon	420868	420870	.	+	0	transcript_id "g466.t1"; gene_id "g466";
# protein sequence = [MTPPTIAPISVPWPSELGVEDDEALELADVDETVLVIEFDWVNDAEVDDDEEDEAEGDEDEEREEEDEDGETELEPVV
# VLLVELGLELDIEVLETEVLSEVVVSARPLNLYNLINTNAQTKNRYSQHYRVDNIMGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g466
###
# start gene g467
Scaffold_10	AUGUSTUS	gene	426326	428068	0.19	+	.	g467
Scaffold_10	AUGUSTUS	transcript	426326	428068	0.19	+	.	g467.t1
Scaffold_10	AUGUSTUS	start_codon	426326	426328	.	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_10	AUGUSTUS	CDS	426326	426860	0.38	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_10	AUGUSTUS	CDS	427100	427267	0.58	+	2	transcript_id "g467.t1"; gene_id "g467";
Scaffold_10	AUGUSTUS	CDS	427389	428068	0.51	+	2	transcript_id "g467.t1"; gene_id "g467";
Scaffold_10	AUGUSTUS	stop_codon	428066	428068	.	+	0	transcript_id "g467.t1"; gene_id "g467";
# protein sequence = [MSETPVQRLVPGAPPPPPLTKSQLKKKRKSKTKANEQAGESLVAITDASTVALVEKAPEIADIQEGIVAPELVAQPSE
# AQSTTEDVTLKLSPIVDLVNKRLKATNKKDCKPSDSTSSYSSQTLLFCSSKTRITTYTTVDPATLNEDQRRAINSLPALEAVSKELGSKKAVERCVSK
# SFSLLASGELDLSEFGFNQEEINAVNGAGVILLGSDAATKDVIVREFLSSNGHFDGVSYAVEVNEHEPSHHSAEVEEYTEPEVAGLVSAPMTTTGSFH
# FMQASELETPSFEENVEWVDTADLVDGSEQVEETEEVNGHLKETPAPEVGEKLNAHATLTEKENVQVPASSEPMDWAAEDDNELPDIDNLHATFGKSG
# SVTPTVQPEPQESPDIIEPTTNDQISSAVEGEDGFTQARGGRGRGRGSRGGDRGSRGGFRGNDRGGYRGGERGGFRGGHRGGDRGKEI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g467
###
# start gene g468
Scaffold_10	AUGUSTUS	gene	436581	439952	0.09	+	.	g468
Scaffold_10	AUGUSTUS	transcript	436581	439952	0.09	+	.	g468.t1
Scaffold_10	AUGUSTUS	start_codon	436581	436583	.	+	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_10	AUGUSTUS	CDS	436581	438082	0.15	+	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_10	AUGUSTUS	CDS	438231	438652	0.14	+	1	transcript_id "g468.t1"; gene_id "g468";
Scaffold_10	AUGUSTUS	CDS	438823	438942	0.52	+	2	transcript_id "g468.t1"; gene_id "g468";
Scaffold_10	AUGUSTUS	CDS	438994	439952	0.55	+	2	transcript_id "g468.t1"; gene_id "g468";
Scaffold_10	AUGUSTUS	stop_codon	439950	439952	.	+	0	transcript_id "g468.t1"; gene_id "g468";
# protein sequence = [MFPIPKNNRPSGWPDTFSSSPSTSTSLSSSFSSGSAASDMLPQDSSQSDIVSSDHLANHTTPLPAPIPRHAAGHDLAL
# AATRPRSSSLAVVMGQNFSKPSASHKGLSISTAAANTGIKLKRAFAGRRKKSEDSTKLFAVTDNKEWDSPASSPSTSSQVTPPASKFPRSTKLTQIAT
# QVIGGAKRAAKSPHASPIPPTPPPKPSSMQVAKLVPTSTPISPLKKVDNRGSIIPMSPGISSAVTFMRLGEEEREAAQVNANEAAAQVKANEAAAAQV
# KTNEAAKEVPKELSNKTDTEKDIWRKSDSTMSHHTIRPGAGAGPRSSRPVSMAESLQSNHTIVPVNKRLSALITDAEFGPPEEEDDSSFVSASEEITP
# IPLSANTSSTNIKGRRSMSLNLGKATKFAISPPSATSTGALDQLKPRSPRESHPRMTPSLSNETPTLTRAAASGIIAPSSSGVQSTGNNIRGRLAAWT
# ATNNASSETYHHHHSHTSRPVPPSAYHRNTPTGYSSDHALGRTTSNNSSGQMSSGRGKQRRTPDAPSGAWSVSSSGTSDSDALLVPAGPSLGTQIRSP
# LRKTAGGAAVAGGIVFGRPLTVVVKETSVGRSPNYDSSSGFDRSKMTMETLGTITKKQSKALETRRLPALVVRYFFVYEPHVSLGADYNLQECSPGEL
# DPHAVASIFKAFLRELPEPILTHSLLPYFEAALAHEQATNEQQLREQPVSSRAMSGQRGPPLPSGPKNGLQGLRKPPSLSTLAMPNLSGLRPPSRSLL
# NVLKSLVRQLPIENRDLILTVTDLIKATAKESQHTRMPLNNLLLVFCPSLNMNPPLLKVLCEAEDIWEQEDPSPVLDIKREDAILDISPSSDIAEAGH
# TARPDTNDTTAAQGIDEGSLSSASASSSPPTSSRVIHGHERLSLERSPTSEERIRSKKPHGPRRAAAVPQVVPVDGTSPVVHNELPYPSGSTDVSFES
# MSLRDDGSCISLIPTRGLSLLHLRLNVEFPRPLYLRRLSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g468
###
# start gene g469
Scaffold_10	AUGUSTUS	gene	440163	440819	0.84	+	.	g469
Scaffold_10	AUGUSTUS	transcript	440163	440819	0.84	+	.	g469.t1
Scaffold_10	AUGUSTUS	start_codon	440163	440165	.	+	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_10	AUGUSTUS	CDS	440163	440819	0.84	+	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_10	AUGUSTUS	stop_codon	440817	440819	.	+	0	transcript_id "g469.t1"; gene_id "g469";
# protein sequence = [MSAPSLSLGSPSPTNSAPSSPRARRIKKPSLQLLFSKRSASSLKSLVDGKPVISSPIPTPLAPSLSSDSSVSTPSSAV
# TAQSVAFFSPPVLDTNIAASPLRFGLGFDPRLSPDLQVQTAAQTNEEQHVEDVVITPVGETPIANRYCTPASSTLSLPLSSDATMPSHLRPYPTARSK
# LTSKTLTSSASSNHLGLLGDQEDQEDWTQSVLLAADAGGNWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g469
###
# start gene g470
Scaffold_10	AUGUSTUS	gene	441520	442920	0.23	+	.	g470
Scaffold_10	AUGUSTUS	transcript	441520	442920	0.23	+	.	g470.t1
Scaffold_10	AUGUSTUS	start_codon	441520	441522	.	+	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_10	AUGUSTUS	CDS	441520	441792	0.67	+	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_10	AUGUSTUS	CDS	441929	442351	1	+	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_10	AUGUSTUS	CDS	442408	442920	0.35	+	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_10	AUGUSTUS	stop_codon	442918	442920	.	+	0	transcript_id "g470.t1"; gene_id "g470";
# protein sequence = [MASDAVKKVQQKLFRGGNISNDDGLPRSEPALTINIPAVPSTPKPPAAAPPKSTKVSDPSPDDDELDARQQQDDRSYR
# ERLASRIGADYKGATVREDYSANGDAWSHFPHEHARSRAYRWGEDGIAGISDNHQRLCFSLSLWNGKDPILKERLFGVTGHQGNHGEDVKELYYYLDS
# TPSHSYMKFLYKYPQRRYPYEELVTENQNRSRDVAEYEILDSDAFDEDRYWDVFVEYAKDEDEPDNVYIRITAYNRGPDPATLHIIPQLWFPNTWSWP
# LEKPPMPSLTAHNRSGINYITAKHPDQPKTHLYCLPSPPPVGPDGNFDVDPETEAVEPELLFTENNTNFSRLYGGQNETPYVKDAFHDHIIPSHRPPH
# LRVMKTSSHIRSALELVSTLLLAPKSTMTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g470
###
# start gene g471
Scaffold_10	AUGUSTUS	gene	448395	449738	0.52	-	.	g471
Scaffold_10	AUGUSTUS	transcript	448395	449738	0.52	-	.	g471.t1
Scaffold_10	AUGUSTUS	stop_codon	448395	448397	.	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_10	AUGUSTUS	CDS	448395	449738	0.52	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_10	AUGUSTUS	start_codon	449736	449738	.	-	0	transcript_id "g471.t1"; gene_id "g471";
# protein sequence = [MSIMFSFVALLNVCLASGVPTQYPLAVWWKGDDDLEYFTLRCRREDQMKQWESTINRLIREAAQRRASDRGGFSRLQQ
# NSTNPRLNPPASVPPYPLPPNGVTSRSRSGSVYDREQGQGPSGPTNGYGSGPQGYPPHDGFDVEADEDEYEDYPPASAQYAPSGRGTPIGQRRTTTAS
# ERDSYVDGHLSAMNGSARPITPRLNSNVSAMSAQSDASFGNIVNGPRLSRPSLRSQFSSTKLRTGYDSSGDYRSGIPPTPASAVYNPPPLNRSRSASQ
# PSAYIPKSEPPPPLPSAQWNSRPSTSVSSSKRGSGSSQSTGDSSDYSPNSSSPITPYGSSESSLAGVNNIRPSRSQVFENGVGHSPFGHPVKVKVHFH
# EDIFVIQVPRMTEFDDLVEKVGRKIRLCGPRRDDGPLRVKYKDEDGDMVSLGSTEDVQMAFEQYRPGGQVTLFVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g471
###
# start gene g472
Scaffold_10	AUGUSTUS	gene	451099	451638	0.33	-	.	g472
Scaffold_10	AUGUSTUS	transcript	451099	451638	0.33	-	.	g472.t1
Scaffold_10	AUGUSTUS	stop_codon	451099	451101	.	-	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_10	AUGUSTUS	CDS	451099	451638	0.33	-	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_10	AUGUSTUS	start_codon	451636	451638	.	-	0	transcript_id "g472.t1"; gene_id "g472";
# protein sequence = [MASVAGRKKSIVSSAGLPIDLPVANNTLLNQAAITSLYQECSRLRSRLMRIRGFDYYFKLASSSDSRQSTDPVTQLWD
# LFSLGIPLCYLFDLLPEDEGFKKLNKSEFNEKFEQNPDRAKKHSILMFAMQLTSEAVTQHIPDCEPFTVTELWLRSSNDGLVKVCPLDLTSFLATDTV
# LRW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g472
###
# start gene g473
Scaffold_10	AUGUSTUS	gene	454933	455283	0.56	-	.	g473
Scaffold_10	AUGUSTUS	transcript	454933	455283	0.56	-	.	g473.t1
Scaffold_10	AUGUSTUS	stop_codon	454933	454935	.	-	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_10	AUGUSTUS	CDS	454933	455283	0.56	-	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_10	AUGUSTUS	start_codon	455281	455283	.	-	0	transcript_id "g473.t1"; gene_id "g473";
# protein sequence = [MNADRSQTPPAQRETAGGEELTTRAGPGPGTIAAAQRRLQAEASSSLPRSRSPTPPRALFRSTTGKGVAFTDEDVTFL
# MRYMEYRKSEGSLDMVAFWKDVATKVSLADVFHDSHSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g473
###
# start gene g474
Scaffold_10	AUGUSTUS	gene	455780	457006	0.16	-	.	g474
Scaffold_10	AUGUSTUS	transcript	455780	457006	0.16	-	.	g474.t1
Scaffold_10	AUGUSTUS	stop_codon	455780	455782	.	-	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_10	AUGUSTUS	CDS	455780	456670	0.18	-	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_10	AUGUSTUS	CDS	456815	457006	0.19	-	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_10	AUGUSTUS	start_codon	457004	457006	.	-	0	transcript_id "g474.t1"; gene_id "g474";
# protein sequence = [MAPARDSIGLHRGIIEPSSSLPPSSNDDLSELFLDPMLGTPLAMYVEKDVQERDVIIGLITVGRSILSNPLVKTFIAS
# MLQKRERSYSTFAGSMNVSKHASFKHFKLIGLDAKLLERKRMCKKNSIFGHSTHISSRALLTPSDILSQPSATVTNPDSPRRRDRQTVQIEEARQIAP
# PPPPPAPIPSQILHPSLHVDSLVHAQNHFPYSIYTASPAQSLHSQRPLQTPPPQTWQATGIAPHQTHAATPSQLLDRPPYRENAWGEYNQHPHAETVN
# PAAYDYRYRDPSPWASTAYYDTPAVPVRGLSACSVFPTNSRIYRSMTKRMIKMITPRIQGLILQSLPQKKSNIPRRLEDANAFVLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g474
###
# start gene g475
Scaffold_10	AUGUSTUS	gene	475659	476458	0.74	+	.	g475
Scaffold_10	AUGUSTUS	transcript	475659	476458	0.74	+	.	g475.t1
Scaffold_10	AUGUSTUS	start_codon	475659	475661	.	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_10	AUGUSTUS	CDS	475659	476018	0.74	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_10	AUGUSTUS	CDS	476063	476458	0.97	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_10	AUGUSTUS	stop_codon	476456	476458	.	+	0	transcript_id "g475.t1"; gene_id "g475";
# protein sequence = [MVHSRSVLTAVIAVGVASSVLAIPVPPASTNTGGPNNGVTPTPSNLLVSGQNVMPSYASNSPSPNVNFVLGQSSSNDS
# QAQGSPIPAGNVKRALERESRYLDITVQDNVDSEEPNEVSPNGLTTSTVRREILERGPDFNIETAMEELASTKYDWSKFLENTQQGQMIKKMDNDSQN
# NWKTYFLSVKTSRERPTNSRASGAPQSTAGPGSQSHNYENLGDKDVKTGAGFTPLMRRARSRARASPYNHVEDLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g475
###
# start gene g476
Scaffold_10	AUGUSTUS	gene	482831	483900	0.93	+	.	g476
Scaffold_10	AUGUSTUS	transcript	482831	483900	0.93	+	.	g476.t1
Scaffold_10	AUGUSTUS	start_codon	482831	482833	.	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_10	AUGUSTUS	CDS	482831	483028	0.93	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_10	AUGUSTUS	CDS	483121	483900	1	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_10	AUGUSTUS	stop_codon	483898	483900	.	+	0	transcript_id "g476.t1"; gene_id "g476";
# protein sequence = [MPNVDSSSSTDDSSPQPQTPLSSSQTGSSIADPANADPSPDNIAGGKKRKQNRRINTAERRATHNADLAAILPNLSQI
# RRPSKSAIVNSSIAYFHASRRHRLLASRELRLLKFETDALRRELNDWRDRASIRRVQEPTRSDGFSIVLSGELEILPIDGIDNEDGDDGDDDLYTPVV
# SPDDNFEHPFDSPRSTRPPASGPEHDSYNMNAVYPIQRPMGGRGPVPVIASPNGMAVENPAAAFDAMGSGVAEPYPAFGEMGQGMQNKWTVQDQAYYG
# PPPEREHVHGNRKTSLGDQPAQYFEQRWNNNNGMHNIEMNGNNSGGSFGMM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g476
###
# start gene g477
Scaffold_10	AUGUSTUS	gene	484722	486164	0.5	-	.	g477
Scaffold_10	AUGUSTUS	transcript	484722	486164	0.5	-	.	g477.t1
Scaffold_10	AUGUSTUS	stop_codon	484722	484724	.	-	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_10	AUGUSTUS	CDS	484722	486164	0.5	-	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_10	AUGUSTUS	start_codon	486162	486164	.	-	0	transcript_id "g477.t1"; gene_id "g477";
# protein sequence = [MRDSNADSASQDASAPGEPDDLFAFRPPPTPAGSSYVLQSPIAFRAPRSSTEISIPAHFASSTSQFGLFSTPGPASSI
# VQPSPPNSFVPSAAYSQDQPYNPARVILPPAQHHDNEYLLPDNREYVSAASNEFSMEPMNPPASSFAPASSFLVPSQQFPYSDPAVGNYVEQHFDANI
# PIHASTPTSMLPIINIGPCSPNDRSNYHENNLDAASDDDIDLHSELTNAFTDPGSAYISSRPLYFDAPTDDPSSDPPDPAYEIDYATLNFQWKPFDRK
# ITGSLEYKHPIRPITHYILEQEPSVTEDLGSLPPSSDQISGDDSNFSNSVLHSGKTGSDRELPLATSSDPPMVDDHSLDTTHNATARVKERTISIESQ
# PAADLPSPTPFRFTPPSQTPSFSQTIVPTNESSPRRLASSRITKNTLLADGRQPPAAASPVFSDPFFSPPNFGDEAKTKVEDLHVLKVGRPFSVKPPI
# YSIRVPLIFP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g477
###
# start gene g478
Scaffold_10	AUGUSTUS	gene	494036	494914	0.93	+	.	g478
Scaffold_10	AUGUSTUS	transcript	494036	494914	0.93	+	.	g478.t1
Scaffold_10	AUGUSTUS	start_codon	494036	494038	.	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_10	AUGUSTUS	CDS	494036	494914	0.93	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_10	AUGUSTUS	stop_codon	494912	494914	.	+	0	transcript_id "g478.t1"; gene_id "g478";
# protein sequence = [MDTRSGEAFTDWGNLFSAPLNPSVFAALDANGVLGPPPQRQHLPNIDVMVQPTGSNQWQESPMSYPRPSMQRSDSSSS
# VQSKNSSFALPPSLWMSPAAAPAGTPIPGPSKHDLGPTPAHSPNTDKSTTAFSDLFSDDLFTASQTTSPRLSGSPELTGSLDTSATSSVADDAAQFAK
# EDPLATQVWKMYARTKAGLPHKQRMENITWRMMAMALKRGDLVDPNDEKALDLYPSSGRLSEEFEASTSTSSIKVEEKDPSITGERGRRKDKGKDRVR
# VVGFDGTNQDEEPALNDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g478
###
# start gene g479
Scaffold_10	AUGUSTUS	gene	494976	497072	0.14	+	.	g479
Scaffold_10	AUGUSTUS	transcript	494976	497072	0.14	+	.	g479.t1
Scaffold_10	AUGUSTUS	start_codon	494976	494978	.	+	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_10	AUGUSTUS	CDS	494976	497072	0.14	+	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_10	AUGUSTUS	stop_codon	497070	497072	.	+	0	transcript_id "g479.t1"; gene_id "g479";
# protein sequence = [MDWRAISRSRSRISMDWRPTSRSRSRPPESTSSASTFSGLNGLGFDMVHMNSNLNFSPMSSSMPNSSMIHALAKPMSG
# LSATRTRSPPGGMNIGMGSIYEDSNAFDTSSDTRYSFANHQFAGVQSPSFAPSSLPSHVMHHPHPHQSSHHPHITSQSSHPTNDSTNPHMGLGLNTSG
# VNFSLGAAGSFSAGGIRSDSPPPPFGFPRHVRKTSFDHTVSKDSIYPLSPAQGGRHQVNGRPLSPKGPNNALLVPRSGLNMAEVGLGMKRRADAPHAE
# SLLRGDLTEMPFNMGSAAGFTLSQSLPAHSHIHTAQHSSRYGPHLPSQHSQHHTGRHHQMGSGDGAEHSSAGGVSGPGSPFPSSTSFNFSFPTYDDNS
# TFEAASSTSNFEGFSDAAGVGSQFKSARSSISGPTHSPYMTNSSNDLTGHHSHPNHGRGGHSHHNSTGSGGAGSNLSAAAASASVVMAEGYARLSAVN
# GIDDLTGGGMGLGGIGIDGSGGSAVDYTLMGSLGPLYSGLEDSSTGAGNSSGPFTHVDPTQILAGSGGVYAHASPSSDGWGPTSTALPNASGGPGSSS
# SPEASNASTPPSGEGGSGLLTGSSSKAGRKYLSLKDEKTRMTGLGDSLRSGSSTPDLETNSASKDGKGTKSNGEDGDNPTLCTNCRTTNTPLWRRDPE
# GQPLCEYPPPSFPEKYLSFRFSSQVMHAVCSM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g479
###
# start gene g480
Scaffold_10	AUGUSTUS	gene	498761	499984	0.14	+	.	g480
Scaffold_10	AUGUSTUS	transcript	498761	499984	0.14	+	.	g480.t1
Scaffold_10	AUGUSTUS	start_codon	498761	498763	.	+	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_10	AUGUSTUS	CDS	498761	498793	0.14	+	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_10	AUGUSTUS	CDS	498851	499984	0.39	+	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_10	AUGUSTUS	stop_codon	499982	499984	.	+	0	transcript_id "g480.t1"; gene_id "g480";
# protein sequence = [MLGQNTVRERSKTDASSPSTSHSNSSLYDAFTPPVPPLPMGSRPIPSTSPIADVFSSSALRPSSPSISKPLPPIMTTG
# TREIEDGRSMVFVDMMPSDNTTVKGKRRSLSVSRIDTSSVMAGAILGGPPRTPDRSPLRTPVTENDGLSGGRIEDTTLNGIITHFKGELSQLDPITVS
# NLDLRDPSTPARRAALLNPNTNGYSQGGQDSDSKHASMMPTVTLQPPFRTEETAQELDVRSVPPSPSAHRVSTVLSNLDPATNPRNLSLQTSLRSSLG
# SAGGGTTSARNMHRQSLSPLRSRSGPAESLTYSNLPSPHLTGASSARGLRVIHRSTASSSEPSLIPTVVAADGARIGTCRYTSTTLFPFHYHRKRQCL
# FFWSPCLSIDLVLFSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g480
###
# start gene g481
Scaffold_10	AUGUSTUS	gene	500395	501267	0.33	+	.	g481
Scaffold_10	AUGUSTUS	transcript	500395	501267	0.33	+	.	g481.t1
Scaffold_10	AUGUSTUS	start_codon	500395	500397	.	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_10	AUGUSTUS	CDS	500395	501267	0.33	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_10	AUGUSTUS	stop_codon	501265	501267	.	+	0	transcript_id "g481.t1"; gene_id "g481";
# protein sequence = [MTSSCSDVCVQNSTSRLKRSKLIVYSRNSVRRYWECNPNTLYGSSSASSMLPDVYFRLTTIRVDLVHAVAYSLLLLNT
# DLHVADLTSRMSRSQFVRNTLAAIQMQLQPSSSTSPKASSPDVYDESGSLRNFPLPGSDQSSNSSSVAVSEGSELDTITRSKRSDSITSWNSISRDTI
# LSSPALSLATSQATTPIVENDCTPNISDLQSSTTSMASSNIVYGRAWEAGMENLLKVLWFHAINRIITDLFVGNVQRHQESANTPAFECQQDINVFLT
# KSRRANVKEPQPTRTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g481
###
# start gene g482
Scaffold_10	AUGUSTUS	gene	501962	502522	0.78	+	.	g482
Scaffold_10	AUGUSTUS	transcript	501962	502522	0.78	+	.	g482.t1
Scaffold_10	AUGUSTUS	start_codon	501962	501964	.	+	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_10	AUGUSTUS	CDS	501962	502522	0.78	+	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_10	AUGUSTUS	stop_codon	502520	502522	.	+	0	transcript_id "g482.t1"; gene_id "g482";
# protein sequence = [MVLTLSNGGVYFFQAGTEELVNEWVSTCNYWAARTSKEPLSGGVSNMEYGWNRVPDPAHGRSHSDSESVRDSDVTSVR
# SNKSARSRFNWREGSATVRGQSPWNDRIHINDWKPPMPPTVASLHDEETQMDALKKYVKSLKRDLQKHNELREPMSALVSEDFFFPVEFNNVVPAVST
# SYEQCSQGDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g482
###
# start gene g483
Scaffold_10	AUGUSTUS	gene	510354	511125	0.41	+	.	g483
Scaffold_10	AUGUSTUS	transcript	510354	511125	0.41	+	.	g483.t1
Scaffold_10	AUGUSTUS	start_codon	510354	510356	.	+	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_10	AUGUSTUS	CDS	510354	510356	0.41	+	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_10	AUGUSTUS	CDS	510457	511125	0.75	+	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_10	AUGUSTUS	stop_codon	511123	511125	.	+	0	transcript_id "g483.t1"; gene_id "g483";
# protein sequence = [MSRPFSPYRHAPTQEDLLAAATRGRAIVIPEEEEPTKASSVAHSRASKTASAAPSATPSHRTRQSVATNGKASNKLPS
# IAPSKQPSMAPSKPSSIAPSKQPSVAPSHQGRSSRNRDVDATPTPSRPHTPDMDELNQEEARIVEQALASAVRTPRTSYYTPSVLDAEVQQSSFHDNE
# LCILLHQLKAPQTHDLVRKVVLKAVKQRMKKLSMNYDNEVRVNLDLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g483
###
# start gene g484
Scaffold_10	AUGUSTUS	gene	511325	512368	0.97	+	.	g484
Scaffold_10	AUGUSTUS	transcript	511325	512368	0.97	+	.	g484.t1
Scaffold_10	AUGUSTUS	start_codon	511325	511327	.	+	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_10	AUGUSTUS	CDS	511325	512368	0.97	+	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_10	AUGUSTUS	stop_codon	512366	512368	.	+	0	transcript_id "g484.t1"; gene_id "g484";
# protein sequence = [MQQRIESLGPKIENLRPPPPPQSYVEEGNFYDDDQYTHTPVTQTVNIHTQATGTMAESMYQPETETMEDAPPGSHFDN
# AAEFEDDGEMTEPTHRGFPAPTADQSRTPPNYALSDGRDDSPGQQYLEEELYKLQQRPSATGEEQTTWDLRRSDVPDEYDDEESPAVAPTIPGSEAGD
# LNRRSTSPSLPPIPRDDTGQRSLVPQPQWNGNYNDHQQDLPPWQKIHQRLLSWAIVWPLSELDEALNSTTRGHQVNEVAMSIWSTQTYKRYVRTRMTD
# TPSGVVDRLFVPPNMADAISNAVYNGRHGDACGMLRDLWGPFGLQGMPRLLVVLAKHRSDENHWVVHRYVFDH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g484
###
# start gene g485
Scaffold_10	AUGUSTUS	gene	532837	533905	0.35	-	.	g485
Scaffold_10	AUGUSTUS	transcript	532837	533905	0.35	-	.	g485.t1
Scaffold_10	AUGUSTUS	stop_codon	532837	532839	.	-	0	transcript_id "g485.t1"; gene_id "g485";
Scaffold_10	AUGUSTUS	CDS	532837	533586	0.73	-	0	transcript_id "g485.t1"; gene_id "g485";
Scaffold_10	AUGUSTUS	CDS	533705	533905	0.35	-	0	transcript_id "g485.t1"; gene_id "g485";
Scaffold_10	AUGUSTUS	start_codon	533903	533905	.	-	0	transcript_id "g485.t1"; gene_id "g485";
# protein sequence = [MDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFYIRIYCSYQQD
# DWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLA
# KHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLR
# YYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g485
###
# start gene g486
Scaffold_10	AUGUSTUS	gene	535062	536467	0.7	-	.	g486
Scaffold_10	AUGUSTUS	transcript	535062	536467	0.7	-	.	g486.t1
Scaffold_10	AUGUSTUS	stop_codon	535062	535064	.	-	0	transcript_id "g486.t1"; gene_id "g486";
Scaffold_10	AUGUSTUS	CDS	535062	535864	0.99	-	2	transcript_id "g486.t1"; gene_id "g486";
Scaffold_10	AUGUSTUS	CDS	535936	536467	0.7	-	0	transcript_id "g486.t1"; gene_id "g486";
Scaffold_10	AUGUSTUS	start_codon	536465	536467	.	-	0	transcript_id "g486.t1"; gene_id "g486";
# protein sequence = [MFLKIIPTTKISPVNLRLFDGSLSSKPITDMANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASR
# NITFRNTSHLDSPQTSVPSAINRCCKGRCSATGTFAVGFTDNSGDPSWGLTSLSLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIAL
# VKVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHG
# APVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISFFLDAPKRAKIYTKLDLAHAYHLFRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQR
# FVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVRKFFGGYGNIGFTPTPTSANSIWILLSIWVIFFLPTD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g486
###
# start gene g487
Scaffold_10	AUGUSTUS	gene	536825	538371	0.44	-	.	g487
Scaffold_10	AUGUSTUS	transcript	536825	538371	0.44	-	.	g487.t1
Scaffold_10	AUGUSTUS	stop_codon	536825	536827	.	-	0	transcript_id "g487.t1"; gene_id "g487";
Scaffold_10	AUGUSTUS	CDS	536825	537512	0.98	-	1	transcript_id "g487.t1"; gene_id "g487";
Scaffold_10	AUGUSTUS	CDS	538133	538371	0.46	-	0	transcript_id "g487.t1"; gene_id "g487";
Scaffold_10	AUGUSTUS	start_codon	538369	538371	.	-	0	transcript_id "g487.t1"; gene_id "g487";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTCTLVTDNL
# SNGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKD
# EMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPNLNPSLVVSLTTMVSPRTLRIPAN
# PAVSAPRSTILGRWKVLPSEGKKDEEQPLSLLRW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g487
###
# start gene g488
Scaffold_10	AUGUSTUS	gene	539313	539831	0.61	-	.	g488
Scaffold_10	AUGUSTUS	transcript	539313	539831	0.61	-	.	g488.t1
Scaffold_10	AUGUSTUS	stop_codon	539313	539315	.	-	0	transcript_id "g488.t1"; gene_id "g488";
Scaffold_10	AUGUSTUS	CDS	539313	539831	0.61	-	0	transcript_id "g488.t1"; gene_id "g488";
Scaffold_10	AUGUSTUS	start_codon	539829	539831	.	-	0	transcript_id "g488.t1"; gene_id "g488";
# protein sequence = [MDRLLREGTPAYFLHISPTKEESPTEEMLRASDSNAQRVQQPKDPESGTLVRNKGGRQGARQRRSKRQETEELKKSIP
# VQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGSYDPPAPLRELLSCLPRKRMVPCDSAWTIEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g488
###
# start gene g489
Scaffold_10	AUGUSTUS	gene	541306	543746	0.15	-	.	g489
Scaffold_10	AUGUSTUS	transcript	541306	543746	0.15	-	.	g489.t1
Scaffold_10	AUGUSTUS	stop_codon	541306	541308	.	-	0	transcript_id "g489.t1"; gene_id "g489";
Scaffold_10	AUGUSTUS	CDS	541306	542750	0.37	-	2	transcript_id "g489.t1"; gene_id "g489";
Scaffold_10	AUGUSTUS	CDS	543083	543746	0.19	-	0	transcript_id "g489.t1"; gene_id "g489";
Scaffold_10	AUGUSTUS	start_codon	543744	543746	.	-	0	transcript_id "g489.t1"; gene_id "g489";
# protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP
# RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA
# PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLQGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRS
# GGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNR
# ITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEA
# DEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVQGWL
# SRFPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGRFPNRPTGKRDDKGRLQLGGKEKVTIAKTERRTKTAVTAGMEENGLKRSSEQELPTPGGN
# GLLRKERRSGGDEGRSSACVVDERNTGQRTALTQNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g489
###
# start gene g490
Scaffold_10	AUGUSTUS	gene	548063	548932	0.88	-	.	g490
Scaffold_10	AUGUSTUS	transcript	548063	548932	0.88	-	.	g490.t1
Scaffold_10	AUGUSTUS	stop_codon	548063	548065	.	-	0	transcript_id "g490.t1"; gene_id "g490";
Scaffold_10	AUGUSTUS	CDS	548063	548932	0.88	-	0	transcript_id "g490.t1"; gene_id "g490";
Scaffold_10	AUGUSTUS	start_codon	548930	548932	.	-	0	transcript_id "g490.t1"; gene_id "g490";
# protein sequence = [MPTSIRSLPPELLYAVFELTMSAENDPLESHDDEITVSPPWPDIFDLKKGPWVLAQVCSRWRFIALSIPQLWSNFYVR
# LPRCKDSAVDVLQAWLGRSGNRPLQFQITATLGFCGHHCGSALLTTLASTSARWQTVELVDVSIKFLDTLAMQREIQLCSLPLLKELSLRSRNWDIES
# DDSPEFEDPSTAYEVFFRAPNLDTLINLDTLSLSVFKLPWNQLTTYIGSDASHAIDHLEIMLLCPNLIECDVAFDRTHTWPTIPSLPLKQLKSGPYGL
# GILLMTFHCFCPNNY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g490
###
# start gene g491
Scaffold_10	AUGUSTUS	gene	557836	558648	0.6	+	.	g491
Scaffold_10	AUGUSTUS	transcript	557836	558648	0.6	+	.	g491.t1
Scaffold_10	AUGUSTUS	start_codon	557836	557838	.	+	0	transcript_id "g491.t1"; gene_id "g491";
Scaffold_10	AUGUSTUS	CDS	557836	558648	0.6	+	0	transcript_id "g491.t1"; gene_id "g491";
Scaffold_10	AUGUSTUS	stop_codon	558646	558648	.	+	0	transcript_id "g491.t1"; gene_id "g491";
# protein sequence = [MLEAELLQGPLELTRRTKMLVWDDEIEISRDDSGLDEAVRDLNEPTSSPKLSINSVPIIPRRTRSQSSSGEFPPPMRR
# IITESGINRPVPFSSKFQRVHPGTTGVTVLEHLERLDAVEASLQRLVSDDNVDEVDVGESQNVHIQNEPTTSNLPPTSPFSPPGSPLATVPEIASLES
# SITEEDLVALSKSTSHLEGSSTISGRHTRWASQALGSGVDWLQENETPVTRTVISEVNLLCCSSSISVLTASLRDWKWLLRSHCARVGDTNRQV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g491
###
# start gene g492
Scaffold_10	AUGUSTUS	gene	566098	566721	0.47	+	.	g492
Scaffold_10	AUGUSTUS	transcript	566098	566721	0.47	+	.	g492.t1
Scaffold_10	AUGUSTUS	start_codon	566098	566100	.	+	0	transcript_id "g492.t1"; gene_id "g492";
Scaffold_10	AUGUSTUS	CDS	566098	566721	0.47	+	0	transcript_id "g492.t1"; gene_id "g492";
Scaffold_10	AUGUSTUS	stop_codon	566719	566721	.	+	0	transcript_id "g492.t1"; gene_id "g492";
# protein sequence = [MDELVQCFSRYGVLEEDDEGDPKVKMYAKDDGSFSGEALVVYFKEDSVVLALNILDESELRLGDPSTRMSVAKADFAH
# KTSQTNGAGGEPRKTVDKKKVSRRLGKMQKYCRYSFVFFYYEFSSFTRKLEEWVDEDGFGPAMEPEDNANVANKNGRVVVLKHMFTLDNLQKDASLLL
# DLKEDVREECSSLGEVTNVVLYDVSTTKYIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g492
###
# start gene g493
Scaffold_10	AUGUSTUS	gene	567119	567734	0.35	-	.	g493
Scaffold_10	AUGUSTUS	transcript	567119	567734	0.35	-	.	g493.t1
Scaffold_10	AUGUSTUS	stop_codon	567119	567121	.	-	0	transcript_id "g493.t1"; gene_id "g493";
Scaffold_10	AUGUSTUS	CDS	567119	567353	0.85	-	1	transcript_id "g493.t1"; gene_id "g493";
Scaffold_10	AUGUSTUS	CDS	567481	567734	0.35	-	0	transcript_id "g493.t1"; gene_id "g493";
Scaffold_10	AUGUSTUS	start_codon	567732	567734	.	-	0	transcript_id "g493.t1"; gene_id "g493";
# protein sequence = [MSFTIDTKDPILGDAVVVNPEISSGLPLQGVNRFPPPGSRPEKYSTPATKGATICVLSSSSASLNNHILSFRYRSKPL
# LETRRPTVAAPAEGDTAEGSKAVSTAQDPIELAAAISQITKSTKLYSESKLPPTLTLSYPRWRPERAPDAPHPQHAYFPLQLYK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g493
###
# start gene g494
Scaffold_10	AUGUSTUS	gene	570660	571571	0.97	-	.	g494
Scaffold_10	AUGUSTUS	transcript	570660	571571	0.97	-	.	g494.t1
Scaffold_10	AUGUSTUS	stop_codon	570660	570662	.	-	0	transcript_id "g494.t1"; gene_id "g494";
Scaffold_10	AUGUSTUS	CDS	570660	571571	0.97	-	0	transcript_id "g494.t1"; gene_id "g494";
Scaffold_10	AUGUSTUS	start_codon	571569	571571	.	-	0	transcript_id "g494.t1"; gene_id "g494";
# protein sequence = [MGLLDYLSPSKSSLNAQERSQREESPVNVQITPATPLTSSADVPFPLSPVTSPNEIAYDEKPMKQPLRRFSFRPFAVQ
# LHLEHNDTLSSIQEREKKEQATAALSKRVVKPISSSSDKRAKQSALLVRGLIVGPTASSPKLSSAVAKPQMGKLKSQLMQAKSANKIIAHLRTLSADS
# AEPKPTGPIHAVCLAHPDGEEHELHFSKLGTTTPPSVSSFAVMNSAPLEALSSLFNEMHVIDLVKSPDFGLGQPGDGNGILAGALPTAETVINGIEQI
# TPQLMALGYATGRAVMPDHTGQSLFAYTP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g494
###
# start gene g495
Scaffold_10	AUGUSTUS	gene	580841	581908	0.2	+	.	g495
Scaffold_10	AUGUSTUS	transcript	580841	581908	0.2	+	.	g495.t1
Scaffold_10	AUGUSTUS	start_codon	580841	580843	.	+	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_10	AUGUSTUS	CDS	580841	581026	0.28	+	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_10	AUGUSTUS	CDS	581084	581908	0.42	+	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_10	AUGUSTUS	stop_codon	581906	581908	.	+	0	transcript_id "g495.t1"; gene_id "g495";
# protein sequence = [MADVDVTSPGIWDRESDMHYEELKRKELEEEASGIIDTEGPPRPKAIGGQLTESNLKLWLSVNPREPTSRQQTLNSYI
# KSQRTLLEAEALARARAFHEAKELDNRMRDTYSQLRRSAYDMGNSASPADDTGGVRIKPPTSPVSASFPRAHDRSHSRDVTLLENGMIVEHVDVRKEE
# KEARDRRRKDERRARKSSRSSAVDVNSLMSTHSLVAPHTDSGVGLKPYSRYSQASSARPLSVLTAPLDRPDLPRALSQASFSDVHSLGSPSSRRTRFF
# GVRSSYWKSQDSLAMSGVSGSMLDMQCVIFIGARRHQITDCNVVLLFREKEIEVKWYSPLLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g495
###
# start gene g496
Scaffold_10	AUGUSTUS	gene	582163	583260	0.43	+	.	g496
Scaffold_10	AUGUSTUS	transcript	582163	583260	0.43	+	.	g496.t1
Scaffold_10	AUGUSTUS	start_codon	582163	582165	.	+	0	transcript_id "g496.t1"; gene_id "g496";
Scaffold_10	AUGUSTUS	CDS	582163	583260	0.43	+	0	transcript_id "g496.t1"; gene_id "g496";
Scaffold_10	AUGUSTUS	stop_codon	583258	583260	.	+	0	transcript_id "g496.t1"; gene_id "g496";
# protein sequence = [MSPRHASTPSLPLASSPKLALSSTTGISPPTAPSTSLPSPASSRQSGADQDTGEGKKTTIVNGDEIEPPNAGYFISSN
# VHSPISEPDLRRISQTAVPIIDVPMDKHFSQTVSSRLTISTLSREKSLPPLPNDAIIRPYVNGSARDNSRPRTVYTFDSRPPGTGAPHDFIPPQAPFR
# TEARRQSFGGLTSRPNLSSFLSRSTNSKAVANPQQGLAPTYDEFGASRGSLRLPPADTNARNSVAHTGPTPTKRRSRFGLSSLLGKKNTSPDRSKEAY
# EPQYQPYTVPNQQGQPQQQQQFPALHTSGSDVHDEVMTGYATSNSRHSGSGGGGPRMSITSRKALDELVSQDAEFVAYRYPSNDQRLDLLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g496
###
# start gene g497
Scaffold_10	AUGUSTUS	gene	583889	584233	0.98	+	.	g497
Scaffold_10	AUGUSTUS	transcript	583889	584233	0.98	+	.	g497.t1
Scaffold_10	AUGUSTUS	start_codon	583889	583891	.	+	0	transcript_id "g497.t1"; gene_id "g497";
Scaffold_10	AUGUSTUS	CDS	583889	584233	0.98	+	0	transcript_id "g497.t1"; gene_id "g497";
Scaffold_10	AUGUSTUS	stop_codon	584231	584233	.	+	0	transcript_id "g497.t1"; gene_id "g497";
# protein sequence = [MPPSYEPLPSNDSEQDITQPQTSAPQKAGKQPITRSNLLFIILGFLVTAFVFYKAGQWSVSLLPSTSVEQSSSIPTGD
# VKENESVPDDNLKNGSSSSSSASTIDETMPGKYSVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g497
###
# start gene g498
Scaffold_10	AUGUSTUS	gene	585239	585694	0.77	+	.	g498
Scaffold_10	AUGUSTUS	transcript	585239	585694	0.77	+	.	g498.t1
Scaffold_10	AUGUSTUS	start_codon	585239	585241	.	+	0	transcript_id "g498.t1"; gene_id "g498";
Scaffold_10	AUGUSTUS	CDS	585239	585694	0.77	+	0	transcript_id "g498.t1"; gene_id "g498";
Scaffold_10	AUGUSTUS	stop_codon	585692	585694	.	+	0	transcript_id "g498.t1"; gene_id "g498";
# protein sequence = [MPLYGRSFLQTQGPGTPFNGVGQGSWEAGVYDYRALPLPGSHLMQDDKAKASWGYDYQKQEMISFDSEDVGRWKGAWI
# KKMGLGGSMFWELSGDKGGPERKEMEGGHGKDPQPGQSLVKVVKEAMGGIEMGQHNWLNYESSRFDNLRNGMQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g498
###
# start gene g499
Scaffold_10	AUGUSTUS	gene	587404	587958	0.53	-	.	g499
Scaffold_10	AUGUSTUS	transcript	587404	587958	0.53	-	.	g499.t1
Scaffold_10	AUGUSTUS	stop_codon	587404	587406	.	-	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_10	AUGUSTUS	CDS	587404	587958	0.53	-	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_10	AUGUSTUS	start_codon	587956	587958	.	-	0	transcript_id "g499.t1"; gene_id "g499";
# protein sequence = [MIKPDIGKLPKNLVDRIPLVVYIPTPSDASPTEGPKQMPTSIYSYSPKSPAKGTEIPAKKCFKFIKFHQFSSKFNKTT
# NDGLTSILKQANPTESGFWEDSWDTGGHPHVVLDDNRVACAICLLDFEEPKRLHIMGEEQSKGGQGKAGVISEKKYENDELKSADVSEGAQLLRLLRC
# GHVFHVRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g499
###
# start gene g500
Scaffold_10	AUGUSTUS	gene	589827	590998	0.21	-	.	g500
Scaffold_10	AUGUSTUS	transcript	589827	590998	0.21	-	.	g500.t1
Scaffold_10	AUGUSTUS	stop_codon	589827	589829	.	-	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_10	AUGUSTUS	CDS	589827	590290	0.65	-	2	transcript_id "g500.t1"; gene_id "g500";
Scaffold_10	AUGUSTUS	CDS	590350	590533	0.66	-	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_10	AUGUSTUS	CDS	590606	590623	0.38	-	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_10	AUGUSTUS	CDS	590729	590998	0.94	-	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_10	AUGUSTUS	start_codon	590996	590998	.	-	0	transcript_id "g500.t1"; gene_id "g500";
# protein sequence = [MSLENRVQKALVLESPKTPFVLKTVPIPKPGPGEVLVKIIASGLNPVDWFIQSRDLFAPNTPYPAIIGLDMAGDVEEV
# GEGVKEISKGDRQYALAPIPENLSYGQAACVPLTFSTAVYGLLPAHPVGMGLNPTFDDTVSYPKEIALVIGGSTSVGQYAIQILKYLGFGTIIVYAST
# KHTEYLKSLGATHFIDRNEISFADLPAALPKVCSQPVKIIYTAVTSPEAQNAAYACLADDGKLAIATPRIVPWGDAEVTTKKVYGVFGGPHIPPNREF
# GVTLWKHLPRLLERGVFVVSKRLKFVFVIIFRPSCSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g500
###
# start gene g501
Scaffold_10	AUGUSTUS	gene	592904	593164	0.86	+	.	g501
Scaffold_10	AUGUSTUS	transcript	592904	593164	0.86	+	.	g501.t1
Scaffold_10	AUGUSTUS	start_codon	592904	592906	.	+	0	transcript_id "g501.t1"; gene_id "g501";
Scaffold_10	AUGUSTUS	CDS	592904	593164	0.86	+	0	transcript_id "g501.t1"; gene_id "g501";
Scaffold_10	AUGUSTUS	stop_codon	593162	593164	.	+	0	transcript_id "g501.t1"; gene_id "g501";
# protein sequence = [MDDLSRWSSDGKLLEAFGAGTAVIITSIGKIGFKGEDIILPEHKGGLGPIANAFRTRILDIQEGKEVWKNWGVVVDGK
# TAPTKTEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g501
###
# start gene g502
Scaffold_10	AUGUSTUS	gene	594495	595403	0.33	+	.	g502
Scaffold_10	AUGUSTUS	transcript	594495	595403	0.33	+	.	g502.t1
Scaffold_10	AUGUSTUS	start_codon	594495	594497	.	+	0	transcript_id "g502.t1"; gene_id "g502";
Scaffold_10	AUGUSTUS	CDS	594495	595403	0.33	+	0	transcript_id "g502.t1"; gene_id "g502";
Scaffold_10	AUGUSTUS	stop_codon	595401	595403	.	+	0	transcript_id "g502.t1"; gene_id "g502";
# protein sequence = [MGGMAVLEWPLCTPPGYVKHIIPIATSARHSAWCISWGEAQRQSIYSDPGYQDGYYTSQPASGLAAARMSALLTYRSR
# DSFESRFGRKAQIQKEARRPLTPPGSPKIRAEDDARVAHNDGYRNSHTNSQSTTPAPKTTTPIFSAQSYLRYQGDKFTSRFDANCYIHITRKLDTHDL
# ARDRFIEGEDQDDDSAALARVLSTLPPRALVISISTDGLFTPSEQKEIAAHIPGAELVTVQSPDGHDGFLLEFEQINTHIMRFLMREFPRFYERELRG
# DEADEAVEGFEIKKTSLFGEAEADITHW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g502
###
# start gene g503
Scaffold_10	AUGUSTUS	gene	598923	599681	0.51	-	.	g503
Scaffold_10	AUGUSTUS	transcript	598923	599681	0.51	-	.	g503.t1
Scaffold_10	AUGUSTUS	stop_codon	598923	598925	.	-	0	transcript_id "g503.t1"; gene_id "g503";
Scaffold_10	AUGUSTUS	CDS	598923	599681	0.51	-	0	transcript_id "g503.t1"; gene_id "g503";
Scaffold_10	AUGUSTUS	start_codon	599679	599681	.	-	0	transcript_id "g503.t1"; gene_id "g503";
# protein sequence = [MAVPDLLNRTFHEVDASLSQMCEESDGKIHSGCTAVTAFLRIEDADGHQSFLDLAQSQSPYPESPVATKVQESDEPPS
# PHGQGEWRSVSGDEVAKPKKKSLSDPIKKALRSLGGGSISGAISPARKTQSPTPSSPKESREKKPVRIPPESSRRVLYCANAGDARGVLCRAGKAVRL
# TYDHKGSDKQEAKRITDAGGFVMGGRVNGVLAVTRSLGDSSMKDFVVGAPYTTETELIEEDEFLILACDGVCSLRP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g503
###
# start gene g504
Scaffold_10	AUGUSTUS	gene	601212	601811	0.7	-	.	g504
Scaffold_10	AUGUSTUS	transcript	601212	601811	0.7	-	.	g504.t1
Scaffold_10	AUGUSTUS	stop_codon	601212	601214	.	-	0	transcript_id "g504.t1"; gene_id "g504";
Scaffold_10	AUGUSTUS	CDS	601212	601811	0.7	-	0	transcript_id "g504.t1"; gene_id "g504";
Scaffold_10	AUGUSTUS	start_codon	601809	601811	.	-	0	transcript_id "g504.t1"; gene_id "g504";
# protein sequence = [MEDTHAFIVDFDSVRGQGYFGVFDGHGNKCVSEWCGQEFHKVSMNWCPVHDRLIDSAQIFLNCIHKNPTLNGLDVLKK
# SFLEADEVLGKMSEGSDELADSGSTAVVAFLRIEDSDGSQNFPHTDLPEHGKVKVPPQDARRVFYCGNVGDARGVMCRNGTATRLTHDHKPSDSDEQA
# RIRVQAGSCFEAVFLAHWQYLEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g504
###
# start gene g505
Scaffold_10	AUGUSTUS	gene	602542	603033	0.68	+	.	g505
Scaffold_10	AUGUSTUS	transcript	602542	603033	0.68	+	.	g505.t1
Scaffold_10	AUGUSTUS	start_codon	602542	602544	.	+	0	transcript_id "g505.t1"; gene_id "g505";
Scaffold_10	AUGUSTUS	CDS	602542	603033	0.68	+	0	transcript_id "g505.t1"; gene_id "g505";
Scaffold_10	AUGUSTUS	stop_codon	603031	603033	.	+	0	transcript_id "g505.t1"; gene_id "g505";
# protein sequence = [MSTQSAAPKPSLQGVRIKARKGAVKAHAKHEPTGNNFYFDIHTSAHSYSTVFRDQLYKHLETVPDGDFESFTTKLIQA
# GSTLEFLKYADPLFEIILVGGLLQPGGSYIDDGAPVSPFAIFNAKDPANVEEIKKYIEVLNKLIRRYVVLASVFDHTLILFLGSC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g505
###
# start gene g506
Scaffold_10	AUGUSTUS	gene	603321	603752	0.33	+	.	g506
Scaffold_10	AUGUSTUS	transcript	603321	603752	0.33	+	.	g506.t1
Scaffold_10	AUGUSTUS	start_codon	603321	603323	.	+	0	transcript_id "g506.t1"; gene_id "g506";
Scaffold_10	AUGUSTUS	CDS	603321	603515	0.73	+	0	transcript_id "g506.t1"; gene_id "g506";
Scaffold_10	AUGUSTUS	CDS	603594	603752	0.33	+	0	transcript_id "g506.t1"; gene_id "g506";
Scaffold_10	AUGUSTUS	stop_codon	603750	603752	.	+	0	transcript_id "g506.t1"; gene_id "g506";
# protein sequence = [MDHLSGSLKKGGIRDLLAFFPANKQEPKQLEEHFRKADLPQIAEWYAKKQYAMIKDAIVKEVQSLIVAAVKAQQGSTP
# IPDPELVACLWQGLISSVDWSARPDQIEGLALREVGVRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g506
###
# start gene g507
Scaffold_10	AUGUSTUS	gene	605016	605324	0.46	-	.	g507
Scaffold_10	AUGUSTUS	transcript	605016	605324	0.46	-	.	g507.t1
Scaffold_10	AUGUSTUS	stop_codon	605016	605018	.	-	0	transcript_id "g507.t1"; gene_id "g507";
Scaffold_10	AUGUSTUS	CDS	605016	605324	0.46	-	0	transcript_id "g507.t1"; gene_id "g507";
Scaffold_10	AUGUSTUS	start_codon	605322	605324	.	-	0	transcript_id "g507.t1"; gene_id "g507";
# protein sequence = [MLASTGQTMDENSLLRKILAGELHYAKLWLVCVALRGVSWDKMPFEQRELAFQAKDAASSCLDIFLSSPEYRYAMSEM
# DGVYLTNIVPYLVLPSDMQFTIAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g507
###
# start gene g508
Scaffold_10	AUGUSTUS	gene	608903	609355	0.69	-	.	g508
Scaffold_10	AUGUSTUS	transcript	608903	609355	0.69	-	.	g508.t1
Scaffold_10	AUGUSTUS	stop_codon	608903	608905	.	-	0	transcript_id "g508.t1"; gene_id "g508";
Scaffold_10	AUGUSTUS	CDS	608903	609355	0.69	-	0	transcript_id "g508.t1"; gene_id "g508";
Scaffold_10	AUGUSTUS	start_codon	609353	609355	.	-	0	transcript_id "g508.t1"; gene_id "g508";
# protein sequence = [MKISQQTQLLEIQQSIEREKSTRIESVSISCCVRVNKANSKIPVGIRTAAIAKLQYMKKELEKLDEELTAYGACDPVK
# LEETRRAITLGKEAAMRWTGNLDVPFLISLTHEFFGAENYSALLPHFLHHSMASIEDIRKYLEIDEEYEDIY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g508
###
# start gene g509
Scaffold_10	AUGUSTUS	gene	618770	619264	0.47	+	.	g509
Scaffold_10	AUGUSTUS	transcript	618770	619264	0.47	+	.	g509.t1
Scaffold_10	AUGUSTUS	start_codon	618770	618772	.	+	0	transcript_id "g509.t1"; gene_id "g509";
Scaffold_10	AUGUSTUS	CDS	618770	619264	0.47	+	0	transcript_id "g509.t1"; gene_id "g509";
Scaffold_10	AUGUSTUS	stop_codon	619262	619264	.	+	0	transcript_id "g509.t1"; gene_id "g509";
# protein sequence = [MLLRSMTCSTDIQIPATATSTTSLSAYMNPCSSVNEPSISPSSPSPGSLSDDLPVSGSLGSFFDDPPASGSAPFICTN
# SSFDKTSISPSTSSLGPLSDDILVSDELQSIDAARSSTLDTMFNETFKRTRDDQEKSIDFATKYIEILIQQCSVSATLDEVKLFTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g509
###
# start gene g510
Scaffold_10	AUGUSTUS	gene	624583	624969	0.44	+	.	g510
Scaffold_10	AUGUSTUS	transcript	624583	624969	0.44	+	.	g510.t1
Scaffold_10	AUGUSTUS	start_codon	624583	624585	.	+	0	transcript_id "g510.t1"; gene_id "g510";
Scaffold_10	AUGUSTUS	CDS	624583	624591	0.44	+	0	transcript_id "g510.t1"; gene_id "g510";
Scaffold_10	AUGUSTUS	CDS	624664	624969	0.82	+	0	transcript_id "g510.t1"; gene_id "g510";
Scaffold_10	AUGUSTUS	stop_codon	624967	624969	.	+	0	transcript_id "g510.t1"; gene_id "g510";
# protein sequence = [MGVRPLHITFVIQVVASSNETNHVPNNINAPSGTNSDEPLDPDEIMDDIDDIMDIEEDVSKQAAEEEDKMDIDQGLNA
# GHLAPMDLLMERFSAVMCPGSWMDDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g510
###
# start gene g511
Scaffold_10	AUGUSTUS	gene	627038	629418	0.26	-	.	g511
Scaffold_10	AUGUSTUS	transcript	627038	629418	0.26	-	.	g511.t1
Scaffold_10	AUGUSTUS	stop_codon	627038	627040	.	-	0	transcript_id "g511.t1"; gene_id "g511";
Scaffold_10	AUGUSTUS	CDS	627038	628458	0.99	-	2	transcript_id "g511.t1"; gene_id "g511";
Scaffold_10	AUGUSTUS	CDS	628926	629418	0.26	-	0	transcript_id "g511.t1"; gene_id "g511";
Scaffold_10	AUGUSTUS	start_codon	629416	629418	.	-	0	transcript_id "g511.t1"; gene_id "g511";
# protein sequence = [MNMDTMTTDTTDTTRTTDTTSTTDTTSTTDMTRTTDTNRTTDTNRTTDTTRTTDMTMTGTTNVTTTSHELMHLFDSAA
# TQNRTIHQALRRIQSHKVELQDRLTLLQNLSPDHDPAAIQEILHRAERAVVAILSELDKFRRPEVKSEVEATKTVARCLERLVETWQPCNEVLLEHDK
# PIKTFEFHSFLDWFGRFLAFPGIAQYGDAFCENLTDGGPPEKKRESSDGRFYYEARGPDGKLFVQERGREGRWFFKLHADFFNIEGNKVNGKHSSTGV
# ISMTCLNLPLEVREDSAFVYVAGVIQGPHKPNSKEAEHNHYIRPLVDELLIAYTQGIRCASASDQETPYGRIHRILLAFISLDFKAARPFAGLLDVGS
# HCFCFTCKTWHRAYLNSTNYKDWEAIDDDFLREGAEKWRDAQNKAERIAIEEQYGVRYSQFWRLPYWRPSKQVTTDPMHTGYQLLEKNFFRDGLRLNN
# PESKEDPKNKSTAPSSAYAHHYAFMPPPPLQFIGSNCVVQADVDDEDEIDENILITGLEWDHLSEDLRCLRNQRMRALGNDFRSSPRLLGQLSDIHTL
# LSDLRPSTTSELVQLRTRLGRMNWTTLLFVCEDLLAFKSPSIQRMEIIQKSQITKDDMIDALVDWVSLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g511
###
# start gene g512
Scaffold_10	AUGUSTUS	gene	648313	649388	0.63	+	.	g512
Scaffold_10	AUGUSTUS	transcript	648313	649388	0.63	+	.	g512.t1
Scaffold_10	AUGUSTUS	start_codon	648313	648315	.	+	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_10	AUGUSTUS	CDS	648313	648421	0.85	+	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_10	AUGUSTUS	CDS	648512	648546	0.87	+	2	transcript_id "g512.t1"; gene_id "g512";
Scaffold_10	AUGUSTUS	CDS	648604	648753	0.81	+	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_10	AUGUSTUS	CDS	648855	649388	0.69	+	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_10	AUGUSTUS	stop_codon	649386	649388	.	+	0	transcript_id "g512.t1"; gene_id "g512";
# protein sequence = [MEGLLLLKYQRKVNLPQKIPVAPSIKDREDPGSHRDHSDPDNAPHDFQRKKGKQRATTIESGSEESEESSSDDDSSDL
# EDELIESDVSHTAARYRRKGKLGRVILREALGVRRNYKAFIHPGVSEERLRAFNENPGANGPKIRNTTIDKNGATTKDLIESLWNQELLLALVKLAEK
# IVGESKDERFPSSIDWLGLLSERLYRIYLAVIKSKPRIKQGELESPRQIEQRILDAHLLRNQKNGETSFRHAVSVYRSQFQPAHSLNLRNGRPAVKSA
# L]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g512
###
# start gene g513
Scaffold_10	AUGUSTUS	gene	650745	652675	0.13	+	.	g513
Scaffold_10	AUGUSTUS	transcript	650745	652675	0.13	+	.	g513.t1
Scaffold_10	AUGUSTUS	start_codon	650745	650747	.	+	0	transcript_id "g513.t1"; gene_id "g513";
Scaffold_10	AUGUSTUS	CDS	650745	651073	0.48	+	0	transcript_id "g513.t1"; gene_id "g513";
Scaffold_10	AUGUSTUS	CDS	651127	651584	0.21	+	1	transcript_id "g513.t1"; gene_id "g513";
Scaffold_10	AUGUSTUS	CDS	651667	651945	0.92	+	2	transcript_id "g513.t1"; gene_id "g513";
Scaffold_10	AUGUSTUS	CDS	651996	652675	1	+	2	transcript_id "g513.t1"; gene_id "g513";
Scaffold_10	AUGUSTUS	stop_codon	652673	652675	.	+	0	transcript_id "g513.t1"; gene_id "g513";
# protein sequence = [MASSFAGPSSPRKLTGSTPGILDSTQRDRLLTFSRSTLSFASFNPRTATSSQLTPDARKLSLNEELYNPKRVVIETSP
# TGESFWRFVPKARIDEGVVDEGDWPRVIDICGMLYECSQDQWDIYKLDPLYECRVRAPPASSTIIRVSPKSPESPQSNGKRTSSKAGIPPLNPRKKLH
# TGSGNSSLDLGYDDDEVEEVEDMIVDQTMPPPPRARSASLRRKREEISQIRQQRRENISRRAEKLSNREDEFNFNFSTEDSPGRSQTTLLVDPLRAAD
# LEVEEDLFRTTFTYKQTAQRKRTRKTSPGAAKRELDIQRAKRERRRRDRQQAKVIGRRQQWHEQFMQEVYAEVPDLKSPSNDIPAQNIGDGEYDDDSG
# SEDENWNGGPSTDTSFDDDAARVAAIAESRRKLAELEADRPLWEEEARKRALRQRVEEESQRLKAEERKWADMKRAEVEARQAEMHRKAQETAERTEE
# QQDAKLREEAIKRQRERRQREQRWAYGHWTPIRALERYRVLSEAFDTTKFNVYDPLTFHVIPWPILNPPAKMSVEDVDWNAVELFFESVRPHMRSQIS
# SHLLKKVSAGSSG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g513
###
# start gene g514
Scaffold_10	AUGUSTUS	gene	655162	655530	0.56	+	.	g514
Scaffold_10	AUGUSTUS	transcript	655162	655530	0.56	+	.	g514.t1
Scaffold_10	AUGUSTUS	start_codon	655162	655164	.	+	0	transcript_id "g514.t1"; gene_id "g514";
Scaffold_10	AUGUSTUS	CDS	655162	655530	0.56	+	0	transcript_id "g514.t1"; gene_id "g514";
Scaffold_10	AUGUSTUS	stop_codon	655528	655530	.	+	0	transcript_id "g514.t1"; gene_id "g514";
# protein sequence = [MSIDGTTDSSKQEKSTKPGSWEDNWDTEGYPFVVLDDNRAACAICLLDFEEPTRLHPMGEEQSKVVESEPNGGPAEVE
# VISEEERESNELRLADVGEGAQPLRLLKCGHVFTFVLGSFSIHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g514
###
# start gene g515
Scaffold_10	AUGUSTUS	gene	656626	657546	0.27	+	.	g515
Scaffold_10	AUGUSTUS	transcript	656626	657546	0.27	+	.	g515.t1
Scaffold_10	AUGUSTUS	start_codon	656626	656628	.	+	0	transcript_id "g515.t1"; gene_id "g515";
Scaffold_10	AUGUSTUS	CDS	656626	657546	0.27	+	0	transcript_id "g515.t1"; gene_id "g515";
Scaffold_10	AUGUSTUS	stop_codon	657544	657546	.	+	0	transcript_id "g515.t1"; gene_id "g515";
# protein sequence = [MKTLLLSGCISSATGYIEDQDQWWLSGIFRDVWLISFPVNHIADIQLQTHLDENYCDATLAVEVNTFGSSIPLTIKLL
# NLSKSLVATKEESATAPSTSFAFSVSNPLKWTAETPHLYHLVVSTPQQTVAVRVGFRNIEIEHGVFMVNGRPIKFRGTNRHEHHPEFGRSVPHDFLRA
# DLLLMKKHNINAIRTSHYPNHPRLYHLADELGFWVIDEADLEAHGFADIEEAALGPDKDALKGKERQNYFYDLAAKWTTDNPAWKEAYVDRARQLVSR
# DKNHPCVILWSLGNEAFYGKNFQAMVSCSRTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g515
###
# start gene g516
Scaffold_10	AUGUSTUS	gene	657674	658773	0.18	+	.	g516
Scaffold_10	AUGUSTUS	transcript	657674	658773	0.18	+	.	g516.t1
Scaffold_10	AUGUSTUS	start_codon	657674	657676	.	+	0	transcript_id "g516.t1"; gene_id "g516";
Scaffold_10	AUGUSTUS	CDS	657674	658127	0.21	+	0	transcript_id "g516.t1"; gene_id "g516";
Scaffold_10	AUGUSTUS	CDS	658202	658773	0.82	+	2	transcript_id "g516.t1"; gene_id "g516";
Scaffold_10	AUGUSTUS	stop_codon	658771	658773	.	+	0	transcript_id "g516.t1"; gene_id "g516";
# protein sequence = [MYSSVATIITYAEDPASTKPLVLCEYIHAMGNGPGAIKEYIDAFYKYPLLMGGFVWEWANHGLLTTNKEGKRYYAYGG
# DFCDEPNDGNFVMDGVLFSDHTPTPGLAEYKKAIEPVQVIGGSEKQIEIINRYDFLTLDHLRCEWNIVGDGYVFKSNSLPAEGFLTVRFSLKTATSWA
# PAGHEVANGQILLKPHVPRSSSSYFSAMYKTVSSSLTYPVTEKDKMLSIKGKDSQWTFEMTSGHLVSWVKGGTNILYSPPVMDFYRALTDNDRPQDGM
# QWIAKRLHQTKDHLKSISWKTTSKGDTEVSVVSRIAPPVFEWSVDTTTTYTFSSAGVQIKIHGIPQE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g516
###
# start gene g517
Scaffold_10	AUGUSTUS	gene	671932	672476	0.54	-	.	g517
Scaffold_10	AUGUSTUS	transcript	671932	672476	0.54	-	.	g517.t1
Scaffold_10	AUGUSTUS	stop_codon	671932	671934	.	-	0	transcript_id "g517.t1"; gene_id "g517";
Scaffold_10	AUGUSTUS	CDS	671932	672197	0.74	-	2	transcript_id "g517.t1"; gene_id "g517";
Scaffold_10	AUGUSTUS	CDS	672248	672476	0.54	-	0	transcript_id "g517.t1"; gene_id "g517";
Scaffold_10	AUGUSTUS	start_codon	672474	672476	.	-	0	transcript_id "g517.t1"; gene_id "g517";
# protein sequence = [MFSSNKTRDRITSEDVENGEASRPLLGDHNVVFSVDDDSDEESLAGPSKTEHSVRFQEDVQVIGPPLRSTTASREAEY
# ELDSDEIDDEPEITSTPRGHMSPNMPLIVGLLDSSRRSFDSPLPLNDANGRVGDLDLEAIAAKRTAGGGLFDSIANMANSILGAGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g517
###
# start gene g518
Scaffold_10	AUGUSTUS	gene	676131	677255	0.57	+	.	g518
Scaffold_10	AUGUSTUS	transcript	676131	677255	0.57	+	.	g518.t1
Scaffold_10	AUGUSTUS	start_codon	676131	676133	.	+	0	transcript_id "g518.t1"; gene_id "g518";
Scaffold_10	AUGUSTUS	CDS	676131	676292	0.57	+	0	transcript_id "g518.t1"; gene_id "g518";
Scaffold_10	AUGUSTUS	CDS	676355	676647	0.89	+	0	transcript_id "g518.t1"; gene_id "g518";
Scaffold_10	AUGUSTUS	CDS	676703	677255	1	+	1	transcript_id "g518.t1"; gene_id "g518";
Scaffold_10	AUGUSTUS	stop_codon	677253	677255	.	+	0	transcript_id "g518.t1"; gene_id "g518";
# protein sequence = [MEDEKNLNFNIFFGISGVNPFGLRSDRACQQIASFMNLSWIASLEKFSHPWHFLTLTDLNDFITPSQACIKPVEQILS
# KTEGKQPGSASVCDSLNPFYPYRFNTLQPQNEIRIDHNGSYYEVNGATPIGGSTTPGKKLEQAQISLNDCLACSGCITSAESVLITLQSHNEVLSFLS
# SNATADVPSRKVPVISIAPQSLASLAASVSSPSSAPITPRQMLHRLRAFCKEVLGFDHVFDTTFARHVALREHVKEFIERQEEYRLKDQAVKSEGGTA
# LPMLASACPGWICYAEKAHPEMLPFIARTQSPQQVMGTLVKHWMGEKWGKQSVVCLFCDIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g518
###
# start gene g519
Scaffold_10	AUGUSTUS	gene	677305	678318	1	+	.	g519
Scaffold_10	AUGUSTUS	transcript	677305	678318	1	+	.	g519.t1
Scaffold_10	AUGUSTUS	start_codon	677305	677307	.	+	0	transcript_id "g519.t1"; gene_id "g519";
Scaffold_10	AUGUSTUS	CDS	677305	678318	1	+	0	transcript_id "g519.t1"; gene_id "g519";
Scaffold_10	AUGUSTUS	stop_codon	678316	678318	.	+	0	transcript_id "g519.t1"; gene_id "g519";
# protein sequence = [MPCYDKKLEASRADFYNEAYSTRDVDCVITTGEMQLLAQEKGWDLSSPVPEEDTLQPSLTTSSKLLSDVSLPELMVHS
# GSSSGGYLQSIIEHIQSTSPTPLSLSVKQIRNADYEEFVLRREAEPAAEGKIVFKGAKCYGFRNLQNVVRKVGKETGVRVAMGAAGKLKGQAAVMKRG
# RRGQEMISEKGYDYIEVMACPGGCVNGGGQAKPPTNFGAVEDAEGYSRKWEESGVLLEDNSGPLAAKWGNKEWTKRVENVYWHDLPTPPASPTSENHH
# MTNSGEKEDAGYDSEIRNEIVMMADRLLIDVTDELYRSGSQHNLFRTNYRAVESEVVGLAVKW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g519
###
# start gene g520
Scaffold_10	AUGUSTUS	gene	682899	683143	0.71	+	.	g520
Scaffold_10	AUGUSTUS	transcript	682899	683143	0.71	+	.	g520.t1
Scaffold_10	AUGUSTUS	start_codon	682899	682901	.	+	0	transcript_id "g520.t1"; gene_id "g520";
Scaffold_10	AUGUSTUS	CDS	682899	682911	0.71	+	0	transcript_id "g520.t1"; gene_id "g520";
Scaffold_10	AUGUSTUS	CDS	682998	683143	0.72	+	2	transcript_id "g520.t1"; gene_id "g520";
Scaffold_10	AUGUSTUS	stop_codon	683141	683143	.	+	0	transcript_id "g520.t1"; gene_id "g520";
# protein sequence = [MGTAYNEPLSNGSAMITTYGSTEQELNECRVDSGKTVLWFSNDNSTVPKNNA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g520
###
# start gene g521
Scaffold_10	AUGUSTUS	gene	685894	686214	0.8	+	.	g521
Scaffold_10	AUGUSTUS	transcript	685894	686214	0.8	+	.	g521.t1
Scaffold_10	AUGUSTUS	start_codon	685894	685896	.	+	0	transcript_id "g521.t1"; gene_id "g521";
Scaffold_10	AUGUSTUS	CDS	685894	686214	0.8	+	0	transcript_id "g521.t1"; gene_id "g521";
Scaffold_10	AUGUSTUS	stop_codon	686212	686214	.	+	0	transcript_id "g521.t1"; gene_id "g521";
# protein sequence = [MFIENIARYFPTPDEADSVFALFDRDGNGDASMEEIEIACMDFHREQLSIEHSMQDLDSAVGRLDNIFMSLYVVVAVL
# IIAVVLVDSFHSNPNELLINANVIGRSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g521
###
# start gene g522
Scaffold_10	AUGUSTUS	gene	686966	687440	0.97	+	.	g522
Scaffold_10	AUGUSTUS	transcript	686966	687440	0.97	+	.	g522.t1
Scaffold_10	AUGUSTUS	start_codon	686966	686968	.	+	0	transcript_id "g522.t1"; gene_id "g522";
Scaffold_10	AUGUSTUS	CDS	686966	687140	0.97	+	0	transcript_id "g522.t1"; gene_id "g522";
Scaffold_10	AUGUSTUS	CDS	687238	687440	0.98	+	2	transcript_id "g522.t1"; gene_id "g522";
Scaffold_10	AUGUSTUS	stop_codon	687438	687440	.	+	0	transcript_id "g522.t1"; gene_id "g522";
# protein sequence = [MSAKRRNKWICALKQALADVGIFGPAGNPDATTKPKQYTEVPWEEVKHAEQNKTSRPMRNVTGDDSDNVFDDDADEQV
# MRSSWRSPTADSDYASLSTPRMPHAAPMPSQSQLAYAPEAIELSERR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g522
###
# start gene g523
Scaffold_10	AUGUSTUS	gene	687624	688591	0.44	-	.	g523
Scaffold_10	AUGUSTUS	transcript	687624	688591	0.44	-	.	g523.t1
Scaffold_10	AUGUSTUS	stop_codon	687624	687626	.	-	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_10	AUGUSTUS	CDS	687624	687983	0.95	-	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_10	AUGUSTUS	CDS	688038	688181	0.56	-	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_10	AUGUSTUS	CDS	688267	688424	0.84	-	2	transcript_id "g523.t1"; gene_id "g523";
Scaffold_10	AUGUSTUS	CDS	688510	688591	0.77	-	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_10	AUGUSTUS	start_codon	688589	688591	.	-	0	transcript_id "g523.t1"; gene_id "g523";
# protein sequence = [MEITSDQLEIQPHPNEGTEEAGEERVRHDPDADPILICKIRKGQELKLRCIAKKVRGHYQSLASQTELFCAGNRKGTR
# KMAEWPLGENAREEEPPREDEPFDFNAKPNKFYFDVETDGSLGAQEVVMKGIAELQKKLASLVLALRRVRNGENEMDMPSGGDQTFVDQPAGGSGGER
# GWGSGAGSGWGNPSSSASGAGGGASWGGGASPSRGGGNAAWGSSPGNANAWSSPSNAGWGSPSAQANGWNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g523
###
# start gene g524
Scaffold_10	AUGUSTUS	gene	700851	701552	0.45	+	.	g524
Scaffold_10	AUGUSTUS	transcript	700851	701552	0.45	+	.	g524.t1
Scaffold_10	AUGUSTUS	start_codon	700851	700853	.	+	0	transcript_id "g524.t1"; gene_id "g524";
Scaffold_10	AUGUSTUS	CDS	700851	701058	0.58	+	0	transcript_id "g524.t1"; gene_id "g524";
Scaffold_10	AUGUSTUS	CDS	701119	701552	0.65	+	2	transcript_id "g524.t1"; gene_id "g524";
Scaffold_10	AUGUSTUS	stop_codon	701550	701552	.	+	0	transcript_id "g524.t1"; gene_id "g524";
# protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS
# KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE
# DEDEDTAPPPKRLKTTSSISGKIFILHFSHFINSIRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g524
###
# start gene g525
Scaffold_10	AUGUSTUS	gene	702150	702865	0.53	+	.	g525
Scaffold_10	AUGUSTUS	transcript	702150	702865	0.53	+	.	g525.t1
Scaffold_10	AUGUSTUS	start_codon	702150	702152	.	+	0	transcript_id "g525.t1"; gene_id "g525";
Scaffold_10	AUGUSTUS	CDS	702150	702198	0.53	+	0	transcript_id "g525.t1"; gene_id "g525";
Scaffold_10	AUGUSTUS	CDS	702261	702865	0.92	+	2	transcript_id "g525.t1"; gene_id "g525";
Scaffold_10	AUGUSTUS	stop_codon	702863	702865	.	+	0	transcript_id "g525.t1"; gene_id "g525";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTSSPVGGSVPMELDLP
# TIESLAERALSPEKGAESAQTSNRGWSLGVVLLFILFHLIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g525
###
# start gene g526
Scaffold_10	AUGUSTUS	gene	703819	704456	0.65	+	.	g526
Scaffold_10	AUGUSTUS	transcript	703819	704456	0.65	+	.	g526.t1
Scaffold_10	AUGUSTUS	start_codon	703819	703821	.	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_10	AUGUSTUS	CDS	703819	703986	0.95	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_10	AUGUSTUS	CDS	704045	704080	0.7	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_10	AUGUSTUS	CDS	704250	704456	0.91	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_10	AUGUSTUS	stop_codon	704454	704456	.	+	0	transcript_id "g526.t1"; gene_id "g526";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRSHVRQSFQNTFVRKP
# PHRARSVHSDHEASTRADNSRFIRKSKKKATRFASSRDVKREPRSVRFDSDVEVNSQI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g526
###
# start gene g527
Scaffold_10	AUGUSTUS	gene	705801	707735	0.28	-	.	g527
Scaffold_10	AUGUSTUS	transcript	705801	707735	0.28	-	.	g527.t1
Scaffold_10	AUGUSTUS	stop_codon	705801	705803	.	-	0	transcript_id "g527.t1"; gene_id "g527";
Scaffold_10	AUGUSTUS	CDS	705801	706053	0.78	-	1	transcript_id "g527.t1"; gene_id "g527";
Scaffold_10	AUGUSTUS	CDS	706651	707735	0.36	-	0	transcript_id "g527.t1"; gene_id "g527";
Scaffold_10	AUGUSTUS	start_codon	707733	707735	.	-	0	transcript_id "g527.t1"; gene_id "g527";
# protein sequence = [MVIEKYRGKLESVAGRVAQDKAEHTEYQSNKKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRL
# TVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDF
# KDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPS
# DESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEXILTRDELIGY
# RAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRILELKRVWIERCIQDIEDLWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g527
###
# start gene g528
Scaffold_10	AUGUSTUS	gene	707916	709241	0.8	+	.	g528
Scaffold_10	AUGUSTUS	transcript	707916	709241	0.8	+	.	g528.t1
Scaffold_10	AUGUSTUS	start_codon	707916	707918	.	+	0	transcript_id "g528.t1"; gene_id "g528";
Scaffold_10	AUGUSTUS	CDS	707916	709241	0.8	+	0	transcript_id "g528.t1"; gene_id "g528";
Scaffold_10	AUGUSTUS	stop_codon	709239	709241	.	+	0	transcript_id "g528.t1"; gene_id "g528";
# protein sequence = [MSSTVNSLSIPRFPESSQLSGENTWRIFKDQVLAHIEVRELEGYLDGTIIRPPIGGYISTSTLYPPATTSTPVYSPTP
# FPHEWRQRDRMAASIIYLNIVDPVGLGVEREKPAYHIWAELKKKYERRDEMRVHQADTKLRAARFDPSNTTIEEHEKTMKNHLKELRNLGGSCLDSQF
# RLIVIASMPKSWRDLLINVKGISSDDAFIHLCQVYDNKKEDEEDIRQHSQVHALIAQEMASFHSANAAFAPKKDRPMCTNPNCPPRRRRTHPIEKCWA
# PGGGDEGGPKKAETSVNYASDGGNHTVMELFDLCTSPSAPISSIQLPNAHTCRNCVSVSTGYGANKEVIRSVEILDSSISYSLSTFDEYTACSASNEK
# TLLYAASKPRIPQTFLDSAAVTISGSEELISLSMRTYMERQGSQRLPGKQENLRYMAKAPWNSRQLWME]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g528
###
# start gene g529
Scaffold_10	AUGUSTUS	gene	710226	711194	0.92	+	.	g529
Scaffold_10	AUGUSTUS	transcript	710226	711194	0.92	+	.	g529.t1
Scaffold_10	AUGUSTUS	start_codon	710226	710228	.	+	0	transcript_id "g529.t1"; gene_id "g529";
Scaffold_10	AUGUSTUS	CDS	710226	711194	0.92	+	0	transcript_id "g529.t1"; gene_id "g529";
Scaffold_10	AUGUSTUS	stop_codon	711192	711194	.	+	0	transcript_id "g529.t1"; gene_id "g529";
# protein sequence = [MENLELGLSKDVLLGISAEGAIEFGCHRLKRSMNLVVSNLRKVTLEDLPPRYQMKLMERCLLMSTSVRLQTVPDSPAN
# KNQIDIPNASIPSTPTTPSTPSYDGIPELFAAQPSFQPLALPIQEPEAGPRRGTRIREPSARQLQSEESTQRERSAFERNLAWAHDSGGIDELDENSN
# PLAMVANSPFAFGAESSDKWVPNTYKQAIRRPELWKAPMQAEYDTLMDKNCWTLVDLPPNANLTGGRWVYAIKWSKDGEVAKRKARYVAQGFTQIEGV
# DYDKTYGAVARMEPFASSSRSLQSSDFSCSRLTSSCIPKLSYPTRCIY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g529
###
# start gene g530
Scaffold_10	AUGUSTUS	gene	714182	714418	0.64	-	.	g530
Scaffold_10	AUGUSTUS	transcript	714182	714418	0.64	-	.	g530.t1
Scaffold_10	AUGUSTUS	stop_codon	714182	714184	.	-	0	transcript_id "g530.t1"; gene_id "g530";
Scaffold_10	AUGUSTUS	CDS	714182	714418	0.64	-	0	transcript_id "g530.t1"; gene_id "g530";
Scaffold_10	AUGUSTUS	start_codon	714416	714418	.	-	0	transcript_id "g530.t1"; gene_id "g530";
# protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMNELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g530
###
# start gene g531
Scaffold_10	AUGUSTUS	gene	715531	717842	0.26	-	.	g531
Scaffold_10	AUGUSTUS	transcript	715531	717842	0.26	-	.	g531.t1
Scaffold_10	AUGUSTUS	stop_codon	715531	715533	.	-	0	transcript_id "g531.t1"; gene_id "g531";
Scaffold_10	AUGUSTUS	CDS	715531	716315	0.31	-	2	transcript_id "g531.t1"; gene_id "g531";
Scaffold_10	AUGUSTUS	CDS	716390	717842	0.26	-	0	transcript_id "g531.t1"; gene_id "g531";
Scaffold_10	AUGUSTUS	start_codon	717840	717842	.	-	0	transcript_id "g531.t1"; gene_id "g531";
# protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK
# KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD
# LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESF
# LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTL
# GLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKS
# TGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFL
# QNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRPPINLIDETNKQVVNEAIGVEKPINLNTEAGVYEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g531
###
# start gene g532
Scaffold_10	AUGUSTUS	gene	721938	723623	0.87	-	.	g532
Scaffold_10	AUGUSTUS	transcript	721938	723623	0.87	-	.	g532.t1
Scaffold_10	AUGUSTUS	stop_codon	721938	721940	.	-	0	transcript_id "g532.t1"; gene_id "g532";
Scaffold_10	AUGUSTUS	CDS	721938	723623	0.87	-	0	transcript_id "g532.t1"; gene_id "g532";
Scaffold_10	AUGUSTUS	start_codon	723621	723623	.	-	0	transcript_id "g532.t1"; gene_id "g532";
# protein sequence = [MANIAVWFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNIMFRNTSHFDSPQTSVPSAINPVVAKVAV
# PLPEPSPSVSPTILETPPGDSPRSRSRSRSRTLWAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAA
# RAADHSSTAPTVPPLHPSIPEDYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGHIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLF
# VPKKDGKLRLCVDFRGLNRITKKDCYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDI
# FSDMLDVCVTVYLDDILIYSDTPEEHREHVKEVLRRLWKHRLYANPEKCEFNMDTVEYLGYISPDGLTMFKEKVQTVLEWPVPRKVKDIQSFLGFANF
# YRRFIYNYSDIVVPMTWLTQKGAPWIWDSSCQEAFENLKIAFTSAPILAHWEPNCPLIVETDASDDTPKFWLDVYTVNCDIFTYRFVSRGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g532
###
# start gene g533
Scaffold_10	AUGUSTUS	gene	723956	725008	0.75	-	.	g533
Scaffold_10	AUGUSTUS	transcript	723956	725008	0.75	-	.	g533.t1
Scaffold_10	AUGUSTUS	stop_codon	723956	723958	.	-	0	transcript_id "g533.t1"; gene_id "g533";
Scaffold_10	AUGUSTUS	CDS	723956	725008	0.75	-	0	transcript_id "g533.t1"; gene_id "g533";
Scaffold_10	AUGUSTUS	start_codon	725006	725008	.	-	0	transcript_id "g533.t1"; gene_id "g533";
# protein sequence = [MLELLSGFKGSIETLGTILAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQWKVNYTLS
# YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYNAQGEAEDSLGNLKMKETENIRKYNIQFNTLAASTNWDSAALKWAYGRGLAECIK
# DEMARLPKPVTLADYCQEVLRIDNHYWKREETRKREAGKPFIARNPKKGSSDFKTGSTNQQHNSQPSGSSAPFMPKSKPFSGGKPNNNGKPQNSSNSG
# QPGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEVTIEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g533
###
# start gene g534
Scaffold_10	AUGUSTUS	gene	728069	729606	0.37	-	.	g534
Scaffold_10	AUGUSTUS	transcript	728069	729606	0.37	-	.	g534.t1
Scaffold_10	AUGUSTUS	stop_codon	728069	728071	.	-	0	transcript_id "g534.t1"; gene_id "g534";
Scaffold_10	AUGUSTUS	CDS	728069	729540	0.94	-	2	transcript_id "g534.t1"; gene_id "g534";
Scaffold_10	AUGUSTUS	CDS	729600	729606	0.37	-	0	transcript_id "g534.t1"; gene_id "g534";
Scaffold_10	AUGUSTUS	start_codon	729604	729606	.	-	0	transcript_id "g534.t1"; gene_id "g534";
# protein sequence = [MRPRTYDIVIPPDDANILTSKWVFRTKRDEQGKVTGHRARLVVRGFNQIPDVDYFPDETFASVTKLAAARAILSTGAE
# QNMFIHQMDVKSAYLYGKLDDNEQIYMKAPPGVDIEVKAGQVLKLKLALYGLKQAGRRWYMRFREIMTSVGLTRSNFDHAVFYRTDPFCIIFIHVDDM
# TMLTKTMAVMDTLKKKIRDQIEVVDSGEIHWLLGIEIRRSLHTRSIHLSQRAYIDAILSRYGFADVKPLSIPFDPHIHLTKDQMPTTVEDITYMRDKP
# YREAVGALQYLSVATRPDITYAVGILAKFLQNPGITHWNAVKRVYAYLKYTRDLWLTFGGTQAEIEGYTDADGMSQEDRHAISGYVFMLNGGAVSWSS
# KRQDTISLSTTEAEYIALTHAAKEAIWFRNLLSELFGPITKPIILNADNQSAIALAKDDRFHARTKHIDIRYHFIRYVIEEGKIRLVYCPTEDMTADI
# FTKALPSLKAKHFAASMGLTKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g534
###
# start gene g535
Scaffold_10	AUGUSTUS	gene	729779	730218	0.12	-	.	g535
Scaffold_10	AUGUSTUS	transcript	729779	730218	0.12	-	.	g535.t1
Scaffold_10	AUGUSTUS	stop_codon	729779	729781	.	-	0	transcript_id "g535.t1"; gene_id "g535";
Scaffold_10	AUGUSTUS	CDS	729779	730130	0.13	-	1	transcript_id "g535.t1"; gene_id "g535";
Scaffold_10	AUGUSTUS	CDS	730214	730218	0.37	-	0	transcript_id "g535.t1"; gene_id "g535";
Scaffold_10	AUGUSTUS	start_codon	730216	730218	.	-	0	transcript_id "g535.t1"; gene_id "g535";
# protein sequence = [METPKKANGMISPWEKRFGTIPDISNFHIFGSTVYVKREKEPGKLDPQAQEGRWVGIEPESNGYFIYWPDRHTVSTER
# NVQFSDRQIQPVEGEDQDLGNLETSITESEQPIIPVPEEI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g535
###
# start gene g536
Scaffold_10	AUGUSTUS	gene	730372	731868	0.51	-	.	g536
Scaffold_10	AUGUSTUS	transcript	730372	731868	0.51	-	.	g536.t1
Scaffold_10	AUGUSTUS	stop_codon	730372	730374	.	-	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_10	AUGUSTUS	CDS	730372	731868	0.51	-	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_10	AUGUSTUS	start_codon	731866	731868	.	-	0	transcript_id "g536.t1"; gene_id "g536";
# protein sequence = [MHCHEPSKVNEHLDKLLEIRDSLEARKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSTIRAEA
# SGHTRGQSGKKESANYAGGNSNRGRGGFNRNRGNFRGQSRGRGNGNRGGGQSRPNSNNSTCYNCGGKGHFANKCSSPKRQQANEAQESSQKKEKNQPS
# GSGSNNWRSKNKEVGSSATIEEVPESSWAAVEVTTTTSQEIFNFSEIASNYETAFVASHSSGAILFDSGCSSHMTPLQDKLRNTRSVPTRIIQAANAE
# TFTSNTAGNLQIDLPINEDGISKSLTLQNTLLCPNTPNTLVSLGKLDDAGYVMVIKDGTLKIINRQGETIGIVPKTNGLYQIPSAEYAYAGKATRMVS
# LYEAHCIAGHQNYAYVKHMFKSNQVHGIKLDPKQMEEPECRTCMLAKAARSPISKIRTSPRAEKFGDVFHMDVWGPASVQTLNHYVYALTVIDEATSW
# LEEPLMKGKDEAFAQYVILQTGLQINMA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g536
###
# start gene g537
Scaffold_10	AUGUSTUS	gene	732055	732692	0.66	-	.	g537
Scaffold_10	AUGUSTUS	transcript	732055	732692	0.66	-	.	g537.t1
Scaffold_10	AUGUSTUS	stop_codon	732055	732057	.	-	0	transcript_id "g537.t1"; gene_id "g537";
Scaffold_10	AUGUSTUS	CDS	732055	732481	0.7	-	1	transcript_id "g537.t1"; gene_id "g537";
Scaffold_10	AUGUSTUS	CDS	732583	732692	0.85	-	0	transcript_id "g537.t1"; gene_id "g537";
Scaffold_10	AUGUSTUS	start_codon	732690	732692	.	-	0	transcript_id "g537.t1"; gene_id "g537";
# protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDVKDRLIDRKQEDLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPE
# YPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDNMSKVFKAFDKVSTLKSDGSNWDTWKNRVELATRSIGFSITSHLIQK
# IH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g537
###
# start gene g538
Scaffold_10	AUGUSTUS	gene	738094	739243	1	-	.	g538
Scaffold_10	AUGUSTUS	transcript	738094	739243	1	-	.	g538.t1
Scaffold_10	AUGUSTUS	stop_codon	738094	738096	.	-	0	transcript_id "g538.t1"; gene_id "g538";
Scaffold_10	AUGUSTUS	CDS	738094	739048	1	-	1	transcript_id "g538.t1"; gene_id "g538";
Scaffold_10	AUGUSTUS	CDS	739107	739243	1	-	0	transcript_id "g538.t1"; gene_id "g538";
Scaffold_10	AUGUSTUS	start_codon	739241	739243	.	-	0	transcript_id "g538.t1"; gene_id "g538";
# protein sequence = [MIFGINDCTTLSHISVQIQTVTRVVKAWDDRNVNVHELTEDIVSCMFHPDFPNHSSKIQGEMMHYMQTWVQQLGSKQH
# ATLSRLSKNAVRNHENTRLAGAGGTPAAQGTYGYNQGIQAQHNLQGYASQIPGVAQAQSLLGKLDSGNRRDVSGTSLGGSSYPGAPVPPHQYNSAPPP
# LLSGESASYYGAEYPPPLSGSRIHHATPPGPPGGSASHYGADRPSMPGSGAHYAPPPGPPGGSASGYAPSYSSPSSFPDSPSPFPDVPPSFPGDTPHF
# PGADGHGGHHGHPHHYAPPPGPPPGAFGPPGGPPGVSFPQSSPYGTPGGGPSFPGADPYPQQGASFPNAAPHFPPPSEGYNPYGGNQGW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g538
###
# start gene g539
Scaffold_10	AUGUSTUS	gene	743841	744353	0.59	-	.	g539
Scaffold_10	AUGUSTUS	transcript	743841	744353	0.59	-	.	g539.t1
Scaffold_10	AUGUSTUS	stop_codon	743841	743843	.	-	0	transcript_id "g539.t1"; gene_id "g539";
Scaffold_10	AUGUSTUS	CDS	743841	744353	0.59	-	0	transcript_id "g539.t1"; gene_id "g539";
Scaffold_10	AUGUSTUS	start_codon	744351	744353	.	-	0	transcript_id "g539.t1"; gene_id "g539";
# protein sequence = [MFYTLLAKNSTLMIFFELQFNEQELELLISGTPDIDVDEWRAATEYNGYTSSDPNIVWWWRALKSFNRDERAKVLSFA
# TGTSRVPLNGFVDLQGVQGVQKFSIHRAYGESDRLPQAHTCRFFSVFQKLARLNLHLLGFNQIDLPQYSSYEMLRQQVLFAISEGGEGFGFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g539
###
# start gene g540
Scaffold_10	AUGUSTUS	gene	745988	748242	0.8	-	.	g540
Scaffold_10	AUGUSTUS	transcript	745988	748242	0.8	-	.	g540.t1
Scaffold_10	AUGUSTUS	stop_codon	745988	745990	.	-	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_10	AUGUSTUS	CDS	745988	746895	0.9	-	2	transcript_id "g540.t1"; gene_id "g540";
Scaffold_10	AUGUSTUS	CDS	746988	748242	0.8	-	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_10	AUGUSTUS	start_codon	748240	748242	.	-	0	transcript_id "g540.t1"; gene_id "g540";
# protein sequence = [MFGRARSGGSAPPEATTHPLLLDASSQAARPTSSTFRGARNPQRIMAGGTTELLQTIEELVGGGAVQLFHHIMTRGRG
# GGGAAGGVPETIRLDVPAGAIMDLGRHYHLPHRRPPVISASVRMERNTRTPPTSSQARTLDPLLTLQRWAEEVKVLHGDLVADRASKLANHLVNTMLP
# NAIEVAQKATEEEAARERDAEAKAQQEKEEEERKEAEDKAQTQISVESSDQPIQSQSSKIEGPSDVHDTSPEDHPMEDATSSVGVSVAAVPEMADTEM
# VDGTAVTGLQPLEPDESNDDNVTSLPSENEASASGQVNTTNRVTVMIHDNEVDITDTGIDPTFLEALPDEMREEVLNQHVRDQRAARIERPADSQISV
# EFLDALPPEIRAEIIQQEAMERARHSAEVAQSASGVPRVPAEIDPATEAGHYRTAQSRRLHVSSRGVRETSGAPAIVRKFAPQHDAIQLLDKAGVAAL
# IRLLFFPQVLKKTLIFKVLVNLCENAKTRTELFNLLLSILQDGTGDLAAVDKSFAQMSVRNSKTPKAIGKQKSTSDLITTLVLPGGHTEAVPDLIAQR
# CLEALTYIVTANSSSSLFFLTEHELPAGLRRASSKKGKGKEKQIPQTHYPIVLLLGLLDRQSLLRTPSIMESVVGLLATVTRPIKEAKLQAQLQPSTS
# KSVTNDAESSNNQTTNGTGDNSVPAVETTPAPPSSLPHDGIASEFFKPFLPLHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g540
###
# start gene g541
Scaffold_10	AUGUSTUS	gene	748588	750843	0.06	-	.	g541
Scaffold_10	AUGUSTUS	transcript	748588	750843	0.06	-	.	g541.t1
Scaffold_10	AUGUSTUS	stop_codon	748588	748590	.	-	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_10	AUGUSTUS	CDS	748588	748659	0.76	-	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_10	AUGUSTUS	CDS	748706	749020	0.68	-	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_10	AUGUSTUS	CDS	749081	749253	0.51	-	2	transcript_id "g541.t1"; gene_id "g541";
Scaffold_10	AUGUSTUS	CDS	749353	749711	0.26	-	1	transcript_id "g541.t1"; gene_id "g541";
Scaffold_10	AUGUSTUS	CDS	749889	750340	0.39	-	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_10	AUGUSTUS	CDS	750397	750843	0.48	-	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_10	AUGUSTUS	start_codon	750841	750843	.	-	0	transcript_id "g541.t1"; gene_id "g541";
# protein sequence = [MDSLLALLLSNPVSMDPEHPIIPRWLAAHLLVTEALLTLSEEPRDIGTPKEGEPIPSEPLSTGPALTDARAMVFDFCL
# KLLAMPDLPSDELLSSLRLLVLLTRDHEYALQFVKKDGLGMLFSRLHTSPVTGSSSYIAIILRHIIEDHKTSPGRLLLSENCSAMALRDPNTFIEVTQ
# KLCHLGSPYATSYTLSLNKNSDVPPKNEELKNTVDMQVDPSTADSSESVDEVMYFLAAELMKAAKALNSDTPSTTSSAPSSVVEPHTAPDAAHVPGLK
# DSADSSTDKAQHLYMCFLMQCMTELFKMSVSTWAMSLLVALCVDTSSGQEGRDISNDLVAVRKFVLESISRAIKDASPAESTELQYGRLFALSDLCHR
# LLTVRFSPSTRKHEDGPTQISKVMLEKNFVATLTNTLSDIDLNYPNVLAIKMSRAPGKARESSSPKAGSISPLSSDEEDEEEENQDAREETPDLYRNS
# ALGMYGGEMEDMTYHGEDEDMDDEEDMGEHDEEMDFDEETGSEDTSNTDEEEEADEDLDDAEEEGWEDEEDDEEDLVPDEVDEGHEDEEGIVNPHEPV
# DEEEIEEAEEMMWQDIQDDVDAEELREEDEDEDSGGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/6
# CDS introns: 0/5
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g541
###
# start gene g542
Scaffold_10	AUGUSTUS	gene	750900	752033	0.61	-	.	g542
Scaffold_10	AUGUSTUS	transcript	750900	752033	0.61	-	.	g542.t1
Scaffold_10	AUGUSTUS	stop_codon	750900	750902	.	-	0	transcript_id "g542.t1"; gene_id "g542";
Scaffold_10	AUGUSTUS	CDS	750900	752033	0.61	-	0	transcript_id "g542.t1"; gene_id "g542";
Scaffold_10	AUGUSTUS	start_codon	752031	752033	.	-	0	transcript_id "g542.t1"; gene_id "g542";
# protein sequence = [MLGLVTVLLIDGMISSIYFGSADLCFLERTTNHTIYTVQLLAFYRVGGVDAVLNVSRSFISSIRSIVPIREEDRSPAQ
# TQELLHAFSGLKIVLHLLHPLVSSKPLFESGQTNIVVTKDKKDTDDDYFEPHNFLVRLRLAVLPLLKDIWESSWLIKAPLGVCRSVVQTVLEVLNSSD
# ESKASIETGPSSSTFFRSNVLDESRIRQLTDMGFPRAAAEHALRRTHNNVPAATEILLSNPFLPFAAEPEPEPATTASGSAEVVTDESSVNEDGAGSG
# PTTMPAEPVDDSPSPEPTIGKTVEEWRKDLEAAREPLRAGISRKALSLVDEHISLLFDIHAAFVRPGDAHQPEAIRNIVDDIKGFHHTLTMFKSNLWR
# IAADY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g542
###
# start gene g543
Scaffold_10	AUGUSTUS	gene	754074	755826	0.1	-	.	g543
Scaffold_10	AUGUSTUS	transcript	754074	755826	0.1	-	.	g543.t1
Scaffold_10	AUGUSTUS	stop_codon	754074	754076	.	-	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_10	AUGUSTUS	CDS	754074	755326	0.38	-	2	transcript_id "g543.t1"; gene_id "g543";
Scaffold_10	AUGUSTUS	CDS	755428	755728	0.36	-	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_10	AUGUSTUS	CDS	755797	755826	0.33	-	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_10	AUGUSTUS	start_codon	755824	755826	.	-	0	transcript_id "g543.t1"; gene_id "g543";
# protein sequence = [MKILHKSKRTPPQVADLITRLINTPDDALAQTLEEIDAWKWQRSDLNAWIKVLNKFDTVLEDVIREYDIDKLQVREFS
# TESKKMVSEILKFERLLLENSTNRKMFNSYDVPLKLLLRPSQQYSAQPAVSQALNISTPRLLSLAKRWPHLREYGIDLVDLANAQGSLEIDALPSEAR
# EVDFSFYRKDAGSSQIKPEADPNDLSSSRKLSSTTPIAAGAVAVHLDEQTLRSKTAMDVLADAIRTHEIPDSEKFDLLCRIRAATTLAKGREAEREKL
# VHVRLLSIAIFGHTHPESQALSTLFLFEPDLIPHVAELLQVGRGISVHIQTAAIAALDAMARYRSKVHEVLTSVNAGVNHGILMGLLRKTISDISSSD
# CKIPHSFVEALLSFVTFIASHASGGNMIVGAGLIPLLIQILENRLPTRLQVVSKTMQLIDNVLYSFTNAFTVFCSSHGVEALVDRIEVDSLFTFYVIF
# TENNLSQFEVDLDIREHGDQQKSRQIFGSHGAFCEIIAYFRAQSVLQGSCLLYELLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g543
###
# start gene g544
Scaffold_10	AUGUSTUS	gene	763661	764203	1	-	.	g544
Scaffold_10	AUGUSTUS	transcript	763661	764203	1	-	.	g544.t1
Scaffold_10	AUGUSTUS	stop_codon	763661	763663	.	-	0	transcript_id "g544.t1"; gene_id "g544";
Scaffold_10	AUGUSTUS	CDS	763661	764203	1	-	0	transcript_id "g544.t1"; gene_id "g544";
Scaffold_10	AUGUSTUS	start_codon	764201	764203	.	-	0	transcript_id "g544.t1"; gene_id "g544";
# protein sequence = [MSTDHPDSNSSSVVDAPASLDSLFSPKQATFGEAEARARESIAESELSDISLDDEKMEDLDVSDSTVDQTDSTTPAEL
# FLPTKPFELDLNETHSGSTSSHKKSASLATLHSGRHISLLVNHDEQAPGSRVSLDGQHKLQEEFARLQKEKDSENLKGPPTPGFSAGIDWGELPPPGS
# TVYN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g544
###
# start gene g545
Scaffold_10	AUGUSTUS	gene	769002	769519	0.97	+	.	g545
Scaffold_10	AUGUSTUS	transcript	769002	769519	0.97	+	.	g545.t1
Scaffold_10	AUGUSTUS	start_codon	769002	769004	.	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_10	AUGUSTUS	CDS	769002	769121	0.97	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_10	AUGUSTUS	CDS	769175	769519	0.98	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_10	AUGUSTUS	stop_codon	769517	769519	.	+	0	transcript_id "g545.t1"; gene_id "g545";
# protein sequence = [MQGSSSTIRGGSLMQIDVSGLLATSHPSPKQPLQQEPRIHTEPNSRERKIRILTALDMEPKDRQRIHALEDLVAAKNT
# EIESAALEIKSRDTIITALERKVSSMRTTIEEAQEHLATQEVLNQGAWAKANDLDKTRKQARIFNPHILRITHTMP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g545
###
# start gene g546
Scaffold_10	AUGUSTUS	gene	783263	784063	0.77	+	.	g546
Scaffold_10	AUGUSTUS	transcript	783263	784063	0.77	+	.	g546.t1
Scaffold_10	AUGUSTUS	start_codon	783263	783265	.	+	0	transcript_id "g546.t1"; gene_id "g546";
Scaffold_10	AUGUSTUS	CDS	783263	783546	0.99	+	0	transcript_id "g546.t1"; gene_id "g546";
Scaffold_10	AUGUSTUS	CDS	783622	784063	0.77	+	1	transcript_id "g546.t1"; gene_id "g546";
Scaffold_10	AUGUSTUS	stop_codon	784061	784063	.	+	0	transcript_id "g546.t1"; gene_id "g546";
# protein sequence = [MSKYRELLAGLKDVDEPLPSKLRHTPVSSSDTRARESARKYQNLTPTDDLEYGMRVMAVGVSSNTSQGRLGQPLSLDS
# TFTKFQAEVARESVGTCSFAEEDSLESLLAPDSRGRLQFGDPKKNSKRTTRALFAISNLVEAARRLETKIQSISTSHTPEEIQATLCAVEDGSETLNL
# QIASITRTAVSEEVKEAREILESLNQMVCAWRLEYPDSSPVKINNRMCLVPSNLPSVDCPHSTQF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g546
###
# start gene g547
Scaffold_10	AUGUSTUS	gene	784328	785926	0.37	+	.	g547
Scaffold_10	AUGUSTUS	transcript	784328	785926	0.37	+	.	g547.t1
Scaffold_10	AUGUSTUS	start_codon	784328	784330	.	+	0	transcript_id "g547.t1"; gene_id "g547";
Scaffold_10	AUGUSTUS	CDS	784328	785926	0.37	+	0	transcript_id "g547.t1"; gene_id "g547";
Scaffold_10	AUGUSTUS	stop_codon	785924	785926	.	+	0	transcript_id "g547.t1"; gene_id "g547";
# protein sequence = [MLCARNAVLRIPFYPNDATHPVYPTVCSERRAPLEEPCGALLLSYGKPLKRYEYYPFFDWFGRFLALPGIEEYGNKFC
# DTVSSHQSIPSDKVDQTDGRFVHEFRAQDGKLFVADRGNEGRWFFTLNADFFNVEGNRIRGKKSSTGMIAMSCLNLPLEIRNDHAFLYIPGIIRGPHE
# PNASNAEHRHYLKPLVDDLVKGYTRGVRPFATFRTRDSNTPYSQVSRIALVLALMDFKAARPFCGLLDVTSHHFCFLCDCWHTAHLGRTDYENWTTLD
# DERLRKGAEMWREAMLKDRKAIEELFGTRFSELWRLPYWRLCQIGIDPMHAFFLILLQRMFRDILGLDNPEDPSRKPSKPRFKIAFYYDFTPPPSLSS
# LVQEMAEVPLRRWSSMIGYVSQPLDEHRLSLLDWDHLSSEHRTHRRLRLESLKVEILNDSRAYQGVLEILTDLCERAPEVESKKKALYGRIQKQKWNA
# ILYVCDNLAIFPDHRCPQFQTSLKILKTNAKKEFLTNILINWVAITFADFLYVPSYMSIAHQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g547
###
# start gene g548
Scaffold_10	AUGUSTUS	gene	793085	793486	0.93	+	.	g548
Scaffold_10	AUGUSTUS	transcript	793085	793486	0.93	+	.	g548.t1
Scaffold_10	AUGUSTUS	start_codon	793085	793087	.	+	0	transcript_id "g548.t1"; gene_id "g548";
Scaffold_10	AUGUSTUS	CDS	793085	793486	0.93	+	0	transcript_id "g548.t1"; gene_id "g548";
Scaffold_10	AUGUSTUS	stop_codon	793484	793486	.	+	0	transcript_id "g548.t1"; gene_id "g548";
# protein sequence = [MLSPIREASNRELLWDALKDGTIDFVVSDHSPCTTELKKIDEGDVMGAWGGISTLGLGLSLLWTEGSQRGISLAQIID
# WTSVKTAKHAGLSERKGKLQTGYDADLVIWDPDAEFAVSLDKLHFSLSLPSSNLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g548
###
# start gene g549
Scaffold_10	AUGUSTUS	gene	796157	797170	1	+	.	g549
Scaffold_10	AUGUSTUS	transcript	796157	797170	1	+	.	g549.t1
Scaffold_10	AUGUSTUS	start_codon	796157	796159	.	+	0	transcript_id "g549.t1"; gene_id "g549";
Scaffold_10	AUGUSTUS	CDS	796157	796184	1	+	0	transcript_id "g549.t1"; gene_id "g549";
Scaffold_10	AUGUSTUS	CDS	796266	797170	1	+	2	transcript_id "g549.t1"; gene_id "g549";
Scaffold_10	AUGUSTUS	stop_codon	797168	797170	.	+	0	transcript_id "g549.t1"; gene_id "g549";
# protein sequence = [MFIQAAETDVRPTDPEAPHTLPKTEADDVASTLPDPPGAQSVTPRTHDADAMEFEGMEDEDIELQMALQASLGHDIPP
# SPADPPQLLRSSVPLPLVDSYPPSTSGSGTRTPLQQDSLLSPISPDVPHDPASVEASIAQSRRIYERMLAEQNLAHREIAAEGGGNSRVRRMREEEEE
# EEMLRRAIAESEAMAKEEGHELGSIGDDEGGSHMDLDQSHLAPPSTAGRRVYDDEDAELQAALRASLEGWNPPPETTTVSAPTVSHTSPLQSSDSSMT
# DDDESIASEDTAPAESSEAPVSVEEMRRRRLARFGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g549
###
# start gene g550
Scaffold_10	AUGUSTUS	gene	797873	800372	0.65	+	.	g550
Scaffold_10	AUGUSTUS	transcript	797873	800372	0.65	+	.	g550.t1
Scaffold_10	AUGUSTUS	start_codon	797873	797875	.	+	0	transcript_id "g550.t1"; gene_id "g550";
Scaffold_10	AUGUSTUS	CDS	797873	798133	0.97	+	0	transcript_id "g550.t1"; gene_id "g550";
Scaffold_10	AUGUSTUS	CDS	799383	800372	0.67	+	0	transcript_id "g550.t1"; gene_id "g550";
Scaffold_10	AUGUSTUS	stop_codon	800370	800372	.	+	0	transcript_id "g550.t1"; gene_id "g550";
# protein sequence = [MHGQPYPSGSDNAKDQTFNLKLICDENASDPKFVSYDGSLAEVEWTNPAACGSEVGDGSDNDSGNDGDSEGDEEEESV
# GSGIGWFFLSAKGKQSTRRDELSIISSESESDDVFTRSSISDEKKAPITPRRAYTHISTSVHSTHKSSIRAKPVLRTLSAPPNSSSFASPPSSPSRIH
# KKSKPQPPTAAASSPKPAAATSHYHRNPNTQFPTSTTTTNSSFQLPNAVIDISDVESYPSSDSSVSGSKTDEEEDSSGPEDVTPLQTRQRLLSPLTSP
# NFKNAVLTDGVGGGVHRHPDVKGKKTTVSNSSPSAQRKRSTPYTPNCTADVFTTGTSLSAAAEHLVSPRQGHTSSSSPRVSSASGFGGSELEQGSSND
# GVSSALGLLHQSPAPTNISVMYNDILDPRSPILRNRVMALGEPK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g550
###
# start gene g551
Scaffold_10	AUGUSTUS	gene	800990	801541	0.92	+	.	g551
Scaffold_10	AUGUSTUS	transcript	800990	801541	0.92	+	.	g551.t1
Scaffold_10	AUGUSTUS	start_codon	800990	800992	.	+	0	transcript_id "g551.t1"; gene_id "g551";
Scaffold_10	AUGUSTUS	CDS	800990	801541	0.92	+	0	transcript_id "g551.t1"; gene_id "g551";
Scaffold_10	AUGUSTUS	stop_codon	801539	801541	.	+	0	transcript_id "g551.t1"; gene_id "g551";
# protein sequence = [MDYSSDFSLETNGSRLLSESPMLPSSSSLSSSSSQADLSLSELSISERRPESPSSSSSSRPFSLLARPVSPSTPSPVQ
# TRRSNPKEVGDENSNEHEDMEDDEDFGEITQKQITVDDEQAATSDSEEREQVIRTKAKLLREDKLQNDIFVLRKLNAAFSSFNEALEGVGDANEARLV
# TTDVPLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g551
###
# start gene g552
Scaffold_10	AUGUSTUS	gene	804950	806155	0.29	+	.	g552
Scaffold_10	AUGUSTUS	transcript	804950	806155	0.29	+	.	g552.t1
Scaffold_10	AUGUSTUS	start_codon	804950	804952	.	+	0	transcript_id "g552.t1"; gene_id "g552";
Scaffold_10	AUGUSTUS	CDS	804950	805065	0.7	+	0	transcript_id "g552.t1"; gene_id "g552";
Scaffold_10	AUGUSTUS	CDS	805120	805391	0.48	+	1	transcript_id "g552.t1"; gene_id "g552";
Scaffold_10	AUGUSTUS	CDS	805488	806155	0.38	+	2	transcript_id "g552.t1"; gene_id "g552";
Scaffold_10	AUGUSTUS	stop_codon	806153	806155	.	+	0	transcript_id "g552.t1"; gene_id "g552";
# protein sequence = [MSSPGSGNHCSFVLLAEFDIIEGAQLKYQFPQPLGIDESVLAMSMLPDGAETQLDDWTIFFLNQTDFNTIEPVLALES
# DSDSFLEDQAGDHAGQERRKKKKELLCVLNLVRTKHDKTLNRGAKVLALAISLDDYLSNPSQDVLARLFDAVNAIDFTVAPVLSRDEKLVMRMSERKD
# IFAERHKHLYTNFTSSFTQHKNSNSDSSVNNQSLPIRPPVKEDPDLNIPGDVSFGSAVWVGDESAFDISGTTSDSDGATDGASTVIGSTRQRSSTDAS
# SSSSSSHLQLPRIPISRAGSSFGSHDSTVSGTKVGGRRPTWVPETLFKILISSTRQWSTTTINSQSKCHCRLSGGSW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g552
###
# start gene g553
Scaffold_10	AUGUSTUS	gene	808315	808650	0.99	+	.	g553
Scaffold_10	AUGUSTUS	transcript	808315	808650	0.99	+	.	g553.t1
Scaffold_10	AUGUSTUS	start_codon	808315	808317	.	+	0	transcript_id "g553.t1"; gene_id "g553";
Scaffold_10	AUGUSTUS	CDS	808315	808650	0.99	+	0	transcript_id "g553.t1"; gene_id "g553";
Scaffold_10	AUGUSTUS	stop_codon	808648	808650	.	+	0	transcript_id "g553.t1"; gene_id "g553";
# protein sequence = [MPPTKRKHSDSSDERSLSDLDIDGIDNDLEDDDVDISSALTRKRSKNNSQQNQSDGEEDFSIFLQDAMAKHNVKSGTE
# LLKKTKGKTKLVKGEVGGGSFQSMGTSRIKQRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g553
###
# start gene g554
Scaffold_10	AUGUSTUS	gene	809191	811346	0.5	+	.	g554
Scaffold_10	AUGUSTUS	transcript	809191	811346	0.5	+	.	g554.t1
Scaffold_10	AUGUSTUS	start_codon	809191	809193	.	+	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_10	AUGUSTUS	CDS	809191	810545	0.5	+	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_10	AUGUSTUS	CDS	810689	811346	0.99	+	1	transcript_id "g554.t1"; gene_id "g554";
Scaffold_10	AUGUSTUS	stop_codon	811344	811346	.	+	0	transcript_id "g554.t1"; gene_id "g554";
# protein sequence = [MNLDLKSVQYVVFDEADRLFEMGFETSLTEIIHRLPSSRQTLLFSATLPTSLVEFAKAGLENPKLVRLDAESKISPDL
# KMAFFSVKQAEKDACLVSLLRDVIKVPLIDSSQREEEERHDDKGKGKAKKRETMPHQTLIFVATKHHVEYLLNLLTTAGYAVSHIYGSLDQAARTYQM
# DQFRRGLTSILVVTDVAARGIDIPVLENVVNYDFPHGARVFVHRVGRTARAGRQGWAWSFVTHTELPYLIDLQLFLGRPLKCEVTEEGDQVYTESMVL
# GPMERSRIDEDMEYLKSLDDANHSLPSLRDVMKRAQSMYERSKGKASPSSYKRAKEMIKDPKWILAGSDTGINPVLLRGSNEFERRAQVQAKQTLLRA
# VNSFRPAETVFEIGTKGKASTANAALMKERRKALTKSVQRAQAATSSALAEDEVLDAVASTSKNLEMANEDDIAVSVHAPIWSKFKPSSPSYSLTDGA
# SFLEQARGATFDLAGDEGVADRKKRQLNWDKKKKKFVKGGGVGSDNVKMVKTESGTKLPATYRSGRFDEWKAKTHSSLPRVGEVEGEGVRSRQMSGPG
# GHRFKHQKITESKPLDKRNKDYERKSRQLKKRGDAEAGNSGGVSSSQVKGGRTKVGGRYGGKSVGRVKSELKSAEDIRKSRKVQEKRKAKNNRPPNHR
# KGRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g554
###
# start gene g555
Scaffold_10	AUGUSTUS	gene	819673	820684	0.59	+	.	g555
Scaffold_10	AUGUSTUS	transcript	819673	820684	0.59	+	.	g555.t1
Scaffold_10	AUGUSTUS	start_codon	819673	819675	.	+	0	transcript_id "g555.t1"; gene_id "g555";
Scaffold_10	AUGUSTUS	CDS	819673	819824	0.59	+	0	transcript_id "g555.t1"; gene_id "g555";
Scaffold_10	AUGUSTUS	CDS	819880	820684	0.85	+	1	transcript_id "g555.t1"; gene_id "g555";
Scaffold_10	AUGUSTUS	stop_codon	820682	820684	.	+	0	transcript_id "g555.t1"; gene_id "g555";
# protein sequence = [MSTDSGPLSDEDSTMGDGVDLNGHANGIGNGSHLPMSDDEDMSLVKTACLLRNLKRKKSNYAESSDEDDIPLASSPAK
# QPTSAAIPMPGAVAATTVPSSKASKSKRLGTKKEESDDDGYLKKPQKKKPRKKVKKEESSDDDIPIVAPKSSARKRKVKPESEAESSDEDKPIIKKTS
# ARKTPAKKAKKEEDVEQPASKVNGKAKAREINDGEDEGKGKGKGKKKKKEEEQEEEVYRWWEADPNGDGSVKWQTLEHNGVIFPPPYESLPSHVKMKY
# NGGPDGLTLICTQSCLTSHRHRKGCSSSSGIRRGCRLLWCFDRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g555
###
# start gene g556
Scaffold_10	AUGUSTUS	gene	822123	822545	0.64	+	.	g556
Scaffold_10	AUGUSTUS	transcript	822123	822545	0.64	+	.	g556.t1
Scaffold_10	AUGUSTUS	start_codon	822123	822125	.	+	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_10	AUGUSTUS	CDS	822123	822545	0.64	+	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_10	AUGUSTUS	stop_codon	822543	822545	.	+	0	transcript_id "g556.t1"; gene_id "g556";
# protein sequence = [MKLRHGLFGMDSKYKKIDKYKEDESDIDDDWIVEYEEQMKSKEIEKAEKKFAKENEKLTEDDLKPQLDSVLEARIRHI
# EEEFKRLAKERGKTTVAVKGNKTPEKLMEGIDKLTERIKSFKLQMVDRDEGKEVALGTRCGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g556
###
# start gene g557
Scaffold_10	AUGUSTUS	gene	823102	823943	0.51	+	.	g557
Scaffold_10	AUGUSTUS	transcript	823102	823943	0.51	+	.	g557.t1
Scaffold_10	AUGUSTUS	start_codon	823102	823104	.	+	0	transcript_id "g557.t1"; gene_id "g557";
Scaffold_10	AUGUSTUS	CDS	823102	823193	0.54	+	0	transcript_id "g557.t1"; gene_id "g557";
Scaffold_10	AUGUSTUS	CDS	823247	823943	0.92	+	1	transcript_id "g557.t1"; gene_id "g557";
Scaffold_10	AUGUSTUS	stop_codon	823941	823943	.	+	0	transcript_id "g557.t1"; gene_id "g557";
# protein sequence = [MFAALSVESSGEESEEEISESEVKSSATTSSAATEPPAPPVKMSKTAMKKAAKAARLEKLNSLAAEKPNGEITANAVS
# SSDSAEAGSFTGNLGDLEPEPPVDLVDEATVVSNHALEPPVTIPLEAAPPSKDPMELSYSMPTPEPGPSSELEASPIAPIEAPSSKQDAPPSDPENVK
# KRQNIFTRTLWTFIMIGIFIGASPRSMSWFHIVTHFQASYLWAMHTWSCLSCYVKHLYIAKSLLYSSWRNLINGTKSKARTLGARR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g557
###
# start gene g558
Scaffold_10	AUGUSTUS	gene	825200	828064	0.65	-	.	g558
Scaffold_10	AUGUSTUS	transcript	825200	828064	0.65	-	.	g558.t1
Scaffold_10	AUGUSTUS	stop_codon	825200	825202	.	-	0	transcript_id "g558.t1"; gene_id "g558";
Scaffold_10	AUGUSTUS	CDS	825200	826488	1	-	2	transcript_id "g558.t1"; gene_id "g558";
Scaffold_10	AUGUSTUS	CDS	828013	828064	0.79	-	0	transcript_id "g558.t1"; gene_id "g558";
Scaffold_10	AUGUSTUS	start_codon	828062	828064	.	-	0	transcript_id "g558.t1"; gene_id "g558";
# protein sequence = [MVPVDHLVVPSHIGHYPQKELEELTLPPAPSRKSFLPAVPQSKRPTWDEIESRGSEFVRAVSRKPPPIPSSEQPLPAK
# GTSTPPFSGRRLPPKPVRLPTPPPEPEIIYEEPEQKESSCIKCYDFSLVDEHASLFPRHSVTSLDHLAYDLTSPWESETEKFRAIFTWLHHNIAYDAD
# AFFCGNVQASTPESTLHSGLAVCDGYAGLFAFLAERSGLQAMKVTGHGKGFGYTPTESGGPVPQYQGNHAWNRALMDEEWRLIDSCWGAGAVDSSGFC
# KGFNPVWFTSTNAEFGKRHYPEDPAYQLISDEEGGPISWEDYILEPEGPLLFNDFHTHKFSPQYMQPSTKYIQGESWVSFHLFKLCEHLSTTEADNFV
# HFISLPDGSRTPLVLNDSGGWSATVYVPAGGDVSLFYVKEIGGKDARGLTMKDYSAAVGRKAMQFGGLCRWTLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g558
###
# start gene g559
Scaffold_10	AUGUSTUS	gene	833857	834330	0.42	+	.	g559
Scaffold_10	AUGUSTUS	transcript	833857	834330	0.42	+	.	g559.t1
Scaffold_10	AUGUSTUS	start_codon	833857	833859	.	+	0	transcript_id "g559.t1"; gene_id "g559";
Scaffold_10	AUGUSTUS	CDS	833857	834330	0.42	+	0	transcript_id "g559.t1"; gene_id "g559";
Scaffold_10	AUGUSTUS	stop_codon	834328	834330	.	+	0	transcript_id "g559.t1"; gene_id "g559";
# protein sequence = [MGPPLSPRETRRSGRRSGPSLSNSHSPESDISPRLKEPAQRPPLISTASGSNGRHKRPKQEDTDDLTEDRKNGTAHSV
# STSSNSSTQGSTKSKRKPKEKLPPPEETSDTTKPPLLPPEMAASEGQEEEEEGGITRCVCGNTGVFFFVLSVCTTWPFM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g559
###
# start gene g560
Scaffold_10	AUGUSTUS	gene	835135	835908	1	+	.	g560
Scaffold_10	AUGUSTUS	transcript	835135	835908	1	+	.	g560.t1
Scaffold_10	AUGUSTUS	start_codon	835135	835137	.	+	0	transcript_id "g560.t1"; gene_id "g560";
Scaffold_10	AUGUSTUS	CDS	835135	835908	1	+	0	transcript_id "g560.t1"; gene_id "g560";
Scaffold_10	AUGUSTUS	stop_codon	835906	835908	.	+	0	transcript_id "g560.t1"; gene_id "g560";
# protein sequence = [MFTEDTHVRPEGVVVQPAPNKRSTNSHRKGAKGNARPSQSQSNTGTGHASGSHDSRRTQGNNSNTNTQTSVDSRAYRN
# SHAYVVSQQPLYTSWNLPDYLSHLEEMLPTDVPKPIEVVAGATGRESIERTTERGVKVKWPSKRTSVADMNKRVRALVEWVGREQASASDRARRHEAL
# EIALKKNAANAFRGNGASGAGSFDRSVLTVSSLDRNAEGGSNRPGIPGTSSMKDMEALMEELIGFQEKFGPGARRERRIAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g560
###
# start gene g561
Scaffold_10	AUGUSTUS	gene	836187	836561	0.95	+	.	g561
Scaffold_10	AUGUSTUS	transcript	836187	836561	0.95	+	.	g561.t1
Scaffold_10	AUGUSTUS	start_codon	836187	836189	.	+	0	transcript_id "g561.t1"; gene_id "g561";
Scaffold_10	AUGUSTUS	CDS	836187	836561	0.95	+	0	transcript_id "g561.t1"; gene_id "g561";
Scaffold_10	AUGUSTUS	stop_codon	836559	836561	.	+	0	transcript_id "g561.t1"; gene_id "g561";
# protein sequence = [MSSEFQYPNGAGSLPREDSLNLSGSEDDNDHGGDYSTRMEELFADDVQDSNGHLEDESDDDGGFLYTGNDADLSTSYR
# DQLRNVLEDDSDAEVHEVEKSLMAEDPTEEVPSEDEEHDPLVCFSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g561
###
# start gene g562
Scaffold_10	AUGUSTUS	gene	837622	839789	0.06	+	.	g562
Scaffold_10	AUGUSTUS	transcript	837622	839789	0.06	+	.	g562.t1
Scaffold_10	AUGUSTUS	start_codon	837622	837624	.	+	0	transcript_id "g562.t1"; gene_id "g562";
Scaffold_10	AUGUSTUS	CDS	837622	838081	0.11	+	0	transcript_id "g562.t1"; gene_id "g562";
Scaffold_10	AUGUSTUS	CDS	838140	838302	0.31	+	2	transcript_id "g562.t1"; gene_id "g562";
Scaffold_10	AUGUSTUS	CDS	838460	839789	0.65	+	1	transcript_id "g562.t1"; gene_id "g562";
Scaffold_10	AUGUSTUS	stop_codon	839787	839789	.	+	0	transcript_id "g562.t1"; gene_id "g562";
# protein sequence = [MPLPLGTTSHPTDTYQAVALLTPHKLVVVGLKPTPKTWFKFARDDTKSQTRVRSRGTLCWFPSILPNTNKDGGLPPVT
# EEPTTPLLACSWGRVMHILRVFESRSRQLVRNPKTGKSIEHEVGSITYLNAGKWTADEDILAIQWLNVNVGSFASFSASALQVYDLSRTKVIEQISFD
# GLSLMSPSLRLTVSGATSYSESVGDVAHSIRVAIDLTRSYYTGEAPGNTNGLPDDPRLRKEVIGKKICELMTASANYAFSEDRMTDGTHDGPDGRGVD
# RTSLFEGLVSTCARACIALDDFDFLFEDLFQLYDDHSISQIFLTQLETFVLNNEIHFVPPRITQRLVAMHDNNSRPDLVERIIWHIDAECLDSNQAVQ
# ICQAHHLYDALIYVYTRALRDYVAPVVELLGLIRKVNQYRRHIAEYTESSMSDMEPVILNAYKIYPYLANILSGLTYPSEQPLGEEEALQAKRDVYTF
# LFFGRSSVWPEGGGGKLVLTADEEGGLEPTYPYVQQLLRYDAESFLHSLDIAFEDAYLNEKSPAVDRLVAVRILMDIVATGSLTQTDKTFVHIFIARN
# IPKYPQFLQEAIPFSTLHKILVSLAEDPDPDTREDRQLAAEYLLSAYNPHNVPHMTELFRKAGFFRILRGWHRQDKQWGLCF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g562
###
# start gene g563
Scaffold_10	AUGUSTUS	gene	842794	843216	0.58	-	.	g563
Scaffold_10	AUGUSTUS	transcript	842794	843216	0.58	-	.	g563.t1
Scaffold_10	AUGUSTUS	stop_codon	842794	842796	.	-	0	transcript_id "g563.t1"; gene_id "g563";
Scaffold_10	AUGUSTUS	CDS	842794	843216	0.58	-	0	transcript_id "g563.t1"; gene_id "g563";
Scaffold_10	AUGUSTUS	start_codon	843214	843216	.	-	0	transcript_id "g563.t1"; gene_id "g563";
# protein sequence = [MGSGFSNSSSSMPPRTPFTPFTAFSTQQSAFPSSLGKTKSPYSRLLDDSDDPLARYTQILRFVERDFSSIMDIAEKVS
# VKSRSSTDPFQIDTAENGRKRDGLGFDIMANVIWNELGKAIMDDLGGFVFASGRPDEFRKVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g563
###
# start gene g564
Scaffold_10	AUGUSTUS	gene	844090	844602	0.53	-	.	g564
Scaffold_10	AUGUSTUS	transcript	844090	844602	0.53	-	.	g564.t1
Scaffold_10	AUGUSTUS	stop_codon	844090	844092	.	-	0	transcript_id "g564.t1"; gene_id "g564";
Scaffold_10	AUGUSTUS	CDS	844090	844602	0.53	-	0	transcript_id "g564.t1"; gene_id "g564";
Scaffold_10	AUGUSTUS	start_codon	844600	844602	.	-	0	transcript_id "g564.t1"; gene_id "g564";
# protein sequence = [MALISSRGAKPVAPGSTRPCTMSVLSPAASSSSSADPFQLERLAEELATRELSHPAQSYPQDGSSHDLPIYTPLSHEN
# PFLSAEKFDVEAFLLSRSHTSLQDLRAELRDYLATLKEELVKLINDDYEAFISLSTDLKGEGERLTGLKQPLGALKSEISVSCSINYSGIMI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g564
###
# start gene g565
Scaffold_10	AUGUSTUS	gene	849070	849627	0.48	+	.	g565
Scaffold_10	AUGUSTUS	transcript	849070	849627	0.48	+	.	g565.t1
Scaffold_10	AUGUSTUS	start_codon	849070	849072	.	+	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_10	AUGUSTUS	CDS	849070	849096	0.49	+	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_10	AUGUSTUS	CDS	849235	849627	0.99	+	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_10	AUGUSTUS	stop_codon	849625	849627	.	+	0	transcript_id "g565.t1"; gene_id "g565";
# protein sequence = [MSRAPAPAQEVEDAEFKRKREEAEANAEAKTAKNRAKRQKKKGKAKNAGSESTHGATSSQKEGADGNDIPFKKRRLVN
# GRELVFRKQGEDGEDSDENEDEQSVPNHPATEASDPPLGMSASDTRPPPVAPSKIVIHEDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g565
###
# start gene g566
Scaffold_10	AUGUSTUS	gene	852151	852474	0.42	+	.	g566
Scaffold_10	AUGUSTUS	transcript	852151	852474	0.42	+	.	g566.t1
Scaffold_10	AUGUSTUS	start_codon	852151	852153	.	+	0	transcript_id "g566.t1"; gene_id "g566";
Scaffold_10	AUGUSTUS	CDS	852151	852474	0.42	+	0	transcript_id "g566.t1"; gene_id "g566";
Scaffold_10	AUGUSTUS	stop_codon	852472	852474	.	+	0	transcript_id "g566.t1"; gene_id "g566";
# protein sequence = [MLLTLLSSRSEIEEPSSLMIRSEDETAAASTNAFLKSRLNFIKDKNGQEICVVKVGDEEIGVMMGWEQGIMQETVKNL
# CEDHPSSDNFKVLNIGFGLGIVCVFFPRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g566
###
# start gene g567
Scaffold_10	AUGUSTUS	gene	857843	859960	0.09	-	.	g567
Scaffold_10	AUGUSTUS	transcript	857843	859960	0.09	-	.	g567.t1
Scaffold_10	AUGUSTUS	stop_codon	857843	857845	.	-	0	transcript_id "g567.t1"; gene_id "g567";
Scaffold_10	AUGUSTUS	CDS	857843	859535	0.63	-	1	transcript_id "g567.t1"; gene_id "g567";
Scaffold_10	AUGUSTUS	CDS	859956	859960	0.09	-	0	transcript_id "g567.t1"; gene_id "g567";
Scaffold_10	AUGUSTUS	start_codon	859958	859960	.	-	0	transcript_id "g567.t1"; gene_id "g567";
# protein sequence = [MLIVVDSGVSACFLLPLQRADILDRIRLQRQQGKILGSPLTSLSSSSSYPAPPAQSRDATISSRYFPQTPGSPNDTVL
# VPSSSPLNSPVNRNPNQPYTQPRWPDVAFRNGAALAGSWNLSQLAPSYDPLSVSSGFTSQNNFQRGSNVRPFSPGESESGLPRKRPNLSDAPSNLAIA
# RSPDSPGIQRPGQRRRTLLDAGSTSSEESTPESSSRTRLVRGRPADSAEPPLSSPPADIFLDPKFVRFNMTMPGVPSHRVRAAWLHAKQDVRLATQLA
# SDDSWVPKPSTPLQSSPSHSLKASTGIHGKVDGLEEAHKAKLAAMKEKSKKSSIYANRPNASKVAPPATPSVKNPPIDLIAESPAMSQPVRRKRNKNM
# IVDSDSDVEMDDSEEERSHKRSRQESHHELRVLTFFNTQGAEALQELTGMLFSIHSLSRNSECVIGCTQVQAQAIIDLREFESVDDLNTKLGQGKKKA
# GPAGLSPRLIDEAVEIFKGTLPSMKSSRAVKRSVQSCNPLSQPGQLFRSKAKENKLTRYRNRSKTAPSIYVQCPRSKNTDLKDISPSSLHLYQTA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g567
###
# start gene g568
Scaffold_10	AUGUSTUS	gene	877544	878086	1	+	.	g568
Scaffold_10	AUGUSTUS	transcript	877544	878086	1	+	.	g568.t1
Scaffold_10	AUGUSTUS	start_codon	877544	877546	.	+	0	transcript_id "g568.t1"; gene_id "g568";
Scaffold_10	AUGUSTUS	CDS	877544	878086	1	+	0	transcript_id "g568.t1"; gene_id "g568";
Scaffold_10	AUGUSTUS	stop_codon	878084	878086	.	+	0	transcript_id "g568.t1"; gene_id "g568";
# protein sequence = [MDQAASVISVPSSALYISFFPELSASAVPLPTGAIFIIANSLVVSDKAVTAKHNYNLRVVETLAAARILARHLELKVG
# KTEKVTLREVVGRLAGEVEEVGAMPVEWLLETLKRMEREIECLKPKKSSGEGQFGVTMEEMIEMSGMTAEEFKEVYLSWVEGKSAEYFTATILSSPFP
# STQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g568
###
# start gene g569
Scaffold_10	AUGUSTUS	gene	883943	884275	0.5	-	.	g569
Scaffold_10	AUGUSTUS	transcript	883943	884275	0.5	-	.	g569.t1
Scaffold_10	AUGUSTUS	stop_codon	883943	883945	.	-	0	transcript_id "g569.t1"; gene_id "g569";
Scaffold_10	AUGUSTUS	CDS	883943	884275	0.5	-	0	transcript_id "g569.t1"; gene_id "g569";
Scaffold_10	AUGUSTUS	start_codon	884273	884275	.	-	0	transcript_id "g569.t1"; gene_id "g569";
# protein sequence = [MHSEYDQLKAEKGTLYGIPFESLVKLTSPNNPFGFYTTSKDRDAEIATLYSAASVMSVPKTNPRSPVQSTFAQSNQHK
# QSQAHRSETVVELPSARALFEDREIAADAVPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g569
###
# start gene g570
Scaffold_10	AUGUSTUS	gene	888294	889163	1	-	.	g570
Scaffold_10	AUGUSTUS	transcript	888294	889163	1	-	.	g570.t1
Scaffold_10	AUGUSTUS	stop_codon	888294	888296	.	-	0	transcript_id "g570.t1"; gene_id "g570";
Scaffold_10	AUGUSTUS	CDS	888294	889163	1	-	0	transcript_id "g570.t1"; gene_id "g570";
Scaffold_10	AUGUSTUS	start_codon	889161	889163	.	-	0	transcript_id "g570.t1"; gene_id "g570";
# protein sequence = [MAKATKNASASGSKPITDYFSRKPATRSKSDNISDGQSNTPKKQQPKPTTSSPPTEPSTSALSPENRLQMRSSTPEAN
# SRVESGCVPSQSQPIAIPPTPFSSKKISTKKNGSRTKNFISSSESSSIDEVPGSVSGEEEMECVTRVRRDVEASKQSVAKWRNESPLLSDLPERMNVD
# EVPTSNFDTDQSPSSAERSTPPPSQQQLTPPPTTVLDHQILPPIPAAIETARKTEELIAAIKAKAIAAAKSSPIEQEIRPFKETLSDSDTDEELRPLE
# INVKGKGKAKEVLVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g570
###
# start gene g571
Scaffold_10	AUGUSTUS	gene	890018	890967	0.46	-	.	g571
Scaffold_10	AUGUSTUS	transcript	890018	890967	0.46	-	.	g571.t1
Scaffold_10	AUGUSTUS	stop_codon	890018	890020	.	-	0	transcript_id "g571.t1"; gene_id "g571";
Scaffold_10	AUGUSTUS	CDS	890018	890833	0.81	-	0	transcript_id "g571.t1"; gene_id "g571";
Scaffold_10	AUGUSTUS	CDS	890962	890967	0.46	-	0	transcript_id "g571.t1"; gene_id "g571";
Scaffold_10	AUGUSTUS	start_codon	890965	890967	.	-	0	transcript_id "g571.t1"; gene_id "g571";
# protein sequence = [MPLESPYISDKPPAFQRSPKVPNFDKETQLTLEYDGLPPLRSIKGAEVVVFANVSNVFVRSSGTVREIYSATAIAGGV
# VVSRNGRLICTGNQSTCLTEAVLASDSKPFFVDLKGGSIEPALTSYGAPLGLEHINQEPSTNDGFAFEPLSQRVPKILGGSIVRAVDGLLFDTRDALY
# AYRAGVTTGITAPSHYGFFFGLGTAFSTGASHKLENGAVVQEVTALHTAIGFDDTPSVSTQIATLRKLLMTPPEGPAGVWFRKVSEVCAAYSDFDII]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g571
###
# start gene g572
Scaffold_10	AUGUSTUS	gene	897606	898047	0.95	-	.	g572
Scaffold_10	AUGUSTUS	transcript	897606	898047	0.95	-	.	g572.t1
Scaffold_10	AUGUSTUS	stop_codon	897606	897608	.	-	0	transcript_id "g572.t1"; gene_id "g572";
Scaffold_10	AUGUSTUS	CDS	897606	897878	1	-	0	transcript_id "g572.t1"; gene_id "g572";
Scaffold_10	AUGUSTUS	CDS	897937	898047	0.95	-	0	transcript_id "g572.t1"; gene_id "g572";
Scaffold_10	AUGUSTUS	start_codon	898045	898047	.	-	0	transcript_id "g572.t1"; gene_id "g572";
# protein sequence = [MIKERVDKDYASMLRTSLTSISKVNKTDVETLRSSFGSIANIARTSPDQLSNLPGFGQVKVKNIKNAFEKPFRNHATN
# TLAFMASSPSREPMGNEPHDGVEQGNTVAEPSYKPPREPSPVWDIELDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g572
###
# start gene g573
Scaffold_10	AUGUSTUS	gene	911484	915224	0.14	+	.	g573
Scaffold_10	AUGUSTUS	transcript	911484	915224	0.14	+	.	g573.t1
Scaffold_10	AUGUSTUS	start_codon	911484	911486	.	+	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_10	AUGUSTUS	CDS	911484	911998	0.42	+	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_10	AUGUSTUS	CDS	912162	912195	0.24	+	1	transcript_id "g573.t1"; gene_id "g573";
Scaffold_10	AUGUSTUS	CDS	912296	912589	0.25	+	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_10	AUGUSTUS	CDS	912642	915224	0.97	+	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_10	AUGUSTUS	stop_codon	915222	915224	.	+	0	transcript_id "g573.t1"; gene_id "g573";
# protein sequence = [MILEANSTKKLTSIRLPHLSVKALLDYNASNTWLEAAEIVTDVFLDIYSSPAGWHEMSAAQADFVWEQDRPTGRVDQL
# ITMLKTTRSVSGQWTLTSAFAITMVIADPGIRKHLKNVYMPQPTNPRQNAYSRRHYEHHPRSDIGPIDDVVQSSESDGENPSGFADTIRAARPLFRYG
# LKITFYPPITLGRGTFHTNKSEWYSRSYKYDIFLINFNIQENQFAYAKKHLNAERSNWTPFAFEPPDNSKNTITVKFSQHDGIDLKLTPLIVNVLEAL
# QSDLESTHFSAEYLTDRWLSSYIGDFPDPSKPKVSSRTILDIHSESVALHVLHRLDVIENGPVHKNDYSGRFAYLVFTASNIQISGNMSVENRSIAAR
# FARTDMDLTSVHSDGRAAAKQPALSFSVLEFQTTLFKDNHEFSCAKLTAELSHSLPSLLISVANAVEGDLPRLVRLRKRASESSSNVIRSTIYHILHS
# SSNELVIDPLSTIQPSFLVQVGLPQMLRVDPAFRFLFHLRDCLWRLREVNPTWDMDRIEAQKVTIDDVTPLLRDRLLALDPDAYHTSRLESLQPLLPF
# IKPATNRRKDETHFSFSYVSIKLNSVELKVADSENRTPCQISLSDMFSGLRLRHHQLLDEEDEFRRLAASQTSLRSKSPDLVQRASVSIVLGDIQTTV
# YPYLINFVQEIIRAQKLNAGASSAKKLKRARFKPFNVVYIHAVLTIKRFRLRASAEKLTFEFGISELRHSSTVLIHHHSKKQSMNHSLLFTEMFIKAR
# ATSEPHEHDDLASLTIADSLLSSVMRNETLDQSIKLAFNLKALRFSVPRSALRLYHFVEQWRADFLSGIESTVQALILEVNKPSTNNARLPQSHSTFP
# KSSTLQIDGQVSCAGIYLRVMHDTWLSWEVNDISLFLNSLARARQRSHEFGLQLSSQLFAVSTESSEPSYKTRVKFEFPPTLLSGHIDQSSIRITSFI
# HFLELKVKPSYWDTLLAVQQKFGQDFNDLLVVIQQTRSKRFPAPPASLSKPETTTQTDFSVFVQMEGFRIGFEGRSSVLYLECPGIRSKFEGVPEKAW
# SVVVTDLALSLAPRLSMTPHSFGLNRHQRSAFVIIDFKIQSESQGSGSEALEVVVTKIHAVMQPSSIGEMGDFIDELQVNLLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g573
###
# start gene g574
Scaffold_10	AUGUSTUS	gene	915269	915652	0.76	+	.	g574
Scaffold_10	AUGUSTUS	transcript	915269	915652	0.76	+	.	g574.t1
Scaffold_10	AUGUSTUS	start_codon	915269	915271	.	+	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_10	AUGUSTUS	CDS	915269	915652	0.76	+	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_10	AUGUSTUS	stop_codon	915650	915652	.	+	0	transcript_id "g574.t1"; gene_id "g574";
# protein sequence = [MIDRREQRTQELAAFKQKTQRLIKTFEIKNQEPALSDRISWLDNYIIQFSLSNIGVAFPLAHDHDMDLPPLGSHDSTA
# VRAFLFSIKSVKFGTQRGETGEAGMESLSFQFVPRYMFSKLLSVNEANG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g574
###
# start gene g575
Scaffold_10	AUGUSTUS	gene	915733	918503	0.09	+	.	g575
Scaffold_10	AUGUSTUS	transcript	915733	918503	0.09	+	.	g575.t1
Scaffold_10	AUGUSTUS	start_codon	915733	915735	.	+	0	transcript_id "g575.t1"; gene_id "g575";
Scaffold_10	AUGUSTUS	CDS	915733	917213	0.27	+	0	transcript_id "g575.t1"; gene_id "g575";
Scaffold_10	AUGUSTUS	CDS	917269	917612	0.22	+	1	transcript_id "g575.t1"; gene_id "g575";
Scaffold_10	AUGUSTUS	CDS	917689	918503	0.82	+	2	transcript_id "g575.t1"; gene_id "g575";
Scaffold_10	AUGUSTUS	stop_codon	918501	918503	.	+	0	transcript_id "g575.t1"; gene_id "g575";
# protein sequence = [MTAQLRSSKSATFNQIYMTATVSGFVLNMDSTIPDYVFSLFDVYRHGKERVQRLSASIPRGGSSIPNAAVSNRQISHS
# AASPDIFASLTFQSGKVCMFSTDASKSSRIRAYSGTWDRPEEPIGDVEAEVFNLPVVSVWAEYRAAPPSRQGSNTEIEPSILIFKSTVHSSHNTLRPM
# LLPFVTEVVTHVEARLRTSTRIDLPSLAVEPAVQTEVTPVPNATSTLRMSFSLRIDQSRLELTCLPDVNVVAAVNWDSGGFMVNVLPGSRDVTFTGVV
# GGLTIGLKHGFLSEDCLKLDARNLAFSVALGKPCFQDRPMLTSISLVVDTEFLGAVRFSRLQDILCFKAVWLDRIPVFNTHNDNDDLSKIKPNHAPPT
# TPNNKPEFDIAILVRIRRIKLEVDLGQSISTVTLHLENSNLRTKLTQSFHELSIRVGHLAITAKGNVAGYANVPNCVFQTIQWVGKPPVEDGTRDRML
# ELRMMSGPLIVMLESDYQKLLHYRAEPLEVDILDDWSIPKSSQTDRPLRLSFTVKSKEVVAIATVGTIPKLLAYANKFKANLEAQREGASRESNTFRI
# SRAPKPDNPLSAVAEAMITSARTRFKEADAILSYTIRQHMSQDVRGRLNRLIESASTSSKRDIRLSFSFMRISRFTQLGHAIMPPITEISDGRQWLED
# LLKDANNADIVGLPSMIMHMASTESQEGLHKTLAYNFDSQFVRLKGVQHSEDIYITLNVGLYSWLTVLRKTLSREMEQVQTAADWRMFAANPVQTRRN
# IPEPLNLANPPRSATVPSPTNVFSPLSPKSASAVTTNFGSSLDVASLSKSQSEAFAPSPTDGEGEAKAFVYRPGHRRIERLTMRQLGEATPDVMHPFF
# MKKSWIQLGRFAPAIRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g575
###
# start gene g576
Scaffold_10	AUGUSTUS	gene	921674	922596	0.67	-	.	g576
Scaffold_10	AUGUSTUS	transcript	921674	922596	0.67	-	.	g576.t1
Scaffold_10	AUGUSTUS	stop_codon	921674	921676	.	-	0	transcript_id "g576.t1"; gene_id "g576";
Scaffold_10	AUGUSTUS	CDS	921674	922202	0.89	-	1	transcript_id "g576.t1"; gene_id "g576";
Scaffold_10	AUGUSTUS	CDS	922349	922596	0.69	-	0	transcript_id "g576.t1"; gene_id "g576";
Scaffold_10	AUGUSTUS	start_codon	922594	922596	.	-	0	transcript_id "g576.t1"; gene_id "g576";
# protein sequence = [MLRGFSNVAFLITMCNVCTAVLIVHLWDLKAKEISERSIRISTTEDVKPQYALAIQSAKDDIEIFLNALEWAKPHYSS
# VAQIFSEGSRTLWSWDSPEVPSNAPSLPTLSKPDWNNLPPGNYSPLRTNSYSIPTASFERTSNPLIRRDSDPYLGQRAFWPTYSNPSSSTQIPSNQHT
# ISNYPAPNRESLPFIKAIKRSPFALSQPAHPRYSSTSSSRHDYSPYDSYQANDELNISQQLPTSDARSLPTSPEYDKRSFTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g576
###
# start gene g577
Scaffold_10	AUGUSTUS	gene	923997	924696	0.63	-	.	g577
Scaffold_10	AUGUSTUS	transcript	923997	924696	0.63	-	.	g577.t1
Scaffold_10	AUGUSTUS	stop_codon	923997	923999	.	-	0	transcript_id "g577.t1"; gene_id "g577";
Scaffold_10	AUGUSTUS	CDS	923997	924617	0.97	-	0	transcript_id "g577.t1"; gene_id "g577";
Scaffold_10	AUGUSTUS	CDS	924676	924696	0.63	-	0	transcript_id "g577.t1"; gene_id "g577";
Scaffold_10	AUGUSTUS	start_codon	924694	924696	.	-	0	transcript_id "g577.t1"; gene_id "g577";
# protein sequence = [MEILLQKLRPGQDFSAELGPPVLRDSWKDPKPSSEISHSKSRLRVSSPPKLAPHLDSNISIPLSSHLKIHTNPSTSSK
# MLPYRRTRQGSATNSADSSTSQYDSSDADELVDNFEKGMQRLTLHSGHSQLQSAGPYDRFHGQSSYIKLVDATRKLKQAHIMAQKEEFSHSSGSNTST
# TSPSPEISNALRRLEFWRAPKASGWTSVKILSLIDSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g577
###
# start gene g578
Scaffold_10	AUGUSTUS	gene	932170	933021	0.73	-	.	g578
Scaffold_10	AUGUSTUS	transcript	932170	933021	0.73	-	.	g578.t1
Scaffold_10	AUGUSTUS	stop_codon	932170	932172	.	-	0	transcript_id "g578.t1"; gene_id "g578";
Scaffold_10	AUGUSTUS	CDS	932170	933021	0.73	-	0	transcript_id "g578.t1"; gene_id "g578";
Scaffold_10	AUGUSTUS	start_codon	933019	933021	.	-	0	transcript_id "g578.t1"; gene_id "g578";
# protein sequence = [MSAPTILEKIYTQRQKDVEVAKATPGTKPEDIQTYLDMGLAPTQISLVPRLKSNPSIDTAEPSLSLMAEIKRASPSKG
# EIAMSTNPAKQGLIYALAGASVISVLTEPTWFKGSLLDMRLVRQAVDKLPNRPAILRKEFIFDEYQIAEARLHGADTVLLIVAMLTQELLASLYAYSV
# SLGMEPLVEVNNAAEMARALGLGAKVIGVNNRNLHNFDVDMGTTSRLVDMVREKNVLLCALSGISGPQDVKVYKDQGVNAVLVGEALMRAADTTVFIR
# DLLNWPHNG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g578
###
# start gene g579
Scaffold_10	AUGUSTUS	gene	935324	935764	0.61	-	.	g579
Scaffold_10	AUGUSTUS	transcript	935324	935764	0.61	-	.	g579.t1
Scaffold_10	AUGUSTUS	stop_codon	935324	935326	.	-	0	transcript_id "g579.t1"; gene_id "g579";
Scaffold_10	AUGUSTUS	CDS	935324	935764	0.61	-	0	transcript_id "g579.t1"; gene_id "g579";
Scaffold_10	AUGUSTUS	start_codon	935762	935764	.	-	0	transcript_id "g579.t1"; gene_id "g579";
# protein sequence = [MDQLNVQGRSNDDYVATYDPTTSKFTRLQLENFNSDQPISVHGMDVVQSTSSGSELFVFVINHRAPPAGQDPRKVGAD
# SVIEVFKTTVAGDRLVHINTVRDPRVIVSPNDVVGEADGKGFFFTNDRGSKISNSYVRRQCSLALFTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g579
###
# start gene g580
Scaffold_10	AUGUSTUS	gene	936806	937219	0.37	-	.	g580
Scaffold_10	AUGUSTUS	transcript	936806	937219	0.37	-	.	g580.t1
Scaffold_10	AUGUSTUS	stop_codon	936806	936808	.	-	0	transcript_id "g580.t1"; gene_id "g580";
Scaffold_10	AUGUSTUS	CDS	936806	937219	0.37	-	0	transcript_id "g580.t1"; gene_id "g580";
Scaffold_10	AUGUSTUS	start_codon	937217	937219	.	-	0	transcript_id "g580.t1"; gene_id "g580";
# protein sequence = [MSLVSLTGNDSISPTGSTAKLDLYVNMIMNLSSQIHYIYFLQALQARTLLTSFSSVGYCHSDHGCKIAVDNLYTANGI
# AKATNGTVYVASTSGLELKMFEKQDDDSLVFLEGVHCGVYIDERSVLTDSSKRLSRYPD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g580
###
# start gene g581
Scaffold_10	AUGUSTUS	gene	941610	942296	0.39	+	.	g581
Scaffold_10	AUGUSTUS	transcript	941610	942296	0.39	+	.	g581.t1
Scaffold_10	AUGUSTUS	start_codon	941610	941612	.	+	0	transcript_id "g581.t1"; gene_id "g581";
Scaffold_10	AUGUSTUS	CDS	941610	942296	0.39	+	0	transcript_id "g581.t1"; gene_id "g581";
Scaffold_10	AUGUSTUS	stop_codon	942294	942296	.	+	0	transcript_id "g581.t1"; gene_id "g581";
# protein sequence = [MHSASLLADAGHSLSGLCSSSFIFTTTTHSTLDLLGDFVTLFCWKLSRKPPSEWYPYGFAKFETLGTTTVSLLLIGGA
# LGIGFHSYHILLTALSETAATLPAGPIQSILTNVTSAVPDVPHVLSHHSHVEAVDPNAAWFAAISVLVKEWLYRVTKAVADDENSPVLLANAIHHRSD
# AYSSFVALFAILGSWIFPKLPLDPIGGTSHPQFKFFVLVIFFFSPQVCWCPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g581
###
# start gene g582
Scaffold_10	AUGUSTUS	gene	945049	948551	0.14	-	.	g582
Scaffold_10	AUGUSTUS	transcript	945049	948551	0.14	-	.	g582.t1
Scaffold_10	AUGUSTUS	stop_codon	945049	945051	.	-	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_10	AUGUSTUS	CDS	945049	945890	0.77	-	2	transcript_id "g582.t1"; gene_id "g582";
Scaffold_10	AUGUSTUS	CDS	946000	946634	0.28	-	1	transcript_id "g582.t1"; gene_id "g582";
Scaffold_10	AUGUSTUS	CDS	946716	947131	0.27	-	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_10	AUGUSTUS	CDS	947193	948551	0.37	-	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_10	AUGUSTUS	start_codon	948549	948551	.	-	0	transcript_id "g582.t1"; gene_id "g582";
# protein sequence = [MQNEAVSEGEKGPVGEEQQPDTDTPPPQQKEQQHEEQSEARAGTESENEVGPETLVEGAPVPTPATRTKRRSRSRSRS
# RGSRDMKGKARAPTPSPLITGDSSQDEAFTASPTITLPVVPQLISPVPSQFQRSLLLRSPTPTSQDPSQFQYPGTSPPTPLPSLEALQKGLFRSNSAG
# RMLAMHKLTNGTESYEPSLSPSPALSPGKFKRTNTVSGGERNAARKLLMDTLGSRSRVAKDTDGSGNDEIQAPSPSPNPKRRRRRSRRGSSGANTGIS
# DSEFASTSPNTPIVPPTPLPPTPLDLFRARSVTPNQLPSPRALSPALSKAESPQPPLIFNESRRRSVVVEEEDEEISALSRRLPSSPTRKLPSPPTPF
# ISRMPNTPELKDYPTTSGVGVPVYLNHRDDIFPTSPFSRPLKEKTSQDDDEEEIVYNTDTSKDLYAFDAIEREISWIASPGIRRPIYDNDDDDEDDGD
# YPDEDEAPYDERPPSTHSRSSNEEVYEDISPRVSSDSQNVLIESDSIPDVTPLYAPHSPSSVAALSPASMPRESDGSLSPQYHNRPSPRLQGELSPMS
# AEFGDLDDRPIVNDNSSKRSGDSTIVTRERRDHTDSSISRESGASINSPRGDPNGGFASQQSQAPVLSPSTSALSLAPQSISRVSPVPPPTSDTYARY
# QNAKLFPFPGIHKLEEERNRVKGLTPSASTPDINAQFHAYEDPTSPSYPGPAGSSTQFDQSKDRTLMQQTSESNIAKYLLSPPLSSDASSSSTFPEYF
# DITPASSTPTNTNSIKLPMTLPAVKQWMSKNKKIFFPFTELVSDWEDLNSTSTETGTLADRPPPVSSERSLSGEQVPAATPPRASPVGTSEHDVEKTP
# KAQRTITSPTSNVERPKLSSSAQSSALPSPPDPLSSTTPDPSSSLSDYPAPSTSTSSSSLSSNYSVAAPPGVQGSIVLERLEENLARGPRSPMWASVL
# ESPPRKLILSSPVLQVVNANTVKDRFLFLFSDILVIAKPVSEGENEGMDLPTPERKFTVKSVVSLQNLRFNADRADPVNRNSTFGLPNRNPLLRSFIH
# QFSKDPDHAISMFFAKSGLSDDQSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g582
###
# start gene g583
Scaffold_10	AUGUSTUS	gene	951547	953916	0.41	+	.	g583
Scaffold_10	AUGUSTUS	transcript	951547	953916	0.41	+	.	g583.t1
Scaffold_10	AUGUSTUS	start_codon	951547	951549	.	+	0	transcript_id "g583.t1"; gene_id "g583";
Scaffold_10	AUGUSTUS	CDS	951547	952407	0.42	+	0	transcript_id "g583.t1"; gene_id "g583";
Scaffold_10	AUGUSTUS	CDS	952552	953916	0.98	+	0	transcript_id "g583.t1"; gene_id "g583";
Scaffold_10	AUGUSTUS	stop_codon	953914	953916	.	+	0	transcript_id "g583.t1"; gene_id "g583";
# protein sequence = [MALIKDSSERESRPPSGQSNKTGSRRPSPARGVTPPLNATETLASLRGNEASAQQKDAEVGSRTKSKTPPGPQPTYQQ
# HYYPYPPPPPPPHMYSVSPYESSWGRMMPPPLPPASGDRGRDPRGSESPVAGGSPGYPQSGMPGYPHPHHHHHHHQGHHPHPHDPYPPLPHHYAHSAY
# PYGNPNGPHMPVYPVQTSYTYNPAGVTAYGSHPPPYSGPGGHGTVGSNYSHNGAEPMNMPPSSESDSNIHSIGPGAPPSVPGNGFAAITATLTPTPIP
# ESEIIYTEDAATKLCNKCGLFERTHSRPRPEQFPHKRTSLGGEGEGGNQSPSSPSYSLTPVPSQSPLHSQDTSSRPVLPHRESIGPTKRNKKAKLGHD
# KPESDSKAQSIAPVPTSSSGGPPGPVSALHVPSQANGLVLPTSDTPSNSHHLPVGLANLTHPHPPQHQPYYGNQPNSSPHPSSYPTHPSHSSHTMYAG
# GAFGVPLQYNGYPSSNGFALPPIGGPALNGYEYTQPHNHSHQQQQQHSGPPPPQRASAPVSGLQGLLNGVDGRGRDSRESSAPAPFRKSSDVPIDPSL
# SQSNDGMKENDQDNSPSRRNIAKELDVSPSEKSGDLQVKSKSTTSKSPTKSSTGTRVPRKSGKPMMNLLWIPILLDQMASERLLLKETLRPNQRQIIT
# LRCLMVIIPVMLMKKKQVGVEMTILQRATMTTEVVIIKSVEAEVRKVEGGDLSVRLQRDKLGWAAVLSGARGRGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g583
###
# start gene g584
Scaffold_10	AUGUSTUS	gene	955594	956395	0.88	+	.	g584
Scaffold_10	AUGUSTUS	transcript	955594	956395	0.88	+	.	g584.t1
Scaffold_10	AUGUSTUS	start_codon	955594	955596	.	+	0	transcript_id "g584.t1"; gene_id "g584";
Scaffold_10	AUGUSTUS	CDS	955594	956179	0.88	+	0	transcript_id "g584.t1"; gene_id "g584";
Scaffold_10	AUGUSTUS	CDS	956241	956395	0.94	+	2	transcript_id "g584.t1"; gene_id "g584";
Scaffold_10	AUGUSTUS	stop_codon	956393	956395	.	+	0	transcript_id "g584.t1"; gene_id "g584";
# protein sequence = [MFSLRRAPFRRCLHTQATHSLHQAKPYRLGFTLAASITVASYTTWRWTRDQRIALDSVTVSESTCPLDFTSFTHSWTL
# PPDIKTPVLDGSSSETDHISASPLQNPEGSTESSTKSEAETEASDSASQGAYNPETGEINWDCPCLGGMAYGPCGPEFREAFSCFIYSEEEPKGINCV
# EKFQAMQTCFRAHPEVYADEIMDDDEDGKANQGATEGVTVDASSPEAASSSGTSQVEKSDSSVSARSTST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g584
###
# start gene g585
Scaffold_10	AUGUSTUS	gene	957083	959780	0.03	-	.	g585
Scaffold_10	AUGUSTUS	transcript	957083	959780	0.03	-	.	g585.t1
Scaffold_10	AUGUSTUS	stop_codon	957083	957085	.	-	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_10	AUGUSTUS	CDS	957083	958177	0.6	-	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_10	AUGUSTUS	CDS	958233	958367	0.51	-	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_10	AUGUSTUS	CDS	958421	958848	0.68	-	2	transcript_id "g585.t1"; gene_id "g585";
Scaffold_10	AUGUSTUS	CDS	959088	959431	0.27	-	1	transcript_id "g585.t1"; gene_id "g585";
Scaffold_10	AUGUSTUS	CDS	959488	959726	0.51	-	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_10	AUGUSTUS	CDS	959778	959780	0.67	-	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_10	AUGUSTUS	start_codon	959778	959780	.	-	0	transcript_id "g585.t1"; gene_id "g585";
# protein sequence = [MSTPRRATKRQRSSSPGGSSPIAAPRTPLRRRDSESSLPPSSPVAFDDTDDSMDERDAVPDLDDGEDNDDGEDLYGDN
# MQEDYGTNELLDRYDATGLDDDEDVEELSAAARRLVEKKMDRRDRAARGGKGARAAQRSRAPAFLDDDDDDMDDDDDELLRMKRRTRRQYDERRDMDD
# MDGLKDVSYLFFLFLESVYHNSESLEVSYSHLAYSKPILAYFLTNAPTAMLAIFDEVALTAILVYYPAYERIHSEVHVRICDLPFASSLRDLRRSNLN
# NLVRVSGVVTRRSSVFPQLKYVKFDCKKCGAVLGPFYQDATKEVKVSYCANCESKGPFPVNSEQTVYRNYQRMTLQESPGSVPAGRLPRHREVIVLWD
# LVDSAKPGEEVEITGVYRNNFDASLNAKNGFPVFSTIIEANHVNKKEDLFAAFRLTEEDEKEMRALSRDERIRKRIIKSIAPSIYGHEDIKTAIALSL
# FGGVSKNINDKHHIRGDINVLLLGDPGTAKSQILKYVEKTAHRSVFTTGQGASAVGLTASVRKDPVTREWTLEGGALVLADKGTCLIDEFDKMNDADR
# TSIHEAMEQQSISISKAGIVTTLQARCAIIAAANPVRGRYNPTIPFQQNVELTEPILSRFDVLCVVKDTVDPVMDELLARFVVGSHLRSHPSFDKQAD
# EMDVGTTVDEDVRFLLIPHESRYSFLESLFLRTSSASTLCMRAKRSSRSYTSSIKTKSRDCSLTSDINPKLLVHIQLLCVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/6
# CDS introns: 0/5
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g585
###
# start gene g586
Scaffold_10	AUGUSTUS	gene	962491	963558	0.99	+	.	g586
Scaffold_10	AUGUSTUS	transcript	962491	963558	0.99	+	.	g586.t1
Scaffold_10	AUGUSTUS	start_codon	962491	962493	.	+	0	transcript_id "g586.t1"; gene_id "g586";
Scaffold_10	AUGUSTUS	CDS	962491	963558	0.99	+	0	transcript_id "g586.t1"; gene_id "g586";
Scaffold_10	AUGUSTUS	stop_codon	963556	963558	.	+	0	transcript_id "g586.t1"; gene_id "g586";
# protein sequence = [MSKAALGYPTRQLGALGEGVYCVWVTPIPKLVVGDLAVWSRTASVSSIHVQGYWYCKSVDTTIPKRALPGEKVLYSLH
# GGAYTYDTAHPSGLNAKVIRHLLNLDCSINCAFAIDYRLSSESSNPFPAALVDALAGYYHLVHTIGFNPSNIIIEGSAGGGNLALALTRYLIDYYGHS
# EAADLPDVPGSLILLSPWADIGLAPVKARLEPATINNTRSWLVSDYMFGPQCPMTSYSQHVFLGPHGTDVAAINEYISPSSRHPLLDLDFEDFPRTFI
# SAGAAENLLPQIRLLKDRMVRDLGHDDKGSEKRGKVTYHEAPDASHHCLALPFAIQKDAQRELLAAISEWLVGSRRYVDLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g586
###
# start gene g587
Scaffold_10	AUGUSTUS	gene	967068	967832	0.71	-	.	g587
Scaffold_10	AUGUSTUS	transcript	967068	967832	0.71	-	.	g587.t1
Scaffold_10	AUGUSTUS	stop_codon	967068	967070	.	-	0	transcript_id "g587.t1"; gene_id "g587";
Scaffold_10	AUGUSTUS	CDS	967068	967832	0.71	-	0	transcript_id "g587.t1"; gene_id "g587";
Scaffold_10	AUGUSTUS	start_codon	967830	967832	.	-	0	transcript_id "g587.t1"; gene_id "g587";
# protein sequence = [MTPLTAFSDPSENRGSPPVFYTSETHVVNGTQVGINGKTPDERNTLDPQHQLVQSYYGFAYPALDRAANQTPLIPYFA
# STPTPPPLAFHSGYLSPPPPPRFLGPGPINTFSGGIPLERDPYAMQHMNMAWPIEMNGIPAYPSGFPLNANAPPPQDPYWLQGATPTGFSGSTASYFS
# PGVPCLPGRPPNDESSAPPSSSAQEGSPCSNDSPSPSHNVKTSLTSTSKKETSEHNQLNLVKIETGVDTRTTIMIKVC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g587
###
# start gene g588
Scaffold_10	AUGUSTUS	gene	973258	973674	0.8	+	.	g588
Scaffold_10	AUGUSTUS	transcript	973258	973674	0.8	+	.	g588.t1
Scaffold_10	AUGUSTUS	start_codon	973258	973260	.	+	0	transcript_id "g588.t1"; gene_id "g588";
Scaffold_10	AUGUSTUS	CDS	973258	973674	0.8	+	0	transcript_id "g588.t1"; gene_id "g588";
Scaffold_10	AUGUSTUS	stop_codon	973672	973674	.	+	0	transcript_id "g588.t1"; gene_id "g588";
# protein sequence = [MYAVTRSTTQEHSEDPLPIAYFQQQPPIPRKEARRHPMNVLVDALPLSNINLPEIMQPSKPALNESYSVAQFYMLDDA
# VTGVLALGSFSAANFSAFQHSLLDGLVKLKSLGATQLLVDVVSPLLVYDSLLSHLVTFHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g588
###
# start gene g589
Scaffold_10	AUGUSTUS	gene	975115	976320	0.45	-	.	g589
Scaffold_10	AUGUSTUS	transcript	975115	976320	0.45	-	.	g589.t1
Scaffold_10	AUGUSTUS	stop_codon	975115	975117	.	-	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_10	AUGUSTUS	CDS	975115	975876	1	-	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_10	AUGUSTUS	CDS	975968	976006	0.78	-	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_10	AUGUSTUS	CDS	976059	976085	0.55	-	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_10	AUGUSTUS	CDS	976141	976320	1	-	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_10	AUGUSTUS	start_codon	976318	976320	.	-	0	transcript_id "g589.t1"; gene_id "g589";
# protein sequence = [MQRDAEFEVESVDKSGGFIGSLYLNKTENAAVVLVKEGLASVHSYSADSLSWSKQLYDAESEAKSAKRNLWQDYDESA
# EKAAFKYSTQKVLFDSSSLDVSALLKRNVLGIASLEKLMRDFSLHHQGAVAVPAGFTPKSGDLVSAKFSDGAWYRAKIRRASPIKKEAEVTFIDYGNQ
# DSVAFKDIRPLAPQFRSLPGQVSFKQSDSGLVLCSTLGQAREARLSFIKLVDPESEYYAEAIDRFRQLCEGRKLVANIDAQEGPLLHLRLIDPQNPQS
# ATDPYECLNAELLRDGVATIDRKCNYLSAYPQLLRKLKDSVLEAKKDRAGMFEFGDVEEDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g589
###
# start gene g590
Scaffold_10	AUGUSTUS	gene	980477	982472	0.41	-	.	g590
Scaffold_10	AUGUSTUS	transcript	980477	982472	0.41	-	.	g590.t1
Scaffold_10	AUGUSTUS	stop_codon	980477	980479	.	-	0	transcript_id "g590.t1"; gene_id "g590";
Scaffold_10	AUGUSTUS	CDS	980477	981177	0.92	-	2	transcript_id "g590.t1"; gene_id "g590";
Scaffold_10	AUGUSTUS	CDS	981304	981863	0.41	-	1	transcript_id "g590.t1"; gene_id "g590";
Scaffold_10	AUGUSTUS	CDS	981919	982472	0.99	-	0	transcript_id "g590.t1"; gene_id "g590";
Scaffold_10	AUGUSTUS	start_codon	982470	982472	.	-	0	transcript_id "g590.t1"; gene_id "g590";
# protein sequence = [MNVYTLLELPKSSRGFSSISQSNGPRSGAQLRKVARTDTDLDSASASRSSTGVTSGSRRIQISGEDFRPSVLPDPFYS
# IRHNISVILTPFKQPSLIESYEAVSLRARYIVCVDGKGEGLYNLLKKELEVCMKDKVLESLMKNGEWISFMGRMCDWFHGAVGLLQSLLSPLDQAYVP
# TVKGTRSINALAYDIFNDRIFGHAGVSKQLRENLSTWIAADRQNSSGERASRSSVAHLLRHFIAHDVYFGSSQYEQYLLTSTEEYYVALVATLNHDMY
# DDPSAFFEIAYDLIEAEVERAEEVFPPQSRQSIKETTIRALFILPKVAGADNFNDNWLDRLKWLATPETVKAYVTSNRVPTMGKMYHLLSTLSSVSGI
# SDIVKVTSTGSAAPDLEEKMVPNLLKFREQAEGIIDVAFISKETNKRDGDFSQALSDGFISGFKTRRVKPAEMLAKYLDGMMRKGQAKFFESLSKSNS
# ADGDAIAGATQNAQDTLFHSHLLQVLGLYRFSEDKDVFRTFYHRQLTKRLLLGRSASSDAEVAMLRMLKEQYDSEFDMGETMFKDLALSTELMNEFRN
# HRLVNGMSDDNLDVRVLQRSAWPFDVSKKQILIPDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g590
###
# start gene g591
Scaffold_10	AUGUSTUS	gene	985155	985505	0.95	-	.	g591
Scaffold_10	AUGUSTUS	transcript	985155	985505	0.95	-	.	g591.t1
Scaffold_10	AUGUSTUS	stop_codon	985155	985157	.	-	0	transcript_id "g591.t1"; gene_id "g591";
Scaffold_10	AUGUSTUS	CDS	985155	985505	0.95	-	0	transcript_id "g591.t1"; gene_id "g591";
Scaffold_10	AUGUSTUS	start_codon	985503	985505	.	-	0	transcript_id "g591.t1"; gene_id "g591";
# protein sequence = [MKPEERAPSPEQAIVLSASNSLQENLGPSEEAEAEFAKELAKMVTDTSADSRKLDRKTAMALWDSSVLPPNLRKKRPE
# DGDEDEEIDANTMHFTVVTKRGNKQQVKHFASRAAPDC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g591
###
# start gene g592
Scaffold_10	AUGUSTUS	gene	990377	990906	0.3	+	.	g592
Scaffold_10	AUGUSTUS	transcript	990377	990906	0.3	+	.	g592.t1
Scaffold_10	AUGUSTUS	start_codon	990377	990379	.	+	0	transcript_id "g592.t1"; gene_id "g592";
Scaffold_10	AUGUSTUS	CDS	990377	990560	0.31	+	0	transcript_id "g592.t1"; gene_id "g592";
Scaffold_10	AUGUSTUS	CDS	990683	990906	0.88	+	2	transcript_id "g592.t1"; gene_id "g592";
Scaffold_10	AUGUSTUS	stop_codon	990904	990906	.	+	0	transcript_id "g592.t1"; gene_id "g592";
# protein sequence = [MPSSTQTPVWGTRATGVSNRILPPESTPVRAPSSIPRLPQFRSPEKTRQSAMLPGFEIPSWILDDDLGMDIDVPPKFS
# QISVPKDGPTSSPIRQDDDDVEMDEEDDDDTDEEFVDGIHFHWKAEVFPMLFGYTCG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g592
###
# start gene g593
Scaffold_10	AUGUSTUS	gene	998107	999210	0.51	+	.	g593
Scaffold_10	AUGUSTUS	transcript	998107	999210	0.51	+	.	g593.t1
Scaffold_10	AUGUSTUS	start_codon	998107	998109	.	+	0	transcript_id "g593.t1"; gene_id "g593";
Scaffold_10	AUGUSTUS	CDS	998107	998137	0.57	+	0	transcript_id "g593.t1"; gene_id "g593";
Scaffold_10	AUGUSTUS	CDS	998393	999210	0.62	+	2	transcript_id "g593.t1"; gene_id "g593";
Scaffold_10	AUGUSTUS	stop_codon	999208	999210	.	+	0	transcript_id "g593.t1"; gene_id "g593";
# protein sequence = [MFRDKETLPGYIFQFQSNSRVIIFGPSFRSSDPKTPEKRQFHKSKGYHRPEHHKHRDGHHQQRRPSISSILDEVGSFS
# EQDDRLSFETHRADEAISRAEYAETRLKDAFERLTEAEEARSQSEIHSIKVEEDLHRYREQVTRVQQLRDARIQIESLQQEKSASEREVEKIRVANLE
# LQSKFRSYQAKEQGREEGLKSGMLKQFHENRQYIWEAGFSDGFEEGREAGFKEGNRKGRKEGVREGREQGRREERRNALEAFDRFIREEREGEDDREV
# SRALSIRQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g593
###
# start gene g594
Scaffold_10	AUGUSTUS	gene	1001628	1002608	0.56	+	.	g594
Scaffold_10	AUGUSTUS	transcript	1001628	1002608	0.56	+	.	g594.t1
Scaffold_10	AUGUSTUS	start_codon	1001628	1001630	.	+	0	transcript_id "g594.t1"; gene_id "g594";
Scaffold_10	AUGUSTUS	CDS	1001628	1001917	0.97	+	0	transcript_id "g594.t1"; gene_id "g594";
Scaffold_10	AUGUSTUS	CDS	1002017	1002608	0.56	+	1	transcript_id "g594.t1"; gene_id "g594";
Scaffold_10	AUGUSTUS	stop_codon	1002606	1002608	.	+	0	transcript_id "g594.t1"; gene_id "g594";
# protein sequence = [MSVPPSPPGGRRKGPKSLPKLPLSAFTPPNSGTSEKFPLAPSPSTVHPETVIDANVVALNDDSSLSRWKIEAGPHLGS
# RIGGIVVLMSSGDEDSLSNLDNSDRPTSLPTSHPVSLTTVFTGVTTNSVENLKWALQQGRPVDIDIHADLTDDVFESFEDLLSKSMADVSPIPPIILC
# TFKLNFISNEFRPSHLSFIIANLLPPPNDLELPIVKLMNHPVYRKFQAQIAALSLFPQVSIKYLPPSWDVETPPTPSVMVASPIDDNKQKKEWKRRIK
# MYCKSKNLYLSINTSLSLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g594
###
# start gene g595
Scaffold_10	AUGUSTUS	gene	1003291	1004359	0.25	+	.	g595
Scaffold_10	AUGUSTUS	transcript	1003291	1004359	0.25	+	.	g595.t1
Scaffold_10	AUGUSTUS	start_codon	1003291	1003293	.	+	0	transcript_id "g595.t1"; gene_id "g595";
Scaffold_10	AUGUSTUS	CDS	1003291	1003308	0.25	+	0	transcript_id "g595.t1"; gene_id "g595";
Scaffold_10	AUGUSTUS	CDS	1003397	1004359	0.66	+	0	transcript_id "g595.t1"; gene_id "g595";
Scaffold_10	AUGUSTUS	stop_codon	1004357	1004359	.	+	0	transcript_id "g595.t1"; gene_id "g595";
# protein sequence = [MLIIAGKQKRSFTPTSDDDLQISPIPDDDTPPPPEKPVLRQALGFASAFGGISTSATLNTYQAKPTNPGNAKFLPGQT
# VFPASTTKKVKASGTKTKKTKKKDYATQTGRFRLTDWTSSPNNASASESPPAPTSSSTQPPPPAMSNVYSLMNNNHNGNGYGSNSYSSSTQASQISTM
# YSVPPPPIINNTTPYFSNTQHVSTTFTPTSAPPASVTGRFSATKLSTDTQIGSSKGKLLEKAKATPSTVIAKVKQKDKPAANSSNRSIDSADNLSRST
# TYYRRDYESQVDLDAMSTSGAGPSSPEIPSHLVPKGKSGTSSTQMSCQLYSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g595
###
# start gene g596
Scaffold_10	AUGUSTUS	gene	1004417	1005912	0.22	+	.	g596
Scaffold_10	AUGUSTUS	transcript	1004417	1005912	0.22	+	.	g596.t1
Scaffold_10	AUGUSTUS	start_codon	1004417	1004419	.	+	0	transcript_id "g596.t1"; gene_id "g596";
Scaffold_10	AUGUSTUS	CDS	1004417	1004548	0.67	+	0	transcript_id "g596.t1"; gene_id "g596";
Scaffold_10	AUGUSTUS	CDS	1004904	1005346	0.3	+	0	transcript_id "g596.t1"; gene_id "g596";
Scaffold_10	AUGUSTUS	CDS	1005441	1005477	0.61	+	1	transcript_id "g596.t1"; gene_id "g596";
Scaffold_10	AUGUSTUS	CDS	1005796	1005912	0.76	+	0	transcript_id "g596.t1"; gene_id "g596";
Scaffold_10	AUGUSTUS	stop_codon	1005910	1005912	.	+	0	transcript_id "g596.t1"; gene_id "g596";
# protein sequence = [MVTVLITDVRSGKEDHQLTEVIVPLKDTDPENPEYGFWANAQEVLPSPPRIPRDLRPSPDPDELSSYSHSHDSRDNKR
# DRKRYRSPSDGGDRLNGDYGSRSRSGSVSHQNKKRRKVDEEEVIEDSDADLFTTPLTGIGQEWNFDYESPTSDDDENLDAKIVERIDPALQMHPTPGL
# WESVFKVKARLPRVPARRVNTVELNISRAEVEAEKPSAQPSSQIPSAEGTVSTITDRGSSATLDSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g596
###
# start gene g597
Scaffold_10	AUGUSTUS	gene	1014965	1015612	0.79	-	.	g597
Scaffold_10	AUGUSTUS	transcript	1014965	1015612	0.79	-	.	g597.t1
Scaffold_10	AUGUSTUS	stop_codon	1014965	1014967	.	-	0	transcript_id "g597.t1"; gene_id "g597";
Scaffold_10	AUGUSTUS	CDS	1014965	1015612	0.79	-	0	transcript_id "g597.t1"; gene_id "g597";
Scaffold_10	AUGUSTUS	start_codon	1015610	1015612	.	-	0	transcript_id "g597.t1"; gene_id "g597";
# protein sequence = [MFASWDITTRLTFNKENNANNIRRDLQRAAHLRDPENIRSPSPVTSELTIQLEEWEKIRTNPIRFDSLKHLIPDFILE
# WMESRKIQEVKDKREREEDTSREAEEEKKKKRRLAEPLVPVVKNPLVPFQASFHDALYEIAHVSPIPLPFFSNDALQFISARAHSLPHKKFKSNDPRK
# SGYFIDIEALKKMLRIKYANDDQLEGLDYILFMSASTTT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g597
###
# start gene g598
Scaffold_10	AUGUSTUS	gene	1024096	1025151	0.69	+	.	g598
Scaffold_10	AUGUSTUS	transcript	1024096	1025151	0.69	+	.	g598.t1
Scaffold_10	AUGUSTUS	start_codon	1024096	1024098	.	+	0	transcript_id "g598.t1"; gene_id "g598";
Scaffold_10	AUGUSTUS	CDS	1024096	1025151	0.69	+	0	transcript_id "g598.t1"; gene_id "g598";
Scaffold_10	AUGUSTUS	stop_codon	1025149	1025151	.	+	0	transcript_id "g598.t1"; gene_id "g598";
# protein sequence = [MSWSVICCSYFDCLGHAVGRKNRHCLCETCEKKGRGGYAPDHTDDDIPSDSAFSDSDSDGTSSESDATSSGQEDSAVK
# RQVNLNERRTRRGVYAVVTKEEDHSDESDDEDGSVRPLAGASDIPSPGEMEMAESTSDLTSIPSSRAVSNCNQAGPSCLSSSTSELTPISRSTSSLSS
# LSSSEGTSSTHKSSSYQSIIATRRQKAQAEAAALVNASATLPEDSLSSVSSLRHLTQASLSVTPSKGKAKQKEQIRASSTPMRPDNLQATESGKMKDE
# DPRILRPRPSASVTTSEAAKEINSKTEIPRGPDGKPLPICATCRNILPVISVDHQIVWGLGLEKDSKKKKAKQDCPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g598
###
# start gene g599
Scaffold_10	AUGUSTUS	gene	1025183	1026517	0.31	+	.	g599
Scaffold_10	AUGUSTUS	transcript	1025183	1026517	0.31	+	.	g599.t1
Scaffold_10	AUGUSTUS	start_codon	1025183	1025185	.	+	0	transcript_id "g599.t1"; gene_id "g599";
Scaffold_10	AUGUSTUS	CDS	1025183	1026517	0.31	+	0	transcript_id "g599.t1"; gene_id "g599";
Scaffold_10	AUGUSTUS	stop_codon	1026515	1026517	.	+	0	transcript_id "g599.t1"; gene_id "g599";
# protein sequence = [MYNAHVSRCMRHYAIYGELWPRRVPLPGCTSTFNTTPREETTPIEFARKVTHKVLPVLDRKIAAVASSKRKRSSEGPV
# AEEENEHFAKKLKTSVDRTVPKKRIPIPLPEGQKRKRGRPRLMSVPVTVPALPPIVKMEDTEEPLHPNGFKSQGRRMNGRFERKLSSSSPQKGYDLDK
# SPKNALAGRAQRALEREKAKEIVERELLVKRGLSDGEIERITKKGKWDGSNPHDKEPPLKKVFPKRSTSFRSGNLFSRPNPMSFAARAWANPLVSDDA
# SSEDEKGPDTPEDSLSPPAIVKVELEDWDRGPSLIVTAPAVPPAYKPSPFSFARRRWSSLSASPIEEPKKSTSELRPNADARPPLNMERILGHNSSSI
# TTSSYEKWNPNHGTYLSEEEVRSHFPITGYKTSILINNSRIPQISLLYGSLRFTGARVTHDPCFSSIHIRQM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g599
###
# start gene g600
Scaffold_10	AUGUSTUS	gene	1029612	1030151	0.88	-	.	g600
Scaffold_10	AUGUSTUS	transcript	1029612	1030151	0.88	-	.	g600.t1
Scaffold_10	AUGUSTUS	stop_codon	1029612	1029614	.	-	0	transcript_id "g600.t1"; gene_id "g600";
Scaffold_10	AUGUSTUS	CDS	1029612	1030151	0.88	-	0	transcript_id "g600.t1"; gene_id "g600";
Scaffold_10	AUGUSTUS	start_codon	1030149	1030151	.	-	0	transcript_id "g600.t1"; gene_id "g600";
# protein sequence = [MRHSDLEDDEKAITTGSKRGRDSLASSETAKHPSKAEKKKNKKQKLQDGTAVAPGVAEKIVGKETEEKKVDVKATTKK
# TDAKTSAKKGEEKKTDGKKGEEKKDKTKPKEKEFPSGLKIQDATIGTGPMAKNGQLVSMRYIGKLANGKIFDQNTKGSPVIIFCLFFLKLYSPIFSSF
# PSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g600
###
# start gene g601
Scaffold_10	AUGUSTUS	gene	1032625	1033191	0.73	-	.	g601
Scaffold_10	AUGUSTUS	transcript	1032625	1033191	0.73	-	.	g601.t1
Scaffold_10	AUGUSTUS	stop_codon	1032625	1032627	.	-	0	transcript_id "g601.t1"; gene_id "g601";
Scaffold_10	AUGUSTUS	CDS	1032625	1033191	0.73	-	0	transcript_id "g601.t1"; gene_id "g601";
Scaffold_10	AUGUSTUS	start_codon	1033189	1033191	.	-	0	transcript_id "g601.t1"; gene_id "g601";
# protein sequence = [MSAKRRADAIARFSVPLESIPTVQVPQEISTSAVASRSRRVSRNASYNVDPTEDDDDEDFVMPSADNNYSDDDEVTAA
# ATWKSKGKGKAKRTQGDSENEDHFSFGDTQNQNNPPVMLISLKAGALGLNLTGELPTAFRGRFPTGLSWNQLRIMFICKDLFCSHLYSMTYLCHRMDP
# YVPVSLYQDSNH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g601
###
# start gene g602
Scaffold_10	AUGUSTUS	gene	1034783	1035196	0.9	-	.	g602
Scaffold_10	AUGUSTUS	transcript	1034783	1035196	0.9	-	.	g602.t1
Scaffold_10	AUGUSTUS	stop_codon	1034783	1034785	.	-	0	transcript_id "g602.t1"; gene_id "g602";
Scaffold_10	AUGUSTUS	CDS	1034783	1035196	0.9	-	0	transcript_id "g602.t1"; gene_id "g602";
Scaffold_10	AUGUSTUS	start_codon	1035194	1035196	.	-	0	transcript_id "g602.t1"; gene_id "g602";
# protein sequence = [MISLIIATKPDVPKNFSNATLVVVPLSVLSNWEKQIQDHCVGGTLTYCSYYGAQRAQLGAQALASHDVVFTTYQTVAG
# EHDHPRTQPANKKKKAEKALFGVRWKVDSLLNVSVIGLRSIYSVSSLMKVTQFGTQRPK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g602
###
# start gene g603
Scaffold_10	AUGUSTUS	gene	1036288	1037218	0.21	-	.	g603
Scaffold_10	AUGUSTUS	transcript	1036288	1037218	0.21	-	.	g603.t1
Scaffold_10	AUGUSTUS	stop_codon	1036288	1036290	.	-	0	transcript_id "g603.t1"; gene_id "g603";
Scaffold_10	AUGUSTUS	CDS	1036288	1036359	0.73	-	0	transcript_id "g603.t1"; gene_id "g603";
Scaffold_10	AUGUSTUS	CDS	1036478	1036862	0.81	-	1	transcript_id "g603.t1"; gene_id "g603";
Scaffold_10	AUGUSTUS	CDS	1037211	1037218	0.33	-	0	transcript_id "g603.t1"; gene_id "g603";
Scaffold_10	AUGUSTUS	start_codon	1037216	1037218	.	-	0	transcript_id "g603.t1"; gene_id "g603";
# protein sequence = [MPXRADQQKIRTALATRRVAVTDIPVSARPIIPPPPALVSTQKLTVANPKKRKESSSNVTTTTSSSQRAEIDAGEDEP
# MEEEVLDELIVSLNTQVVGIQYYKGVKPFNSKSLDFSNPILGLVGPGEEVILVIISRNAIRVDNIGIVPIVRAERR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g603
###
# start gene g604
Scaffold_10	AUGUSTUS	gene	1037918	1038388	0.99	+	.	g604
Scaffold_10	AUGUSTUS	transcript	1037918	1038388	0.99	+	.	g604.t1
Scaffold_10	AUGUSTUS	start_codon	1037918	1037920	.	+	0	transcript_id "g604.t1"; gene_id "g604";
Scaffold_10	AUGUSTUS	CDS	1037918	1038388	0.99	+	0	transcript_id "g604.t1"; gene_id "g604";
Scaffold_10	AUGUSTUS	stop_codon	1038386	1038388	.	+	0	transcript_id "g604.t1"; gene_id "g604";
# protein sequence = [MARSLKSGSGAFDIDDYLAKLVSFMGGHKLDNQNPDDPDADDALLDAPLDWDKIGRTTLAKSKRVPVVGFHVSYHFER
# SAISLRYQSTSHRLGPLSIEQKKRAPVKRAKLEKNKADERKPQELKEEDIARSVNETTKNVATVGPLPFISWPMHRPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g604
###
# start gene g605
Scaffold_10	AUGUSTUS	gene	1041223	1041645	0.72	+	.	g605
Scaffold_10	AUGUSTUS	transcript	1041223	1041645	0.72	+	.	g605.t1
Scaffold_10	AUGUSTUS	start_codon	1041223	1041225	.	+	0	transcript_id "g605.t1"; gene_id "g605";
Scaffold_10	AUGUSTUS	CDS	1041223	1041645	0.72	+	0	transcript_id "g605.t1"; gene_id "g605";
Scaffold_10	AUGUSTUS	stop_codon	1041643	1041645	.	+	0	transcript_id "g605.t1"; gene_id "g605";
# protein sequence = [MSFPQAEVHYSPSDAFEGTVIGFFRQPATDLGHAILDSISLVRSVVLKCYDAPAPVAMLDDSTINLAKDQLTESVQRA
# RAELEKFCDDLDKERRISSDESSDLPPRAFNLCLFMISLLQVDMIFFDATLSSECLSDGGRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g605
###
# start gene g606
Scaffold_10	AUGUSTUS	gene	1045889	1046332	0.95	-	.	g606
Scaffold_10	AUGUSTUS	transcript	1045889	1046332	0.95	-	.	g606.t1
Scaffold_10	AUGUSTUS	stop_codon	1045889	1045891	.	-	0	transcript_id "g606.t1"; gene_id "g606";
Scaffold_10	AUGUSTUS	CDS	1045889	1046332	0.95	-	0	transcript_id "g606.t1"; gene_id "g606";
Scaffold_10	AUGUSTUS	start_codon	1046330	1046332	.	-	0	transcript_id "g606.t1"; gene_id "g606";
# protein sequence = [MVGRRALPGLAATPTILPSKLPGGPPSPIKPFSIPRTESSEKSPVSPSLASKYPSEPTRPTTPSRHSRIPSTGNRATV
# MDVAQAFTEPQKQTEPEKASPEVIEAPASLPPLNPNFRQNINPPALSERRRSSYQEKYSAIVLPPLREK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g606
###
# start gene g607
Scaffold_10	AUGUSTUS	gene	1046756	1048789	0.53	-	.	g607
Scaffold_10	AUGUSTUS	transcript	1046756	1048789	0.53	-	.	g607.t1
Scaffold_10	AUGUSTUS	stop_codon	1046756	1046758	.	-	0	transcript_id "g607.t1"; gene_id "g607";
Scaffold_10	AUGUSTUS	CDS	1046756	1048455	0.88	-	2	transcript_id "g607.t1"; gene_id "g607";
Scaffold_10	AUGUSTUS	CDS	1048548	1048667	0.81	-	2	transcript_id "g607.t1"; gene_id "g607";
Scaffold_10	AUGUSTUS	CDS	1048732	1048789	0.73	-	0	transcript_id "g607.t1"; gene_id "g607";
Scaffold_10	AUGUSTUS	start_codon	1048787	1048789	.	-	0	transcript_id "g607.t1"; gene_id "g607";
# protein sequence = [MDSPSTPSRSRYSDLPKLDTIDWARKVRALQQQVDADEEAEYKRLQEEIAASRIARKRRTSSRESLSEVSQKSSTSDL
# KSIADRQQSQVEAFHKLNGTSSSSSPSNSDIKGSIATARAWMTSNSSNATASKPSGPISLAAFMGGRASGPILNKHAPQQDAHDPTQFEDRGRITAPH
# PVFGRGGVAMPGLTASSRFPLRDEIGSLPSVVSPKYGSDRAPTASLATLERTVTPANNGIPESSPSTTAPLVIRPRSASPTKIFDERPVPLQKTGGRD
# RTISIPSVSSYLSESGVLSRSSLSEKNGPRERTLSSSPSESPPVSAKFPVVKTSQERPVSTTNTGPRDRTISTPTGNSRVTFTVSDSTTSDNLPSLRR
# PISTSFTPPKPPIQATSLSKSPPHKSPVSIPSLAKPIRPDPKPSPQTSHMPVSPNTSPAFLKPPVQKEPTPSISRLQGRGFVQNMVKASHTFETPSSS
# TQTTPDRPVSASRKATVLERWHHNGSPSPVPASSPPVTSPKPLAMRKSFTLEPNSSLKATATGPSVTPKPVKTLPLTTKVDSEPIRPRRDSPPMLNSQ
# GTGLGSATTLVVFKPPADEEEVGSFGAVSELGVKHSAAQQKLPVVAGKPLTHVRSFW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g607
###
# start gene g608
Scaffold_10	AUGUSTUS	gene	1048990	1051407	0.62	+	.	g608
Scaffold_10	AUGUSTUS	transcript	1048990	1051407	0.62	+	.	g608.t1
Scaffold_10	AUGUSTUS	start_codon	1048990	1048992	.	+	0	transcript_id "g608.t1"; gene_id "g608";
Scaffold_10	AUGUSTUS	CDS	1048990	1049573	0.62	+	0	transcript_id "g608.t1"; gene_id "g608";
Scaffold_10	AUGUSTUS	CDS	1049631	1051407	0.83	+	1	transcript_id "g608.t1"; gene_id "g608";
Scaffold_10	AUGUSTUS	stop_codon	1051405	1051407	.	+	0	transcript_id "g608.t1"; gene_id "g608";
# protein sequence = [MTSIKTESIHEFNYPRSTSPTKESLRPNAHPYAIKTTSTALLSRSNSSSRTHDSSHHHYVPRTPPATSLGHRKHEGAH
# YRHRYSSSLSSDNIPRPLPVPPSPTKEAVNDSSGKHPRTFYNPVVFSAPLTLEDLPPNPKLWTPSQLCAYLSTALRVKSGESLQLPAPVARDIASFVR
# ESKITGRIFLRLDEKDLEAYGVNKLWKNALLKTSQNLRQNVLKGQIWGFVEELEGTSNGINFPSVGDAHSGSIDEDEDEDSTPHRRRRSASQPQTTRS
# RFIAGSTVKSSFNHPFPNGLPVYSSASSSSSSDDLFSPTGINPSVSFTTRSTSPNGHSHYMHDNRSRHGRVKGMVDSFERSSSFDEGDPTSAKLLQEI
# KGNRELDLEKLRKIRRERSGSTSSISNGSSGSSHSPTSSSDDGSEPGAFVGSPVEEYNVSTITSSRPLPNPPRNEIDDVLFVSGLEEPSIEELLAQEG
# RLEDAISSHTSLATLNSTFKNQTPSFAKGTFSISKGKGRAKKRGGVYAWEEEVEDLGAAAPGKTTAKRVFSQIPIPATMMSSASSAKDIFEELENVNG
# NIREDQLRSVDTSSPAPVKSGQGSGTHTPSRPLPEIPLHPSLVALPEPGDISFSPVSPKETDEETRLRASIAEITGLLQAFEVRLADVERKVDVLDVE
# LKELEVANLVRNKQQAEDGVQIKDETEQMTREDKVEEVNEPIFLSEWPIMRKVINRVFRFSPAGQLPSIGSRVFHSQYWRSPSHINPQTLSQLPPYVL
# LVGLGVCAVVLRVVARRLTGKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g608
###
# start gene g609
Scaffold_10	AUGUSTUS	gene	1058374	1060569	0.8	-	.	g609
Scaffold_10	AUGUSTUS	transcript	1058374	1060569	0.8	-	.	g609.t1
Scaffold_10	AUGUSTUS	stop_codon	1058374	1058376	.	-	0	transcript_id "g609.t1"; gene_id "g609";
Scaffold_10	AUGUSTUS	CDS	1058374	1060569	0.8	-	0	transcript_id "g609.t1"; gene_id "g609";
Scaffold_10	AUGUSTUS	start_codon	1060567	1060569	.	-	0	transcript_id "g609.t1"; gene_id "g609";
# protein sequence = [MPSPLPPALPPSPPASRSTSPVAGPSVQSAKRKSEVGLDTDRPKRSKTESTATTHRVSHLPPTHYLPRSELAEDGEVA
# EEPNSVSHPIQSRATPIHPSPDAPVTSFVPIRRPKRGHQHNVQLIPTLHEKYHQAGRKLKYSGDARFWSTYPPSHKEYRPIPNAPPPNSLYHIHGGMV
# AKLELMEALVMFVYSSWCKEYGRGGIYTDSWLTMEGFIKWCKAKWKPEEGSSDGEKAFYGLMYVLSSGSSMFVLMISSRHMFHAFIHARIVTQSQRKL
# RSDLERVTEATCQAVNAAISDAPSHSSSSLGAKSQSTPPMLPSPASIGAANSANSTPTNRDGTPISSEIRSASISSSSAISAPSQSSSSPSGPSIPLP
# FLPPQYRTGIPPSHITAAANTVSASFNLNQLATVNEVSYSLSVSIAEMQTAQVHLNFSIIARHFPRTFARMVHSTLKSTEEHEVDFEDDDGELFWPGQ
# SITGDGLGWLCYMGEAMVQEFGKQFDYKGLKGVVPKPDQYDPRIRPPLLEWLDSGRNTRTRKRTMASLSLFHVHLTLRAWVKIYLDRVYSAGRNLELI
# IRTQGLGRRASAIVLFSKSSRLGDRTLLFLEPISNGSYGPVCETTGPYTHSLHMSHGSLTICNGILRHLTNSLPPRLKKCSMAFRNLVYYLSHPANPK
# TTIPFSSAIIYMCTYLLPQVTLDYFVPQGDFLPPCDLDYGTVVGFFIYFVTAGPSPSEVARRWGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g609
###
# start gene g610
Scaffold_10	AUGUSTUS	gene	1068202	1068801	0.78	-	.	g610
Scaffold_10	AUGUSTUS	transcript	1068202	1068801	0.78	-	.	g610.t1
Scaffold_10	AUGUSTUS	stop_codon	1068202	1068204	.	-	0	transcript_id "g610.t1"; gene_id "g610";
Scaffold_10	AUGUSTUS	CDS	1068202	1068801	0.78	-	0	transcript_id "g610.t1"; gene_id "g610";
Scaffold_10	AUGUSTUS	start_codon	1068799	1068801	.	-	0	transcript_id "g610.t1"; gene_id "g610";
# protein sequence = [MTVTSTRTARALDVPQGWVDEKKLRVMREQWSRKVYRVADTQTDGKFVVLAPEDTHSESHGSMPSSPSSTSSLSSSSP
# PYASSLYSPTSLQLYRLSLPSSTSVSSSGPKLSFVRTLHGQMGPIAALALSDGRCVSFGVNGSIWVWDLESTTGTEVAAPMIEKSSDGALALTSAKRS
# VTFDERRIVTAVNDHVVERRFDI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g610
###
# start gene g611
Scaffold_10	AUGUSTUS	gene	1068873	1069528	0.18	-	.	g611
Scaffold_10	AUGUSTUS	transcript	1068873	1069528	0.18	-	.	g611.t1
Scaffold_10	AUGUSTUS	stop_codon	1068873	1068875	.	-	0	transcript_id "g611.t1"; gene_id "g611";
Scaffold_10	AUGUSTUS	CDS	1068873	1069412	0.45	-	0	transcript_id "g611.t1"; gene_id "g611";
Scaffold_10	AUGUSTUS	CDS	1069526	1069528	0.2	-	0	transcript_id "g611.t1"; gene_id "g611";
Scaffold_10	AUGUSTUS	start_codon	1069526	1069528	.	-	0	transcript_id "g611.t1"; gene_id "g611";
# protein sequence = [MSHMLLAGSLTITATSRSSSCPLIYVQHVAGEEHTLACPTTHIAHVTALALDQSAPLSGHIRLISFLSSGDFRVFSVD
# HNRPASSSTELSYTPLRRSSRVCPIIQAVYHHPLLITLSEAFTLSIYDLSSGGAVLTQTLSSFTSFPPTSLVLSTTSAATYKLVLAYAIPVYPAIGQL
# EPQN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g611
###
# start gene g612
Scaffold_10	AUGUSTUS	gene	1079260	1080119	0.25	-	.	g612
Scaffold_10	AUGUSTUS	transcript	1079260	1080119	0.25	-	.	g612.t1
Scaffold_10	AUGUSTUS	stop_codon	1079260	1079262	.	-	0	transcript_id "g612.t1"; gene_id "g612";
Scaffold_10	AUGUSTUS	CDS	1079260	1079438	0.84	-	2	transcript_id "g612.t1"; gene_id "g612";
Scaffold_10	AUGUSTUS	CDS	1079491	1079666	0.76	-	1	transcript_id "g612.t1"; gene_id "g612";
Scaffold_10	AUGUSTUS	CDS	1079722	1080119	0.27	-	0	transcript_id "g612.t1"; gene_id "g612";
Scaffold_10	AUGUSTUS	start_codon	1080117	1080119	.	-	0	transcript_id "g612.t1"; gene_id "g612";
# protein sequence = [MTGAKSALEVKDDMTFLDLTVRQIEHLNTTSRVDVPLILMTSFNTHDDTLRIIKKYANQQLRITTFNQSRYPRILKES
# LLPCPKRADDDKKNWYPPGHGDLYNALLHSGVLDQLLAEGKEYLFVSNSDNLGAVVDEKILQHMIESQAEFLMEVTDKTKADVKGGTLIDYDGSMRLL
# EIAQVPSEHVEDFKSVRKFKIFNTNNLWVNLKALKHIMEHEGMELDIIINPKMTDDGQGVIQVGVYACNPCVGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g612
###
# start gene g613
Scaffold_10	AUGUSTUS	gene	1089294	1089680	0.76	+	.	g613
Scaffold_10	AUGUSTUS	transcript	1089294	1089680	0.76	+	.	g613.t1
Scaffold_10	AUGUSTUS	start_codon	1089294	1089296	.	+	0	transcript_id "g613.t1"; gene_id "g613";
Scaffold_10	AUGUSTUS	CDS	1089294	1089680	0.76	+	0	transcript_id "g613.t1"; gene_id "g613";
Scaffold_10	AUGUSTUS	stop_codon	1089678	1089680	.	+	0	transcript_id "g613.t1"; gene_id "g613";
# protein sequence = [MWTTLHAEPSSTVDAESSHGDDELHSSPGHEPATGPENPLFTASESQVDFPYSQFQDINLDTDNGADEPLIGVDRLDE
# DSEEEEEVQETITPRVTRRSSTAYRGLSEIAARTSSSPAFSRVPSPLLLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g613
###
# start gene g614
Scaffold_10	AUGUSTUS	gene	1091085	1091981	0.25	+	.	g614
Scaffold_10	AUGUSTUS	transcript	1091085	1091981	0.25	+	.	g614.t1
Scaffold_10	AUGUSTUS	start_codon	1091085	1091087	.	+	0	transcript_id "g614.t1"; gene_id "g614";
Scaffold_10	AUGUSTUS	CDS	1091085	1091095	0.6	+	0	transcript_id "g614.t1"; gene_id "g614";
Scaffold_10	AUGUSTUS	CDS	1091236	1091374	0.43	+	1	transcript_id "g614.t1"; gene_id "g614";
Scaffold_10	AUGUSTUS	CDS	1091463	1091981	0.6	+	0	transcript_id "g614.t1"; gene_id "g614";
Scaffold_10	AUGUSTUS	stop_codon	1091979	1091981	.	+	0	transcript_id "g614.t1"; gene_id "g614";
# protein sequence = [MGKPKLRCPSNTAPFDAHDVGVVLESQGIQCAAVVVSDVAERFSHIYRGRGTTLGRITVGSDTSLPAPKADEFWDPSL
# ENLVDQISTKEPYEINPSGSLKIALLDFGAKANILRSLIRRGAAVTVLPWNYDFNAVRDQYDGLFLSNGPGDPTHCMEAALKLRPTLEEWSKPVFGIC
# MGHQIIGMAAGLDAYRMTFGNRGHNQPVLALASSGSIKAGRVYVTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g614
###
# start gene g615
Scaffold_10	AUGUSTUS	gene	1092471	1093595	0.19	+	.	g615
Scaffold_10	AUGUSTUS	transcript	1092471	1093595	0.19	+	.	g615.t1
Scaffold_10	AUGUSTUS	start_codon	1092471	1092473	.	+	0	transcript_id "g615.t1"; gene_id "g615";
Scaffold_10	AUGUSTUS	CDS	1092471	1092489	0.19	+	0	transcript_id "g615.t1"; gene_id "g615";
Scaffold_10	AUGUSTUS	CDS	1092610	1093595	0.74	+	2	transcript_id "g615.t1"; gene_id "g615";
Scaffold_10	AUGUSTUS	stop_codon	1093593	1093595	.	+	0	transcript_id "g615.t1"; gene_id "g615";
# protein sequence = [MAIKYTCNWPAGPFLGWVQEAGALTLVRIRSLKLNNQKHQSQNALEVARKDLTEVVSQAQKELHKFTGDASNEAQPSS
# SLSGPQSEELHPRSSSETLKPDAAVSSENASASSSTTSVQNLFSRLQTSLPPNVVSTVQANLPESLKHLSENTDFAPFRTTLTSEFQRLQGVTLTQAE
# EYVHKSEILLRDAMKEAGEVLRDAVKVLPPDENTSNNTGLIWDGSDMWMLPSESGDIPTSGKGKGKANSQNAVATRAEALLKRLRSDPNILKHDPEVD
# GGVYLQWIASDIDSADGGIDGTHWRAKIDETLQSEDGKTLQATFDILGVSCNEGSMQLSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g615
###
# start gene g616
Scaffold_10	AUGUSTUS	gene	1093761	1094060	0.94	+	.	g616
Scaffold_10	AUGUSTUS	transcript	1093761	1094060	0.94	+	.	g616.t1
Scaffold_10	AUGUSTUS	start_codon	1093761	1093763	.	+	0	transcript_id "g616.t1"; gene_id "g616";
Scaffold_10	AUGUSTUS	CDS	1093761	1094060	0.94	+	0	transcript_id "g616.t1"; gene_id "g616";
Scaffold_10	AUGUSTUS	stop_codon	1094058	1094060	.	+	0	transcript_id "g616.t1"; gene_id "g616";
# protein sequence = [MENEEDFSWEDDEADDSSASIATAAKNTEAPKVQPLDPDPVAKKSPDPSSQVNTPANTSPRVSSEESYDVVSGNVSAS
# GEGRKGNEAAEESSDGDSDWE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g616
###
# start gene g617
Scaffold_10	AUGUSTUS	gene	1102114	1104073	0.5	+	.	g617
Scaffold_10	AUGUSTUS	transcript	1102114	1104073	0.5	+	.	g617.t1
Scaffold_10	AUGUSTUS	start_codon	1102114	1102116	.	+	0	transcript_id "g617.t1"; gene_id "g617";
Scaffold_10	AUGUSTUS	CDS	1102114	1103287	0.93	+	0	transcript_id "g617.t1"; gene_id "g617";
Scaffold_10	AUGUSTUS	CDS	1103344	1103716	0.5	+	2	transcript_id "g617.t1"; gene_id "g617";
Scaffold_10	AUGUSTUS	CDS	1103776	1104073	0.7	+	1	transcript_id "g617.t1"; gene_id "g617";
Scaffold_10	AUGUSTUS	stop_codon	1104071	1104073	.	+	0	transcript_id "g617.t1"; gene_id "g617";
# protein sequence = [MPRRRASGLHPSKPPVYRRAQLNRVDSATLFFGGPAVTAAPSLASPSTSSRRVTTSISSDAADSPFTTATRPKILNRH
# SYSGSGPVTPSWRQMHPRSNDVSPTTSPPLSYTAGETESYDTDDDDSMMVDLPANSSFVLNITEDTPSPKRIGRTSEQISKKYTRDSGIALSDDDEDM
# EFVESSTSSERLSTMPRASTSVSSLYSDIEDGLVTPGVGPRSSSAWPDFVIVNGPDDGGCDASEQDVDAFILRTLAAAAKSTYEAKKAPGTPVKKSKV
# SYLARQRPWQSAMTHKVGFGAHAEEKMKKVPRKSMPASFPLVGRKHNRSVDPDTDSESDCDDSPSNRKEKYIGLGIGIPSLSKNGVSRNRWLMRRSSS
# GAFSSSSESAGTPTRNRPLGDCLRPSGSPHLSKQTSPTHRSKLSPARSASSSSNGSVTSPSILRQLPIAGDQKYRAPRFSTRTRRLSQPSHQQRPGRF
# EQQFVEIAEVGSGEFGKVLKVRTKDGNSDACFAVKKSKRFEGVKHRLRLREEVDTLQHLSHVTGGCGHPNILAFIDAWEEDEQLFIWTELCEGGNFAH
# FLWEYGRVFPRLDQARVWKIIVELSNVSVTPTIRSLAHDGFPDHRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g617
###
# start gene g618
Scaffold_10	AUGUSTUS	gene	1106733	1107985	0.33	+	.	g618
Scaffold_10	AUGUSTUS	transcript	1106733	1107985	0.33	+	.	g618.t1
Scaffold_10	AUGUSTUS	start_codon	1106733	1106735	.	+	0	transcript_id "g618.t1"; gene_id "g618";
Scaffold_10	AUGUSTUS	CDS	1106733	1107226	0.4	+	0	transcript_id "g618.t1"; gene_id "g618";
Scaffold_10	AUGUSTUS	CDS	1107748	1107985	0.91	+	1	transcript_id "g618.t1"; gene_id "g618";
Scaffold_10	AUGUSTUS	stop_codon	1107983	1107985	.	+	0	transcript_id "g618.t1"; gene_id "g618";
# protein sequence = [MPTHQGGMHVRHSSVDSRCYRLSPHGVTVSPSPSPMSAYHSSTIRSSLPDSRLVAFSTRPIYSPLPGPLPSPDYSFGV
# ASSMPSLASPDSERNSPDHSHGLLFQREDLDAEDDASYDGYSRFGSITSIGTSDSSNSAYYSDVGNCVDPLSGVELGDASHQQHRRGYPPIALPSASI
# EFAGNEYQFVAHQSSQDGANFGGSTSVAESYPVGVDAMGHEHFPNHGHNGSRDPDYNNFEDGSTSFM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g618
###
# start gene g619
Scaffold_10	AUGUSTUS	gene	1109424	1111013	0.46	-	.	g619
Scaffold_10	AUGUSTUS	transcript	1109424	1111013	0.46	-	.	g619.t1
Scaffold_10	AUGUSTUS	stop_codon	1109424	1109426	.	-	0	transcript_id "g619.t1"; gene_id "g619";
Scaffold_10	AUGUSTUS	CDS	1109424	1109458	0.63	-	2	transcript_id "g619.t1"; gene_id "g619";
Scaffold_10	AUGUSTUS	CDS	1109538	1109563	0.63	-	1	transcript_id "g619.t1"; gene_id "g619";
Scaffold_10	AUGUSTUS	CDS	1109647	1111013	0.46	-	0	transcript_id "g619.t1"; gene_id "g619";
Scaffold_10	AUGUSTUS	start_codon	1111011	1111013	.	-	0	transcript_id "g619.t1"; gene_id "g619";
# protein sequence = [MSEEYSSNSGSLTSGSVSSSLTGSINMSSGSSMMFGGSSIIFGNIGDAEATPVHRDRLELPLETETASLYPSFDRSRR
# VKAQDETSTSRTTRTRSPITEPLTNDPEWRQALLQLLARTEEAPSASRLPIFPYVSTSRPLQRHVCLHLIGWGFILRDDSLMAEVRRWERESEGDEGY
# ARAAAWLVFSGRYGGGAGVSNEGAVHGEGAIECLLRSEGAHFVFALSLLFSSTNSNPLPLRLDESHHMMSGVIAALVPFASATLTTPNSSSKLALPST
# LLEHYARLVNKLQDSYLRALLTHLTAISSSVTPSGEHWLEILHDEEDLLPFYERLALAFCFLDDTALTTYLRRCREHALGNGGDVDALIVTGLGTSEG
# REVVGLWLDRIGDVQSAALLGWTGLSSSLGRERIPKLASDLKTKGQTSIQDSQVTRWVETYRDFLDSVKLFHCRVEFDIERGEIYTNAEINLNVDLYV
# ANNLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g619
###
# start gene g620
Scaffold_10	AUGUSTUS	gene	1111202	1112518	0.59	-	.	g620
Scaffold_10	AUGUSTUS	transcript	1111202	1112518	0.59	-	.	g620.t1
Scaffold_10	AUGUSTUS	stop_codon	1111202	1111204	.	-	0	transcript_id "g620.t1"; gene_id "g620";
Scaffold_10	AUGUSTUS	CDS	1111202	1112518	0.59	-	0	transcript_id "g620.t1"; gene_id "g620";
Scaffold_10	AUGUSTUS	start_codon	1112516	1112518	.	-	0	transcript_id "g620.t1"; gene_id "g620";
# protein sequence = [MTAEFSPSRRGVLVTLAKDANYVRLWDVLEVDNSPISREVDNVDENIIKLQDKVPAGRKSWANLPWGSSGTSTESKNP
# SPIHEEEHREQSQHPMLILYNTRKGTFSYVYLILYNEYVLAFTRSIPNPLCSFAAVPPVYLSHKTISKIVVVSQLGEITVQSVHDAPQALAWSSRGDM
# LYGPLQSVDKDDVKIGFGVVHSYHEEQEETVKDEYIHDSQTSPSVTRPSTNQKPFPASEPNELHERGRPRNPITFREVPPSPALFGRGDAEGFPALSR
# PIIENPVSANLAATKPTDGRKEEEKKMTFSPAAALRVPLRPTNALLSPLNVSAIPYNEPSTPIKSQSSNPPTPKYQSMVNGGKASVVHAAANDISVLM
# RRRAIRGYSIRDPLRNASVIRELSRSGNPGAGVEFEEPSVFRSKESEMLADLWEWIHRNIIPAPFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g620
###
# start gene g621
Scaffold_10	AUGUSTUS	gene	1116705	1117656	0.45	+	.	g621
Scaffold_10	AUGUSTUS	transcript	1116705	1117656	0.45	+	.	g621.t1
Scaffold_10	AUGUSTUS	start_codon	1116705	1116707	.	+	0	transcript_id "g621.t1"; gene_id "g621";
Scaffold_10	AUGUSTUS	CDS	1116705	1116743	0.45	+	0	transcript_id "g621.t1"; gene_id "g621";
Scaffold_10	AUGUSTUS	CDS	1116811	1117656	0.46	+	0	transcript_id "g621.t1"; gene_id "g621";
Scaffold_10	AUGUSTUS	stop_codon	1117654	1117656	.	+	0	transcript_id "g621.t1"; gene_id "g621";
# protein sequence = [MGANHSDKAKRGLMHEKATNVYESQANSTSDEMNVAQEDMDALHTLEMFAGYTKLLMKDMASNPRVFSDKADSRSLNP
# DSNNGSFVGSGPQRNDLSQEQYQANFLPRSSSFRTVMPSATTYHDTDPDASPSIEHPHLAVSFLRTNEPVDQVLNHQHPYSAHTGHEHNFVSSSSIAP
# TVYSYENDRHAAHSFGMSSQVAYGMNSYSQYVDHGEHWTDTRSQYDSSVYPLFKREDKFDNQSSSYPDSHFWPPMSERNDTSQHPGRLPLATTVGAMN
# FQWAELVQDEGLTVLQRVQM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g621
###
# start gene g622
Scaffold_10	AUGUSTUS	gene	1117749	1118069	0.87	-	.	g622
Scaffold_10	AUGUSTUS	transcript	1117749	1118069	0.87	-	.	g622.t1
Scaffold_10	AUGUSTUS	stop_codon	1117749	1117751	.	-	0	transcript_id "g622.t1"; gene_id "g622";
Scaffold_10	AUGUSTUS	CDS	1117749	1118069	0.87	-	0	transcript_id "g622.t1"; gene_id "g622";
Scaffold_10	AUGUSTUS	start_codon	1118067	1118069	.	-	0	transcript_id "g622.t1"; gene_id "g622";
# protein sequence = [MTQIQEQLTLVRSSLVPSLEKFLQTLPTQSNTTIPFDSTSNPPTSPASIHKEHARLSEMLLQSLLTLDAITVDGEWVQ
# ARQERKTAVREVQGYLDQLDAAWNSRVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g622
###
# start gene g623
Scaffold_10	AUGUSTUS	gene	1118694	1119050	0.17	+	.	g623
Scaffold_10	AUGUSTUS	transcript	1118694	1119050	0.17	+	.	g623.t1
Scaffold_10	AUGUSTUS	start_codon	1118694	1118696	.	+	0	transcript_id "g623.t1"; gene_id "g623";
Scaffold_10	AUGUSTUS	CDS	1118694	1119050	0.17	+	0	transcript_id "g623.t1"; gene_id "g623";
Scaffold_10	AUGUSTUS	stop_codon	1119048	1119050	.	+	0	transcript_id "g623.t1"; gene_id "g623";
# protein sequence = [MARRNNNDVDDTAALLQQASLASPSSHNLPPNFRTAASYPPPNLPKSATPAAGGIAARRRSKPNFSLKDINGNLGGGA
# SAAGLGQGRPSFAANDSRRGPLAHAPPGSLFSSFANVMYV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g623
###
# start gene g624
Scaffold_10	AUGUSTUS	gene	1119740	1120445	0.53	+	.	g624
Scaffold_10	AUGUSTUS	transcript	1119740	1120445	0.53	+	.	g624.t1
Scaffold_10	AUGUSTUS	start_codon	1119740	1119742	.	+	0	transcript_id "g624.t1"; gene_id "g624";
Scaffold_10	AUGUSTUS	CDS	1119740	1120051	0.53	+	0	transcript_id "g624.t1"; gene_id "g624";
Scaffold_10	AUGUSTUS	CDS	1120104	1120445	1	+	0	transcript_id "g624.t1"; gene_id "g624";
Scaffold_10	AUGUSTUS	stop_codon	1120443	1120445	.	+	0	transcript_id "g624.t1"; gene_id "g624";
# protein sequence = [MCLSIIAVRSNYVILEYLVNWRRVLPKLTSGAKHTWLYVSVLSVIPQLLITTHTQPERISGEHQNTVGTYTVSSDVWS
# LGLSIIEIAIGRYPYPPEAYSNILAQLKTIIQDDAPTLPSDRYSPEACDWVASCLVKVPDGRATYAELLEHDFIQRDEAKANAENGDAVDMAGWLSKA
# LQFREAKIAHVQALAAAALAPSAPPGHPVLSAPATTRIRLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g624
###
# start gene g625
Scaffold_10	AUGUSTUS	gene	1122909	1124185	0.27	+	.	g625
Scaffold_10	AUGUSTUS	transcript	1122909	1124185	0.27	+	.	g625.t1
Scaffold_10	AUGUSTUS	start_codon	1122909	1122911	.	+	0	transcript_id "g625.t1"; gene_id "g625";
Scaffold_10	AUGUSTUS	CDS	1122909	1122930	0.37	+	0	transcript_id "g625.t1"; gene_id "g625";
Scaffold_10	AUGUSTUS	CDS	1123155	1124185	0.43	+	2	transcript_id "g625.t1"; gene_id "g625";
Scaffold_10	AUGUSTUS	stop_codon	1124183	1124185	.	+	0	transcript_id "g625.t1"; gene_id "g625";
# protein sequence = [MGAKFTPNFASRLGERGLEPSIEDPAELDRLEEEDADQEAQEQGEPVSVAVSASRTQDSARDAREAADIVMGADNDPY
# LGQENEGHAMVVDVEPEPAKHTPRTPVSSKSKPRPRPQAIHRKDDDDNDLNSSPSKMPKQSPPKSSSRRSRIVETDEPQMDSDYHVSSEKENRHVSNR
# DEEEQEMEKRPVASKKKVKVQDPTNFSSRWRTNTAGSSDSEGDFDADLPPVTKANVKNNIKAATKRARYASGDESDNGGNDISEKEDSPESEDDDVVT
# PSKKKRVQPSRPNAVRPKARGRETEDSDVPRRVSMKANAVPKAKPKTVPSPKQLSVVMPRLANPLLLQVLPRLRKH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g625
###
# start gene g626
Scaffold_10	AUGUSTUS	gene	1124363	1126063	0.13	+	.	g626
Scaffold_10	AUGUSTUS	transcript	1124363	1126063	0.13	+	.	g626.t1
Scaffold_10	AUGUSTUS	start_codon	1124363	1124365	.	+	0	transcript_id "g626.t1"; gene_id "g626";
Scaffold_10	AUGUSTUS	CDS	1124363	1124759	0.25	+	0	transcript_id "g626.t1"; gene_id "g626";
Scaffold_10	AUGUSTUS	CDS	1124905	1125039	0.48	+	2	transcript_id "g626.t1"; gene_id "g626";
Scaffold_10	AUGUSTUS	CDS	1125417	1126063	0.76	+	2	transcript_id "g626.t1"; gene_id "g626";
Scaffold_10	AUGUSTUS	stop_codon	1126061	1126063	.	+	0	transcript_id "g626.t1"; gene_id "g626";
# protein sequence = [MKKHRRHSSSSVSAFPRDRDEPDQEEEKPAANGKSKTKPKEDFGVIAGKKRKVSSRDMREVEESDMPADAASPPKKVR
# KRKPGSVRVMTTQVNLTDATKKVLWSRLTFRSLCLSVSQAMEKLGAKFVTKPSESLDFQLIFIAAEEPFFLKDRGKWDIDLKKSLEEAKSQSTLYWPT
# GYDLGANTQQTFSSATMSEADLGYSEGSFDLPRWQTHVDLSSSAQAAHSAQAAYYASPLPPPPPSASTNRPPRLNALVDQDYSPQPLSRSASLGGIEI
# SDVTTYQTSSNQRRCQHIHPQHPTLLPSGPEISVEDTKHGSHVGSILASAVSISTEPFKESFERIRDFAISKSASAQKTVHIQSTDSAQLPSRPNARR
# SNATAAPSSSARPSPCSWPN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g626
###
# start gene g627
Scaffold_10	AUGUSTUS	gene	1127908	1129385	0.49	+	.	g627
Scaffold_10	AUGUSTUS	transcript	1127908	1129385	0.49	+	.	g627.t1
Scaffold_10	AUGUSTUS	start_codon	1127908	1127910	.	+	0	transcript_id "g627.t1"; gene_id "g627";
Scaffold_10	AUGUSTUS	CDS	1127908	1127910	0.49	+	0	transcript_id "g627.t1"; gene_id "g627";
Scaffold_10	AUGUSTUS	CDS	1127994	1129385	0.82	+	0	transcript_id "g627.t1"; gene_id "g627";
Scaffold_10	AUGUSTUS	stop_codon	1129383	1129385	.	+	0	transcript_id "g627.t1"; gene_id "g627";
# protein sequence = [MVYTAQAQAQAQQQREYRNPYLAPGPAGQNQSQPPSSQVPSHDGYGLPTNPAQLTQPPPPVHHRLMHQTSTGHLNMNS
# SSSMPQFPGSGSGGGAGSNSYYTSNSMQSSSQQSPASSTSSRGRANTINQMDAAIPPALARLQHMNQDVIQGRNALTPVLNRDDAMREWERRQSGKGG
# PPPPNAYSRELEYLQQQAELAASGAVGGGQWGGSGTGMGGMFPSIGRYHAGHTQAPSKLSHGYSANLPPILVDDSESASASSGNARRDAIMSNVRSAA
# RGDGAGAALYGGAGSVISSPPQAYTGGTATPGNRYTLTYNYSQPPLQSTGVPLSSSHPPSLQPQHNSPQTPFDSVDRRTDIGSMYVPMQTDVSGPGGY
# GPPSGSYSNHGSSAMNARHVGASAQNVAPSFYGAGVAGVLPPMVGTQSMPGSLGSINPLQQQQQRPAFGEMSPSSGSLKDSRRASGMDAWPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g627
###
# start gene g628
Scaffold_10	AUGUSTUS	gene	1132212	1132742	0.37	+	.	g628
Scaffold_10	AUGUSTUS	transcript	1132212	1132742	0.37	+	.	g628.t1
Scaffold_10	AUGUSTUS	start_codon	1132212	1132214	.	+	0	transcript_id "g628.t1"; gene_id "g628";
Scaffold_10	AUGUSTUS	CDS	1132212	1132742	0.37	+	0	transcript_id "g628.t1"; gene_id "g628";
Scaffold_10	AUGUSTUS	stop_codon	1132740	1132742	.	+	0	transcript_id "g628.t1"; gene_id "g628";
# protein sequence = [MRMDAIQEALAEKKPDSRANGSNQFTTPSSNLRAQAVKTPGQLRRDEEINRALGTPTRQSTQLQRNDANVFQSSQPPP
# ANFKLTPLSQESSIHSDEDDPFDNLPLTPPTSQRYKRSRDQESNEEFEPDSFRSSPSRNKGKKKANLAHDWVRYIRVRICEGNKHYENIDHPDYFYER]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g628
###
# start gene g629
Scaffold_10	AUGUSTUS	gene	1138003	1139053	0.83	+	.	g629
Scaffold_10	AUGUSTUS	transcript	1138003	1139053	0.83	+	.	g629.t1
Scaffold_10	AUGUSTUS	start_codon	1138003	1138005	.	+	0	transcript_id "g629.t1"; gene_id "g629";
Scaffold_10	AUGUSTUS	CDS	1138003	1138284	0.83	+	0	transcript_id "g629.t1"; gene_id "g629";
Scaffold_10	AUGUSTUS	CDS	1138337	1139053	0.88	+	0	transcript_id "g629.t1"; gene_id "g629";
Scaffold_10	AUGUSTUS	stop_codon	1139051	1139053	.	+	0	transcript_id "g629.t1"; gene_id "g629";
# protein sequence = [MAQTSWLSSAIHGERTSRSDLYENSSSSSVAPRPIPPPSDISRWDLAEILNPTSAFRERKLSMDFTSGSAGPQHSVYG
# QSEIDHPFSALHTSDPDHSGYDLFSHSAPNSFGARYRNASSSSLGGNYAGLNGDSLYSQQSFNDSVPSFGSSNGNPYDMIHSLPSSYGSGKVSPLTPS
# DPVGPLHPPFPVGGKDFTSSNFPDFTPDRRLSSVSSGTYGSDLSDDFAMNNGNLPFPSSALQHFSERLGRFQSGANSGISPISPTAHSPDILRGVAPH
# ATHGYRPDNGMNGFDEMQYMGNPHGDYRMSGVDEQLARVGLRGPSIMGTSSDLSTFIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g629
###
# start gene g630
Scaffold_10	AUGUSTUS	gene	1139972	1141298	0.28	+	.	g630
Scaffold_10	AUGUSTUS	transcript	1139972	1141298	0.28	+	.	g630.t1
Scaffold_10	AUGUSTUS	start_codon	1139972	1139974	.	+	0	transcript_id "g630.t1"; gene_id "g630";
Scaffold_10	AUGUSTUS	CDS	1139972	1140770	0.86	+	0	transcript_id "g630.t1"; gene_id "g630";
Scaffold_10	AUGUSTUS	CDS	1140827	1140950	0.28	+	2	transcript_id "g630.t1"; gene_id "g630";
Scaffold_10	AUGUSTUS	CDS	1141007	1141298	0.7	+	1	transcript_id "g630.t1"; gene_id "g630";
Scaffold_10	AUGUSTUS	stop_codon	1141296	1141298	.	+	0	transcript_id "g630.t1"; gene_id "g630";
# protein sequence = [MYIVDVNKPTGGIDVPPPPALQPDYPSPPPNAIPFTNNGSQIPIYYNQTVVLQCLTSGVVSPVLIIRKVDHQTTVVGG
# GLQEGAKGVADHFCAPGEVCGDPVSQLHKIAFEVYDGAKGMPEPGTPGITGAFLSCMGEKVNTYRPIDGRQWNSGGSNSGNSPVASPVSSTPVSSNGS
# EYFGHNLDSAPESPSSPDFLSNDGGRVKKKRGTSSAGGPSKNPTKGRRRPSSAGSVTSGRRGSTSDSGAASGALWQVDIGETSVWTIVGTDQIRYNFY
# VPPVLFDAQHAPQTGSFPIPSKPVTPFPGVVKYLPPDRAAEAPKANCSSSRSMLSKPNPHASKMLTVYGENFSKSDPVSVFFGHEPSPYVEVRCTEVL
# GCLPPEQQIAKRRPIILIRPDGVVFPSNTMYP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g630
###
# start gene g631
Scaffold_10	AUGUSTUS	gene	1142927	1146322	0.2	-	.	g631
Scaffold_10	AUGUSTUS	transcript	1142927	1146322	0.2	-	.	g631.t1
Scaffold_10	AUGUSTUS	stop_codon	1142927	1142929	.	-	0	transcript_id "g631.t1"; gene_id "g631";
Scaffold_10	AUGUSTUS	CDS	1142927	1143238	0.78	-	0	transcript_id "g631.t1"; gene_id "g631";
Scaffold_10	AUGUSTUS	CDS	1143758	1144346	0.68	-	1	transcript_id "g631.t1"; gene_id "g631";
Scaffold_10	AUGUSTUS	CDS	1145000	1145412	0.31	-	0	transcript_id "g631.t1"; gene_id "g631";
Scaffold_10	AUGUSTUS	CDS	1145507	1146322	0.41	-	0	transcript_id "g631.t1"; gene_id "g631";
Scaffold_10	AUGUSTUS	start_codon	1146320	1146322	.	-	0	transcript_id "g631.t1"; gene_id "g631";
# protein sequence = [MIKATEVEIPSGLTTSKTVHALENFSPPSQLSQKYVITPLKLRLVVLVALLRNMISQRRGQPGSKAIVFLSCTDAVDF
# LWKMLGGSLMDGEDIERAEQESNVEDNSDDVDEGQIESKSEQISLKSSLLPDTSVFRLHGSLPTQTRLATLRGFSGSSKRTAPFSVLLCTSVASRGLD
# LPLVWSVIQYDLPTEGGATEYVHRVGRTARAGKGGEAWSFVSPSEVAWVQWVEGKMRSDSSESEKQNISLIPVTPESVLKLGFGGKGSEYEERATQNA
# ILARKAFMSHMRAYATHPSAEKHIFHIRHLHLGHLAKAFALRETPKAATSASGGKSRRLNTAKDGGVTKKREKDRAANIKGEKWEITHSGDAERRMRD
# IVRAQGRHSKKGGVMMSSGSSEFQIAGGYDLEKMVGGINDVKEEEEVDNKKPEEKLEFFVHWDQFNKRLDDWVSGTRILLHRDLEWPRPKAPPVKKAL
# NGTPKVPPGKAPPGKAHRPNNLLKAATSNAALGASPAPTPQHSQLFSISRASPSPAPPSLKRKVPHDEEEEPTEEAYDFDADADGDMEIDGDGDLETF
# DLSLTDTGPDSQEPPPFSAFSKEQEIEKLRTSGSLTQSESAENYNVACILTLPHHQRHGYGKLLIEFSYELSKKEGKLGSPEKPLSDLGLLSYRAYWS
# EVVVELLMEWDGDISIDEVAQKTSITHADVMNTYVMCLSTACS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g631
###
# start gene g632
Scaffold_10	AUGUSTUS	gene	1151307	1151642	0.89	+	.	g632
Scaffold_10	AUGUSTUS	transcript	1151307	1151642	0.89	+	.	g632.t1
Scaffold_10	AUGUSTUS	start_codon	1151307	1151309	.	+	0	transcript_id "g632.t1"; gene_id "g632";
Scaffold_10	AUGUSTUS	CDS	1151307	1151642	0.89	+	0	transcript_id "g632.t1"; gene_id "g632";
Scaffold_10	AUGUSTUS	stop_codon	1151640	1151642	.	+	0	transcript_id "g632.t1"; gene_id "g632";
# protein sequence = [MRVSQKTVPPKSPVKPGKGVKFVPAAGRMPVAHGKTNVEPEPRVKIEDKLDDAQLDRLATGDLLTLKPQRSVSSISPF
# PSLILLLAASKNRKSCYYRVAERYNPNHASSER]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g632
###
# start gene g633
Scaffold_10	AUGUSTUS	gene	1153695	1154593	1	+	.	g633
Scaffold_10	AUGUSTUS	transcript	1153695	1154593	1	+	.	g633.t1
Scaffold_10	AUGUSTUS	start_codon	1153695	1153697	.	+	0	transcript_id "g633.t1"; gene_id "g633";
Scaffold_10	AUGUSTUS	CDS	1153695	1154060	1	+	0	transcript_id "g633.t1"; gene_id "g633";
Scaffold_10	AUGUSTUS	CDS	1154114	1154593	1	+	0	transcript_id "g633.t1"; gene_id "g633";
Scaffold_10	AUGUSTUS	stop_codon	1154591	1154593	.	+	0	transcript_id "g633.t1"; gene_id "g633";
# protein sequence = [MSSDLATDTSTLDEYHPQFCSPEADIVLRSLEGTLYRVPSFVLRSASGFWNALLSISPQTPASTSSPLPTSQHNDILE
# PMLRLMSGLPIPSWTPDPESADSDEKCISEIETFYYSRNLGMLQPLRLYALATHFGWVPEAKVASKHSLGLNLYDDEHEEVLKRLSAKDLLILLRLHR
# ARRDQMKVFLDDQDVFTLGNSESSRCVACNNEVDNSAWRELKARIFQEMDRCSKGDFVGSWEMEEWKETDRCWKVKCGKCTALLYHKGQTIRKMKEGL
# SILPDTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g633
###
# start gene g634
Scaffold_10	AUGUSTUS	gene	1158784	1159110	0.66	+	.	g634
Scaffold_10	AUGUSTUS	transcript	1158784	1159110	0.66	+	.	g634.t1
Scaffold_10	AUGUSTUS	start_codon	1158784	1158786	.	+	0	transcript_id "g634.t1"; gene_id "g634";
Scaffold_10	AUGUSTUS	CDS	1158784	1159110	0.66	+	0	transcript_id "g634.t1"; gene_id "g634";
Scaffold_10	AUGUSTUS	stop_codon	1159108	1159110	.	+	0	transcript_id "g634.t1"; gene_id "g634";
# protein sequence = [MKEKEYVVNHVYVAVISESITAIMADKGGGAYGTKAADTDFRKKWDKEEYTERAKKRDLEEKERMQENEERMKQGENI
# PYLYILSLMHICQERGPEKGQNRISQSPQN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g634
###
# start gene g635
Scaffold_10	AUGUSTUS	gene	1159161	1159633	0.75	+	.	g635
Scaffold_10	AUGUSTUS	transcript	1159161	1159633	0.75	+	.	g635.t1
Scaffold_10	AUGUSTUS	start_codon	1159161	1159163	.	+	0	transcript_id "g635.t1"; gene_id "g635";
Scaffold_10	AUGUSTUS	CDS	1159161	1159278	0.75	+	0	transcript_id "g635.t1"; gene_id "g635";
Scaffold_10	AUGUSTUS	CDS	1159335	1159633	1	+	2	transcript_id "g635.t1"; gene_id "g635";
Scaffold_10	AUGUSTUS	stop_codon	1159631	1159633	.	+	0	transcript_id "g635.t1"; gene_id "g635";
# protein sequence = [MVVQNPGGRGSGQPGFHCEACNRTYKDTTGYLDHINSRAHLRALGQSTRLERSTLEQVRARIALLREKTKEATNAKAY
# DFDQRLAEVRAKETAIREEKKAQKKAQKEKLLVNALAANNPENDEMAKLMGFGGFGSSKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g635
###
# start gene g636
Scaffold_10	AUGUSTUS	gene	1159709	1160389	1	-	.	g636
Scaffold_10	AUGUSTUS	transcript	1159709	1160389	1	-	.	g636.t1
Scaffold_10	AUGUSTUS	stop_codon	1159709	1159711	.	-	0	transcript_id "g636.t1"; gene_id "g636";
Scaffold_10	AUGUSTUS	CDS	1159709	1160389	1	-	0	transcript_id "g636.t1"; gene_id "g636";
Scaffold_10	AUGUSTUS	start_codon	1160387	1160389	.	-	0	transcript_id "g636.t1"; gene_id "g636";
# protein sequence = [MELLVFHPDEQYLADIRPLQRYIESELNVRDVIFSSDERLSGVRYRAVADWGVLGKKLRKDIGRVKRALPDVSSDRVK
# EYISTGKMDVDGITLVEGDLAVQRYLELPSSGIGQYGTHTDNDVVVRLDIQIHADLQGEWLARELINRIQKLRKKAGLQATDDVELYYSLEGSTGAAL
# LNAMEQYAEFIRKIVGNVPINDNQRKSGTELIREEQEIVDVKFELILVRP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g636
###
# start gene g637
Scaffold_10	AUGUSTUS	gene	1162272	1164465	0.2	-	.	g637
Scaffold_10	AUGUSTUS	transcript	1162272	1164465	0.2	-	.	g637.t1
Scaffold_10	AUGUSTUS	stop_codon	1162272	1162274	.	-	0	transcript_id "g637.t1"; gene_id "g637";
Scaffold_10	AUGUSTUS	CDS	1162272	1162508	0.99	-	0	transcript_id "g637.t1"; gene_id "g637";
Scaffold_10	AUGUSTUS	CDS	1162568	1162854	0.96	-	2	transcript_id "g637.t1"; gene_id "g637";
Scaffold_10	AUGUSTUS	CDS	1162907	1163277	0.71	-	1	transcript_id "g637.t1"; gene_id "g637";
Scaffold_10	AUGUSTUS	CDS	1164023	1164465	0.25	-	0	transcript_id "g637.t1"; gene_id "g637";
Scaffold_10	AUGUSTUS	start_codon	1164463	1164465	.	-	0	transcript_id "g637.t1"; gene_id "g637";
# protein sequence = [MIGVARKLSLETEVALEVEGRDDIAPVLSGWEVEAAETELNTGSFVGLSVDFRFRAMIVVSSALNFSRSPSATGLGEM
# KVKLWPLSSPKRAIFSFTWDAPSLLQNNAVPKLNHYNFDRKGVVVHEVSACGTRTEGAFGRFESIVSKSLFGWDTHGLPVEHEIDKKFGITGKDDVMA
# MGIDKYNAECRNIVMRYSNEWRNTVERMGRWIDFDNDYKTLNISFMESVWWAFKELFKKGLVYRGLRVMPYSTGLTTPLSNFEAGLDYRDINDPAVTV
# AFPLVDDPATSLLAWTTTPWTLPSNLALCVHPDFTYIKIHDAEKDQNFILHENLLSTLYKDPKKAKYKKLGQFQGSDMKGWRYIPLFEYFTEQFEDKA
# FRVVVDTYVTASDGTGIVHQAPAFGEDDHRIAIANGVLSPEEMPPCPIDDKGNFTKEVPDFAGENFKVHNFLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g637
###
# start gene g638
Scaffold_10	AUGUSTUS	gene	1169368	1170147	0.95	+	.	g638
Scaffold_10	AUGUSTUS	transcript	1169368	1170147	0.95	+	.	g638.t1
Scaffold_10	AUGUSTUS	start_codon	1169368	1169370	.	+	0	transcript_id "g638.t1"; gene_id "g638";
Scaffold_10	AUGUSTUS	CDS	1169368	1170147	0.95	+	0	transcript_id "g638.t1"; gene_id "g638";
Scaffold_10	AUGUSTUS	stop_codon	1170145	1170147	.	+	0	transcript_id "g638.t1"; gene_id "g638";
# protein sequence = [MNILRSQAFSVLRRPLCRRLATTRPFVPPVQAQLVFHDTLFAPGAKELDDNTVDALEAETNEREFEDDDFDANNFQDK
# AHPDSPNFYTGRSSYYDNIVELQNAISRTRGTLQRLHLLPLPEFAWKCLKPMPTVWKTPEEMTTDFETAMTISRYRKVTALLNELNEYLRIATTAGYA
# DVADRIGSIISIFESGKKEAFLARGVRKPVQLDQYGRSYTFGKRKTSAARVWMIPVKPLSHESGSDVNVEEAFGLSDKPRRPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g638
###
# start gene g639
Scaffold_10	AUGUSTUS	gene	1171769	1172107	0.46	-	.	g639
Scaffold_10	AUGUSTUS	transcript	1171769	1172107	0.46	-	.	g639.t1
Scaffold_10	AUGUSTUS	stop_codon	1171769	1171771	.	-	0	transcript_id "g639.t1"; gene_id "g639";
Scaffold_10	AUGUSTUS	CDS	1171769	1172107	0.46	-	0	transcript_id "g639.t1"; gene_id "g639";
Scaffold_10	AUGUSTUS	start_codon	1172105	1172107	.	-	0	transcript_id "g639.t1"; gene_id "g639";
# protein sequence = [MNVRETETRLASHEEVLAKLNHDHPNVAQHVQSEVEARQRLAEVTAQLTQYQNLYGEFSSVQPDSLANELQHKEDELR
# RLRLLNAQHAQVGSLVSVVRLFTEEISGRKCVVH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g639
###
# start gene g640
Scaffold_10	AUGUSTUS	gene	1174283	1175416	0.98	-	.	g640
Scaffold_10	AUGUSTUS	transcript	1174283	1175416	0.98	-	.	g640.t1
Scaffold_10	AUGUSTUS	stop_codon	1174283	1174285	.	-	0	transcript_id "g640.t1"; gene_id "g640";
Scaffold_10	AUGUSTUS	CDS	1174283	1175416	0.98	-	0	transcript_id "g640.t1"; gene_id "g640";
Scaffold_10	AUGUSTUS	start_codon	1175414	1175416	.	-	0	transcript_id "g640.t1"; gene_id "g640";
# protein sequence = [MPEEPTDLFDMAHVFAGGRVEFVSDQHFGIGSNLILPGRGKNMGDGWETKRSRLPGHKDWAIIKLYVFSTKGFLILDG
# RFLNRGAPGFLEQVELDTAHFKGNFPESCEIHALTSASNVVWTMEHSESDNWTLILPRTRLGPHRQHYFQLENVGGTPFTHVKLTIYPDGGLKRVRIL
# GRRTDTKTTIKAASVPTELDSVPTSTPIIIKKPMLQSTIPVLPLTPEGFAPFGQVIQAYGDHTAAPKGTKITQANAGTASKFHKLSLLVSSYPHNSGA
# TAGLSVYRCQPLKDINAIEGTTELTILERHPFTNQGFIPMGGGQGEGLSDSGHRYLVVVAKNGEDDKPDVRTLRAFMASTAQGIVYNTGIWRKSWSSL
# KYLMD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g640
###
# start gene g641
Scaffold_10	AUGUSTUS	gene	1177581	1178895	0.36	+	.	g641
Scaffold_10	AUGUSTUS	transcript	1177581	1178895	0.36	+	.	g641.t1
Scaffold_10	AUGUSTUS	start_codon	1177581	1177583	.	+	0	transcript_id "g641.t1"; gene_id "g641";
Scaffold_10	AUGUSTUS	CDS	1177581	1177829	0.38	+	0	transcript_id "g641.t1"; gene_id "g641";
Scaffold_10	AUGUSTUS	CDS	1178014	1178895	0.96	+	0	transcript_id "g641.t1"; gene_id "g641";
Scaffold_10	AUGUSTUS	stop_codon	1178893	1178895	.	+	0	transcript_id "g641.t1"; gene_id "g641";
# protein sequence = [MTESTLVPIAPAPPVALVGASTSTANYQNQKQAGTKRKRNDAQEPSGPDSGSTQSKKARDGPKKRKPIALAFTVKRHI
# SPAMTSIQCVYDTIEQLKRTNKNPQNTTTNVAETPRPSTPAPQQEQPQPHLSTCQHLLEHPFTLFSTSPSIADPILQESPTFEVPFDSNFPFGSEAAN
# LEYSILSAILGNPSPPQGDSTPPPTYSGWPSSDPLIASQSPTFSSTFPTSLSSNLAASPTTAYLTYQYQEPPRTSELSEVQYPPFQQSVNTPNTTTQP
# LQSRYSLESRAKSPPYSVFIDETSHGLLSPPHSNASPSLTPSVVRSTDSVASASICTPGSKLQSIHDRVTKPYDYTEGYHFLMKHLPIRCVLSLKTNQ
# TRVF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g641
###
# start gene g642
Scaffold_10	AUGUSTUS	gene	1182049	1183395	0.93	-	.	g642
Scaffold_10	AUGUSTUS	transcript	1182049	1183395	0.93	-	.	g642.t1
Scaffold_10	AUGUSTUS	stop_codon	1182049	1182051	.	-	0	transcript_id "g642.t1"; gene_id "g642";
Scaffold_10	AUGUSTUS	CDS	1182049	1183395	0.93	-	0	transcript_id "g642.t1"; gene_id "g642";
Scaffold_10	AUGUSTUS	start_codon	1183393	1183395	.	-	0	transcript_id "g642.t1"; gene_id "g642";
# protein sequence = [MFYLKENISHVPDLELSWYKEFDAQQSDSVPTEGLSNANAQEEAPQSFREQDELSRTAGLLLETVKTEKNPKFQNSIF
# MNLMTQLRDQKVVVRGNEMVENDGTHTVGQDSRVDVKGKGKGKASDSPFIPYAGLVSTLGQTIGNNATMAGVSPYNEQIDIQEDANDAYFRQENEDYT
# RYWNGMDPRKSQRQTVEVDLNWDKLQTDWEKFEASTKGITPVVSYQFQKNNPYLRGDSLRMRHHSMHSDDRLEVCSHSFHGDFLFMLNQIQTVLALEA
# AVQQDMSNASAWFELGVKQQEHERETQALQALKRATELDPSYLPGWLALAVSYTNDGRRLEAYEAIREWVLRNDDHRDILQQHLSQHPSSEEATIQEK
# FKQLVQCLITMAQQSAFGQIDADIQIALAVLFNSNEVRYSVVRSDSWAGEIDYPSSCRNMERLKTVLERHFLFVLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g642
###
# start gene g643
Scaffold_10	AUGUSTUS	gene	1185483	1186189	0.36	-	.	g643
Scaffold_10	AUGUSTUS	transcript	1185483	1186189	0.36	-	.	g643.t1
Scaffold_10	AUGUSTUS	stop_codon	1185483	1185485	.	-	0	transcript_id "g643.t1"; gene_id "g643";
Scaffold_10	AUGUSTUS	CDS	1185483	1185971	0.46	-	0	transcript_id "g643.t1"; gene_id "g643";
Scaffold_10	AUGUSTUS	CDS	1186025	1186189	0.36	-	0	transcript_id "g643.t1"; gene_id "g643";
Scaffold_10	AUGUSTUS	start_codon	1186187	1186189	.	-	0	transcript_id "g643.t1"; gene_id "g643";
# protein sequence = [MSSVDASHAENIAAMKRERDKLARESEDDWVQLVLFAEWSHGYLQMAALIPEAKVVIEDLGEWIDDVFLRYSGKENGE
# DEGPTAELGFTKPASPRRELKSNNNKRQPSPFTSETENDDSGIIFVAKKDKRTSSNDRGMIDIGSERTDSTKVDPTKPAKVDVKTEAEEEKTIGPDAD
# DEYEVGNIEGMRTSSSRQGGQIISESELMRRRRLLDSHIFK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g643
###
# start gene g644
Scaffold_10	AUGUSTUS	gene	1191923	1192267	0.43	-	.	g644
Scaffold_10	AUGUSTUS	transcript	1191923	1192267	0.43	-	.	g644.t1
Scaffold_10	AUGUSTUS	stop_codon	1191923	1191925	.	-	0	transcript_id "g644.t1"; gene_id "g644";
Scaffold_10	AUGUSTUS	CDS	1191923	1192267	0.43	-	0	transcript_id "g644.t1"; gene_id "g644";
Scaffold_10	AUGUSTUS	start_codon	1192265	1192267	.	-	0	transcript_id "g644.t1"; gene_id "g644";
# protein sequence = [MKILLRSLAHFLAKGALKASPIDTYECLCSVLLYSSANPPSETPSNDANSFPPFKMVDSTIMHNIVQQLNALDQGLDE
# EGLPSLSCLNYSHILSAPSALVGALTKALCCKLGLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g644
###
# start gene g645
Scaffold_10	AUGUSTUS	gene	1192874	1193723	0.18	+	.	g645
Scaffold_10	AUGUSTUS	transcript	1192874	1193723	0.18	+	.	g645.t1
Scaffold_10	AUGUSTUS	start_codon	1192874	1192876	.	+	0	transcript_id "g645.t1"; gene_id "g645";
Scaffold_10	AUGUSTUS	CDS	1192874	1193062	0.82	+	0	transcript_id "g645.t1"; gene_id "g645";
Scaffold_10	AUGUSTUS	CDS	1193190	1193325	0.77	+	0	transcript_id "g645.t1"; gene_id "g645";
Scaffold_10	AUGUSTUS	CDS	1193437	1193723	0.22	+	2	transcript_id "g645.t1"; gene_id "g645";
Scaffold_10	AUGUSTUS	stop_codon	1193721	1193723	.	+	0	transcript_id "g645.t1"; gene_id "g645";
# protein sequence = [MASSVLDINYPSDVDDDDNNTMNVDDRYNSHSQDRDASADDDVNMDVVDQPSARPSYNGSRYSGYEDLADEEDEDDEE
# EDGTYADEDYTKKKSAPKKKKLSTSSAVRREKKRARPQSDELRVSSRGGKIPNYFDDVQDFEKFDEEEEPDTGYYAGPVQQYQEEDEIEAVLSHSRDE
# GREADPEDVWFDNIVRDLTSFLFSCSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g645
###
# start gene g646
Scaffold_10	AUGUSTUS	gene	1200030	1201542	0.38	-	.	g646
Scaffold_10	AUGUSTUS	transcript	1200030	1201542	0.38	-	.	g646.t1
Scaffold_10	AUGUSTUS	stop_codon	1200030	1200032	.	-	0	transcript_id "g646.t1"; gene_id "g646";
Scaffold_10	AUGUSTUS	CDS	1200030	1200869	0.38	-	0	transcript_id "g646.t1"; gene_id "g646";
Scaffold_10	AUGUSTUS	CDS	1201015	1201542	0.65	-	0	transcript_id "g646.t1"; gene_id "g646";
Scaffold_10	AUGUSTUS	start_codon	1201540	1201542	.	-	0	transcript_id "g646.t1"; gene_id "g646";
# protein sequence = [MSHKKKDCLERPRRKGARFSNKDIKADEVIQEVELGYDAKRDRWNGYDPAEHKKIYAEYAAVEATRQKLREEEIDNQT
# TTDLAAVRKMAKAGKTEKKEDADFGSSDEEDADEDKYADAADAVGQKLDAKTRITVRNLRIREDTAKYLINLDPSSAYYDPKTRSMRDAPNKDTAPED
# PLAETMFMNANPTQGELLHQEFKEKRQELKETSKGSILAKYGGEEYLQTAPRELRQGQTEECRVFADWSGYQRSRTRKSEVEVPRRWYMCCYHCCELQ
# LIQSSVFVNNHTSVWGSWYDASSGTWGYSCCHSNVHLSYCSGEAGIVATEASNAQNLLSAPSEPIAPSPEISTSKTVTSHEKVEQNYSKKRVGEGEVK
# LDKNRLARALQEEKKRARGDEEDDRSGKRPKVGGSHDVTEEELGTFFSVAHPSEHRLTFSSEAYRMRRTITEDPMANYVDVHD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g646
###
# start gene g647
Scaffold_10	AUGUSTUS	gene	1202132	1204747	0.98	-	.	g647
Scaffold_10	AUGUSTUS	transcript	1202132	1204747	0.98	-	.	g647.t1
Scaffold_10	AUGUSTUS	stop_codon	1202132	1202134	.	-	0	transcript_id "g647.t1"; gene_id "g647";
Scaffold_10	AUGUSTUS	CDS	1202132	1204747	0.98	-	0	transcript_id "g647.t1"; gene_id "g647";
Scaffold_10	AUGUSTUS	start_codon	1204745	1204747	.	-	0	transcript_id "g647.t1"; gene_id "g647";
# protein sequence = [MSFPATAEAIDSLEEYEDIIAWINDTLTASSSEQDLESLINLDQQITQLIASLDIACEDTSSQLERTIDDVSRGIPRL
# TYDLHFIKDNALSLQNSLANVHSSSRAAIPDTTASALEQLKRLDTMKGHMEAAREVLREAESWSTLELEVTSMLTEHNYAKAASRLSEANKSMVVFQN
# TPEYDPRRTLLVNLQNQLEASLSSALVAAINEQNLETCRSYFDIFNNIQREVEFRNYYYGSRRAPLTATWSDAELLNAAPEGKIVSGQTFSEFLSKFY
# ASMLALLNQECGSIPAIFPDPAHTLSAFISSILSSLQPTFSQRLSSLSSYYSDLALKELIAVYRVTEEFAVGVVKLMEKIQYSTVPPVNTSSSDPATP
# THPSRSRKRSMRMSISFRSGMNRTNSGGQKISSLVDGLDWDQELFHPFLEFQVDYSSLERRFLDHALRDIVSNDTRQKASGSDQARIFRERAVDIFST
# AEESLARCSAFTHGYGSVSLLQALDGFLKSFVDMWTADVSFASLGPHSTLQEAGSEDLSGLDYTSQDWQNIQTMLHLLGSARSVYERMNSFEVKLRSN
# LANTASTFRLHRGDPTSFPIADTKGAEQILEQSSLNSADLHAHWTKDVDPSHIRDNFSRQQGTASSTLGEPLLTDARSAMFDFAKACQISLQDTILSP
# LRQQLASYAISSIWVITTEESRNTTFNDLQVPTFSLSPSEIFQRVTEGLLNLPRLFEVYADDDALSFSLQTLPYADPELLKNLPAASVPDIPTHSRRH
# SVTKSVTLDPEVVSTAWLSSLGQSLLAHLTTEVLPRINKLNSGGAAQLASDLGYLSNVIRVINVESEELEQWKEYVELNDDAGKAKVDTKNDEDRVLN
# HVARMRGWR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g647
###
# start gene g648
Scaffold_10	AUGUSTUS	gene	1205301	1205786	0.97	-	.	g648
Scaffold_10	AUGUSTUS	transcript	1205301	1205786	0.97	-	.	g648.t1
Scaffold_10	AUGUSTUS	stop_codon	1205301	1205303	.	-	0	transcript_id "g648.t1"; gene_id "g648";
Scaffold_10	AUGUSTUS	CDS	1205301	1205786	0.97	-	0	transcript_id "g648.t1"; gene_id "g648";
Scaffold_10	AUGUSTUS	start_codon	1205784	1205786	.	-	0	transcript_id "g648.t1"; gene_id "g648";
# protein sequence = [MPDAALFTRPPRNADYNTLTAIVLFTKLPFAFFPIDIFLQRVSDTDMDTPTDAIDSQVLITLTTHFKVHWRTSVLSKN
# SQHVLMASQTLGDLFEVMPCVSNEYPEEIVEDDKVIGYKETNGMNGSSGCVIVINDLAYGDALNEEDYAEYVGISQLSVCYRH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g648
###
# start gene g649
Scaffold_10	AUGUSTUS	gene	1213864	1214754	0.73	+	.	g649
Scaffold_10	AUGUSTUS	transcript	1213864	1214754	0.73	+	.	g649.t1
Scaffold_10	AUGUSTUS	start_codon	1213864	1213866	.	+	0	transcript_id "g649.t1"; gene_id "g649";
Scaffold_10	AUGUSTUS	CDS	1213864	1214754	0.73	+	0	transcript_id "g649.t1"; gene_id "g649";
Scaffold_10	AUGUSTUS	stop_codon	1214752	1214754	.	+	0	transcript_id "g649.t1"; gene_id "g649";
# protein sequence = [MNLDRTSAYPSSSYERPFFATKFPPESPLKLDFHHPGPPPNTPLPPIPSQNPKAMSLAPPSPKSSVLRLGGRPGTQPR
# SVPFARLLQRKLSVVPEEPGSNVEHPPTSPRNERTAFGGGAEGQHYKPYFAHTSQNTPRLPDISNHDGAIHRSHSYSSHFGSEPFTAGNLEVGGFIQL
# GPRTNSTNASAHIRAVKPPFQGVIVSEDIRERPCKIRSNMVATASSGVIANKENGPAIGRSDSAGSNRSGKTFSSVTGKETVRKKFKSKKQGNSVTTS
# AETFVSTGDPWLSGSELDAWLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g649
###
# start gene g650
Scaffold_10	AUGUSTUS	gene	1220811	1221377	1	+	.	g650
Scaffold_10	AUGUSTUS	transcript	1220811	1221377	1	+	.	g650.t1
Scaffold_10	AUGUSTUS	start_codon	1220811	1220813	.	+	0	transcript_id "g650.t1"; gene_id "g650";
Scaffold_10	AUGUSTUS	CDS	1220811	1221377	1	+	0	transcript_id "g650.t1"; gene_id "g650";
Scaffold_10	AUGUSTUS	stop_codon	1221375	1221377	.	+	0	transcript_id "g650.t1"; gene_id "g650";
# protein sequence = [MLSELVNDFNVIDHYRPSNKRARNANEPINKLPSSAQQAQQAQVPFSRSQTTTYQSQSQSQPAQPYPTRSTRLDEQVS
# ADLQLASQLLYGWRSTGESPPAWTNQQTAESLSTIDKKTVTYLEQIFGRIDNFHNDPGVAYKDADQGIYQDPNQDYYSSQLQPGYQGEALAMSGVNHA
# ADFESSTASGFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g650
###
# start gene g651
Scaffold_10	AUGUSTUS	gene	1225087	1225929	0.53	-	.	g651
Scaffold_10	AUGUSTUS	transcript	1225087	1225929	0.53	-	.	g651.t1
Scaffold_10	AUGUSTUS	stop_codon	1225087	1225089	.	-	0	transcript_id "g651.t1"; gene_id "g651";
Scaffold_10	AUGUSTUS	CDS	1225087	1225623	0.78	-	0	transcript_id "g651.t1"; gene_id "g651";
Scaffold_10	AUGUSTUS	CDS	1225666	1225929	0.53	-	0	transcript_id "g651.t1"; gene_id "g651";
Scaffold_10	AUGUSTUS	start_codon	1225927	1225929	.	-	0	transcript_id "g651.t1"; gene_id "g651";
# protein sequence = [MLRDRVILAVEIPAAQHRALIGRGGQHLNELQDQTGAQIQFPGSRSYAHVGEPENAVDFGDVDPANIVKVTGPRAACE
# KAIDGLKVGINSMKAAAPELITSTISVPLKYHHIISQQGQFFRNLRNFGVQVDQSVQAQKQEVPVRPVPSGTTTARIDEEEDPEAPEVEWEVAPNYQN
# AEEGDSLWTLKARDQGGLERAAKLVHDAIEHAKGMSFIGFLTLPDRSTFPRIVGSKGANVMRIRNETGADIQVSRENSTIIIVGMCCYFY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g651
###
# start gene g652
Scaffold_10	AUGUSTUS	gene	1226024	1227519	0.09	-	.	g652
Scaffold_10	AUGUSTUS	transcript	1226024	1227519	0.09	-	.	g652.t1
Scaffold_10	AUGUSTUS	stop_codon	1226024	1226026	.	-	0	transcript_id "g652.t1"; gene_id "g652";
Scaffold_10	AUGUSTUS	CDS	1226024	1226721	0.67	-	2	transcript_id "g652.t1"; gene_id "g652";
Scaffold_10	AUGUSTUS	CDS	1227190	1227378	0.28	-	2	transcript_id "g652.t1"; gene_id "g652";
Scaffold_10	AUGUSTUS	CDS	1227447	1227519	0.62	-	0	transcript_id "g652.t1"; gene_id "g652";
Scaffold_10	AUGUSTUS	start_codon	1227517	1227519	.	-	0	transcript_id "g652.t1"; gene_id "g652";
# protein sequence = [MVKEAADVKSDTLQVEKRWHEAIIDILHRIIGEDKALSIKFGVEAGDSATEDSILIRGTSADVSRAAKEILQIVENAK
# NDEIVNSYVTSTHASAFQLDDLIFIYLGKYVIRLEENYSVKITFPRQTAENGEGKTREQLKPDEVLIKGGKKGVAGAKAELLDVSLSLKILIHYLDCL
# QAVEFEKETNNVLKFTVPTRSVARILGKGGKSINEIKDTTDAQIDVEKVSDDQTNITVRGTKKAINAAKIAILAIADQVAEELALTVPVESKYHRTLI
# GVGGQGLKDLVSRCGGGSDPKVLANLIRLSALFLFLHGSDSHPLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g652
###
# start gene g653
Scaffold_10	AUGUSTUS	gene	1227741	1229253	0.61	-	.	g653
Scaffold_10	AUGUSTUS	transcript	1227741	1229253	0.61	-	.	g653.t1
Scaffold_10	AUGUSTUS	stop_codon	1227741	1227743	.	-	0	transcript_id "g653.t1"; gene_id "g653";
Scaffold_10	AUGUSTUS	CDS	1227741	1228657	0.62	-	2	transcript_id "g653.t1"; gene_id "g653";
Scaffold_10	AUGUSTUS	CDS	1228710	1229253	0.95	-	0	transcript_id "g653.t1"; gene_id "g653";
Scaffold_10	AUGUSTUS	start_codon	1229251	1229253	.	-	0	transcript_id "g653.t1"; gene_id "g653";
# protein sequence = [MEGAPDPFAPTPEEQVEPRSKPLKQELDTNSHQAFPSLASSAPTTKPATQSAWGAANGPRIKPVINKQPVFTDSFTLG
# TVELTTKDNKPVTLGETIKQVMAKYKVKVEASGNQRGRQTTFHMKAESQRELDKAKRLLLALLSPIVRVLSNNLLYVINNHAAQETFNVTAPISTIPT
# IIGPKGATLKQIRDQTGAKIDVPPKDSANGTSNGHAVGDDEDEEPSVQITVMGPKPLALEAVDLINQIVASKTSRITQRVRDIPPHVLPFILARKSVF
# EAAAQGSELKLQSGHLEVTASGERDAVHRALDLIKADIAELSSNLTSLKISLPKRQHRLLVGKGAQGVMAKSKCAVMVNFDDPSDEIAVWGHAADLPS
# GLAAVMEQANSKYIHEFPLPGPVTLSKQLLEYMNRIDYPKTLSEKHPGVSIFTPAPATIDRAHSLVIDIVGDKPAVDAVVRQVSELIGKLIGATKDVS
# IDWLLHRIINGKNAKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g653
###
# start gene g654
Scaffold_10	AUGUSTUS	gene	1233993	1234301	0.97	+	.	g654
Scaffold_10	AUGUSTUS	transcript	1233993	1234301	0.97	+	.	g654.t1
Scaffold_10	AUGUSTUS	start_codon	1233993	1233995	.	+	0	transcript_id "g654.t1"; gene_id "g654";
Scaffold_10	AUGUSTUS	CDS	1233993	1234301	0.97	+	0	transcript_id "g654.t1"; gene_id "g654";
Scaffold_10	AUGUSTUS	stop_codon	1234299	1234301	.	+	0	transcript_id "g654.t1"; gene_id "g654";
# protein sequence = [MPVPLDLRIQNNQAPCNISLDSKFSGNYDVSTKLATASVDLVPDLHDYTGDGPRQMLPEVDTMSVKHGWVGWGSQPAQ
# FNPRQQGQVVLVSSLSPVSLSLGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g654
###
# start gene g655
Scaffold_10	AUGUSTUS	gene	1235921	1236262	0.72	+	.	g655
Scaffold_10	AUGUSTUS	transcript	1235921	1236262	0.72	+	.	g655.t1
Scaffold_10	AUGUSTUS	start_codon	1235921	1235923	.	+	0	transcript_id "g655.t1"; gene_id "g655";
Scaffold_10	AUGUSTUS	CDS	1235921	1236262	0.72	+	0	transcript_id "g655.t1"; gene_id "g655";
Scaffold_10	AUGUSTUS	stop_codon	1236260	1236262	.	+	0	transcript_id "g655.t1"; gene_id "g655";
# protein sequence = [MAGPREAVWHAIIRKNFGATHFIVGRDHAGPGKNSEGKDFYGPYDAQDLVTKYHEELEIEMVPFQQMTYLPSTDEYQP
# VDEVPKGVQTLDISGTELRRRLRTGASIPDWFSYE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g655
###
# start gene g656
Scaffold_10	AUGUSTUS	gene	1238631	1239278	0.99	+	.	g656
Scaffold_10	AUGUSTUS	transcript	1238631	1239278	0.99	+	.	g656.t1
Scaffold_10	AUGUSTUS	start_codon	1238631	1238633	.	+	0	transcript_id "g656.t1"; gene_id "g656";
Scaffold_10	AUGUSTUS	CDS	1238631	1239278	0.99	+	0	transcript_id "g656.t1"; gene_id "g656";
Scaffold_10	AUGUSTUS	stop_codon	1239276	1239278	.	+	0	transcript_id "g656.t1"; gene_id "g656";
# protein sequence = [MNSTRWVTLTEFIKHLGRTGVARVDETEKGWFIAWIDNSPKALAKAVRLLPIQIGIAFHWATQEASMKKERATTSDEQ
# RERTLIAEQIERAAAEAGPSRSETPPEDLGLKRDEGAEKVVLSLSAKAADAPNSVSPPAPLKMNAFKSSAFNPLKPATNPLKRPNVFKSTTASSSSST
# GTSIEKDAKKRALPMSAAERLIVEEQERKRRRMDKESMN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g656
###
# start gene g657
Scaffold_10	AUGUSTUS	gene	1239384	1240148	0.76	-	.	g657
Scaffold_10	AUGUSTUS	transcript	1239384	1240148	0.76	-	.	g657.t1
Scaffold_10	AUGUSTUS	stop_codon	1239384	1239386	.	-	0	transcript_id "g657.t1"; gene_id "g657";
Scaffold_10	AUGUSTUS	CDS	1239384	1240148	0.76	-	0	transcript_id "g657.t1"; gene_id "g657";
Scaffold_10	AUGUSTUS	start_codon	1240146	1240148	.	-	0	transcript_id "g657.t1"; gene_id "g657";
# protein sequence = [MLCTQFTYSLKLTRLFQIADIIVASLLVEGTPVPRKVARLHLICDILHNSAASVPSAWKFRQEFQSRLGIVFDHLSNI
# YHSFPGRITAETFKKQITTVVDIWEDWIVFPPAFTSELRVRLEGMAMENKTETVETVATEEVKGDSAKLPSRFTTSTFKTATEPASGVGVDEDLDGAP
# LDTATEGRIDGTSMDDVDGIPIEDVDGTPMEDLDGAPMEDLDGTPMEDVDGTPMEDVDGAPMDNMSPSLDDLDGEPLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g657
###
# start gene g658
Scaffold_10	AUGUSTUS	gene	1245625	1246258	0.3	-	.	g658
Scaffold_10	AUGUSTUS	transcript	1245625	1246258	0.3	-	.	g658.t1
Scaffold_10	AUGUSTUS	stop_codon	1245625	1245627	.	-	0	transcript_id "g658.t1"; gene_id "g658";
Scaffold_10	AUGUSTUS	CDS	1245625	1246146	0.68	-	0	transcript_id "g658.t1"; gene_id "g658";
Scaffold_10	AUGUSTUS	CDS	1246241	1246258	0.32	-	0	transcript_id "g658.t1"; gene_id "g658";
Scaffold_10	AUGUSTUS	start_codon	1246256	1246258	.	-	0	transcript_id "g658.t1"; gene_id "g658";
# protein sequence = [MQFMLALNSPPVNPSFGKANDNAVQFSSSTSSSSSATTSSPTSSSASAQSSASTNNSSGIWNGASSLLSVVSSCGDIG
# ATCTYSLLFVYQSLNVFTVDITSQSGPNGNIYWMNCGVSDSGWNPTYVNINQIIVKDFATALQDSNTPFSACSSYTDKFYEYGQQFGIPPIVIASFAM
# QEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g658
###
# start gene g659
Scaffold_10	AUGUSTUS	gene	1257897	1258811	0.62	-	.	g659
Scaffold_10	AUGUSTUS	transcript	1257897	1258811	0.62	-	.	g659.t1
Scaffold_10	AUGUSTUS	stop_codon	1257897	1257899	.	-	0	transcript_id "g659.t1"; gene_id "g659";
Scaffold_10	AUGUSTUS	CDS	1257897	1258811	0.62	-	0	transcript_id "g659.t1"; gene_id "g659";
Scaffold_10	AUGUSTUS	start_codon	1258809	1258811	.	-	0	transcript_id "g659.t1"; gene_id "g659";
# protein sequence = [MQTSQLSRPPIHLKGPRERLSRPVSPSPNTMILPETPPLNIKKVNPSHPPNSSVPQPPNSSPRKFPAPALTLSIPTPR
# SRPTTPKPRIQIDIPLPSNNHSADEDSYCYYGGGPTTVISSGGSADETTIRPPATTRPSITIAMPSKQDEPIESIRHAIDNMRPTDDEVDSVVQEAVF
# SNPWSDDILEEVCRLGEGAGGAVHKVKDKRTGKVMARKTITTREAPMKQLERELSIMSSTKHINIVHFYGAYMSPSSSEVKILMDFCEGGSLETVSKK
# IKERNAVVGEKIAGRLAEGVSRVTSTILIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g659
###
# start gene g660
Scaffold_10	AUGUSTUS	gene	1264774	1265073	0.78	+	.	g660
Scaffold_10	AUGUSTUS	transcript	1264774	1265073	0.78	+	.	g660.t1
Scaffold_10	AUGUSTUS	start_codon	1264774	1264776	.	+	0	transcript_id "g660.t1"; gene_id "g660";
Scaffold_10	AUGUSTUS	CDS	1264774	1265073	0.78	+	0	transcript_id "g660.t1"; gene_id "g660";
Scaffold_10	AUGUSTUS	stop_codon	1265071	1265073	.	+	0	transcript_id "g660.t1"; gene_id "g660";
# protein sequence = [MGVLAVCELCCSPSEVDLVSIKPYRSRGLGSQSLQHIIDAAKSHIKTKIDKIYLHVQTSNVEAKKFYDRHGFEAVGIH
# KNYYKKLVPRDAWIMELTIGQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g660
###
# start gene g661
Scaffold_10	AUGUSTUS	gene	1269648	1269788	0.88	+	.	g661
Scaffold_10	AUGUSTUS	transcript	1269648	1269788	0.88	+	.	g661.t1
Scaffold_10	AUGUSTUS	start_codon	1269648	1269650	.	+	0	transcript_id "g661.t1"; gene_id "g661";
Scaffold_10	AUGUSTUS	CDS	1269648	1269788	0.88	+	0	transcript_id "g661.t1"; gene_id "g661";
Scaffold_10	AUGUSTUS	stop_codon	1269786	1269788	.	+	0	transcript_id "g661.t1"; gene_id "g661";
# protein sequence = [MQASDASFLANLWKSQQGKSKEQDDELIDVDVDSTSDYSEMDDIDI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g661
###
# start gene g662
Scaffold_10	AUGUSTUS	gene	1273767	1274099	0.86	+	.	g662
Scaffold_10	AUGUSTUS	transcript	1273767	1274099	0.86	+	.	g662.t1
Scaffold_10	AUGUSTUS	start_codon	1273767	1273769	.	+	0	transcript_id "g662.t1"; gene_id "g662";
Scaffold_10	AUGUSTUS	CDS	1273767	1274099	0.86	+	0	transcript_id "g662.t1"; gene_id "g662";
Scaffold_10	AUGUSTUS	stop_codon	1274097	1274099	.	+	0	transcript_id "g662.t1"; gene_id "g662";
# protein sequence = [MGVGPLSSQYSSVNPIATHDPSRGAGSRSYSNYDYLTHPRVSTTLDNRNRSEEAEYALTSLAQSYPDVQPPSRDMPKG
# SVAPPAKYECTYCGKGFNRPSSLKVESLVSDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g662
###
# start gene g663
Scaffold_10	AUGUSTUS	gene	1282221	1282502	0.63	-	.	g663
Scaffold_10	AUGUSTUS	transcript	1282221	1282502	0.63	-	.	g663.t1
Scaffold_10	AUGUSTUS	stop_codon	1282221	1282223	.	-	0	transcript_id "g663.t1"; gene_id "g663";
Scaffold_10	AUGUSTUS	CDS	1282221	1282502	0.63	-	0	transcript_id "g663.t1"; gene_id "g663";
Scaffold_10	AUGUSTUS	start_codon	1282500	1282502	.	-	0	transcript_id "g663.t1"; gene_id "g663";
# protein sequence = [MGRQKLKKSFQYEIKWRGLDHRFNTWVARDDLITKGFTKLVQQFDDLESSREGAGSRDTAAHLVRKHLEDIGLDGDIA
# QYNEISGLSGGEFCD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g663
###
# start gene g664
Scaffold_10	AUGUSTUS	gene	1284259	1285041	0.88	-	.	g664
Scaffold_10	AUGUSTUS	transcript	1284259	1285041	0.88	-	.	g664.t1
Scaffold_10	AUGUSTUS	stop_codon	1284259	1284261	.	-	0	transcript_id "g664.t1"; gene_id "g664";
Scaffold_10	AUGUSTUS	CDS	1284259	1284720	1	-	0	transcript_id "g664.t1"; gene_id "g664";
Scaffold_10	AUGUSTUS	CDS	1284775	1285041	0.88	-	0	transcript_id "g664.t1"; gene_id "g664";
Scaffold_10	AUGUSTUS	start_codon	1285039	1285041	.	-	0	transcript_id "g664.t1"; gene_id "g664";
# protein sequence = [MANPDSVPACIKALSSTTFVAEVTAPALAVLVPLLIRALNDRSMETQRRTVVVIDNLVKLVRDPKVAAQYLSPLVEGV
# EKIAKGAAFPEVRAFGETALETLLKSGASAKVPPSESRDLEQQTKDACSALLLLLPEDIRDPSSPPNGPYTPKYSLLTRSLDFQASLVADLVNARQFS
# DINAWSRCIGLFIKGWTDPEHSTRFSEAVREHFLAIDKVLHFLKPVLQGVTEGFLPGKVYCSYQWQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g664
###
# start gene g665
Scaffold_10	AUGUSTUS	gene	1289961	1291748	0.13	+	.	g665
Scaffold_10	AUGUSTUS	transcript	1289961	1291748	0.13	+	.	g665.t1
Scaffold_10	AUGUSTUS	start_codon	1289961	1289963	.	+	0	transcript_id "g665.t1"; gene_id "g665";
Scaffold_10	AUGUSTUS	CDS	1289961	1290505	0.27	+	0	transcript_id "g665.t1"; gene_id "g665";
Scaffold_10	AUGUSTUS	CDS	1290556	1290883	0.25	+	1	transcript_id "g665.t1"; gene_id "g665";
Scaffold_10	AUGUSTUS	CDS	1291152	1291748	0.98	+	0	transcript_id "g665.t1"; gene_id "g665";
Scaffold_10	AUGUSTUS	stop_codon	1291746	1291748	.	+	0	transcript_id "g665.t1"; gene_id "g665";
# protein sequence = [MAFPPAKTDTTLAPSWILLLGNAMASYNVVHSDACYAQVGLVWKTLWPFLESSSASVRKATVQSLDQLARCIVTDASS
# SKMDDIVAQVMKALTSVSHARAIPDLLSLTSALLTSSYGKGKRTLDDVMGQRLLALVVQIGKLRTEKAFEYKEAADDTLSTAMRMLGPKVLLNVLPLN
# LEPEDRQAGLEPRAFLLPLLAQPHPSPLSHFVSYFVPLSERMFDLQQKAENEGRQSESKVWNVLISQIWAGFPAYCHATPNIEGTMDASFSQLVSQLL
# YGQPELRSAVLRGLRLIEIHKAYIKVVDLFKGHIGKTSSASGNEENISATALDLLLLLLPYLSSADLTVLFQNCLSSEFLCAKDNALQKRAYKILTRL
# TESGKVIIDSEAVLKELDALSEGLTSAAKKDRFNLFAVLIPLIPSSAMHLIPSMIPEAVLGTKETSDKARNAAFELIIAMGQKMSQGGVVKRDMLEEM
# DEDSAVEGQLLHPCRSMSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g665
###
# start gene g666
Scaffold_10	AUGUSTUS	gene	1292353	1293052	0.45	+	.	g666
Scaffold_10	AUGUSTUS	transcript	1292353	1293052	0.45	+	.	g666.t1
Scaffold_10	AUGUSTUS	start_codon	1292353	1292355	.	+	0	transcript_id "g666.t1"; gene_id "g666";
Scaffold_10	AUGUSTUS	CDS	1292353	1292572	0.45	+	0	transcript_id "g666.t1"; gene_id "g666";
Scaffold_10	AUGUSTUS	CDS	1292628	1293052	0.95	+	2	transcript_id "g666.t1"; gene_id "g666";
Scaffold_10	AUGUSTUS	stop_codon	1293050	1293052	.	+	0	transcript_id "g666.t1"; gene_id "g666";
# protein sequence = [MKVPETKATAGDAFEDILYGSESEVDASDDDEGAGRKPSQLRTKSKKQSQGMRLRLDDDEPMDLLQGVASRITSASSN
# RRRKPGQDAAHFKTDEDTGKMVIDQSDDEDAVPHQASNDVSGTAYRESITSVDGFTRGPNGRVKFNKDTKKRRRDNEDLDMMDVDESDRNHNQQKRKT
# APKLGHEFKAKVGFYLFIVEFVMISVYRELVEMLKKAV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g666
###
# start gene g667
Scaffold_10	AUGUSTUS	gene	1295110	1295637	0.7	+	.	g667
Scaffold_10	AUGUSTUS	transcript	1295110	1295637	0.7	+	.	g667.t1
Scaffold_10	AUGUSTUS	start_codon	1295110	1295112	.	+	0	transcript_id "g667.t1"; gene_id "g667";
Scaffold_10	AUGUSTUS	CDS	1295110	1295637	0.7	+	0	transcript_id "g667.t1"; gene_id "g667";
Scaffold_10	AUGUSTUS	stop_codon	1295635	1295637	.	+	0	transcript_id "g667.t1"; gene_id "g667";
# protein sequence = [MVGTGFDFRRSDQPEEGSRFHLVQMPCKCIHGFTLEYPTGDHFTDGCIRFYRVDFLDAFVEALPPNVAHFGMRLASYS
# QNASASEISLQFSNGTTATCDLLAGCDGIKSSIRAQLYRECSERSGDSTLLKFIDPGLDGHYCVQRTDTGRTLATVSSQYCRSDDGMHADRCRQRSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g667
###
# start gene g668
Scaffold_10	AUGUSTUS	gene	1296701	1298002	0.39	-	.	g668
Scaffold_10	AUGUSTUS	transcript	1296701	1298002	0.39	-	.	g668.t1
Scaffold_10	AUGUSTUS	stop_codon	1296701	1296703	.	-	0	transcript_id "g668.t1"; gene_id "g668";
Scaffold_10	AUGUSTUS	CDS	1296701	1297457	1	-	1	transcript_id "g668.t1"; gene_id "g668";
Scaffold_10	AUGUSTUS	CDS	1297511	1297687	0.56	-	1	transcript_id "g668.t1"; gene_id "g668";
Scaffold_10	AUGUSTUS	CDS	1297935	1298002	0.43	-	0	transcript_id "g668.t1"; gene_id "g668";
Scaffold_10	AUGUSTUS	start_codon	1298000	1298002	.	-	0	transcript_id "g668.t1"; gene_id "g668";
# protein sequence = [MSGFKVICSLCKGLPVECCDRPQNYASGPSPHALVFLEHRQGDIDSGSLSALTAASQLGGKVAGLVVGSSEFVPAVVD
# KVKKLKGLTSLLHCTSDLYAEQLPETLSPLLEKLLSDSEYTHVVSTPSSLAKSLLPRVAAKLDVPSVSEITSLEHDSSSNSTTFTRPIYAGNAISTVR
# LPSSVPIKFFTVRATNFDPAPFEESQEIEVKAIDPVDVPNCPTKHISTQLAKSDRPDLSVAGRVVSGGRPLKNAETFAATLNPLADVLGAALGASRAA
# VDAGYVDNSLQVGQTGKVVAPELYMAIGISGAIQHLAGMKDSKMIVAVNKVRESCYSSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g668
###
# start gene g669
Scaffold_10	AUGUSTUS	gene	1298068	1299106	0.38	+	.	g669
Scaffold_10	AUGUSTUS	transcript	1298068	1299106	0.38	+	.	g669.t1
Scaffold_10	AUGUSTUS	start_codon	1298068	1298070	.	+	0	transcript_id "g669.t1"; gene_id "g669";
Scaffold_10	AUGUSTUS	CDS	1298068	1298312	0.38	+	0	transcript_id "g669.t1"; gene_id "g669";
Scaffold_10	AUGUSTUS	CDS	1298402	1298749	0.51	+	1	transcript_id "g669.t1"; gene_id "g669";
Scaffold_10	AUGUSTUS	CDS	1298800	1299106	1	+	1	transcript_id "g669.t1"; gene_id "g669";
Scaffold_10	AUGUSTUS	stop_codon	1299104	1299106	.	+	0	transcript_id "g669.t1"; gene_id "g669";
# protein sequence = [MIVAFIYQQLHQLPGTSSSAATGHDLALARQFFEANRASPAIFASAIPELSNPQMKDAWIAEQQQHMRIFESNKSHSQ
# WTADAQLPHGSHMVAAPQMASYMPQVAMYGNYVPHNNLFAMGGPPLMQNYTPPIVDSAEGKGKSREADFDAAFAQAAAFLPSQEAGTSGIVEVNDGVT
# DIEEGLKSTTLQDHTIEPDFRRVWDHLQNSDAPPPAEDLAKWETEFQQLMDAQRDELNYGNAMQEAWENGLGNFTDSTTLGDPPLKFDNDGLPILQAY
# VFETNNKYLDPSNSTSSLCQTQKRC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g669
###
# start gene g670
Scaffold_10	AUGUSTUS	gene	1300852	1301274	1	-	.	g670
Scaffold_10	AUGUSTUS	transcript	1300852	1301274	1	-	.	g670.t1
Scaffold_10	AUGUSTUS	stop_codon	1300852	1300854	.	-	0	transcript_id "g670.t1"; gene_id "g670";
Scaffold_10	AUGUSTUS	CDS	1300852	1301274	1	-	0	transcript_id "g670.t1"; gene_id "g670";
Scaffold_10	AUGUSTUS	start_codon	1301272	1301274	.	-	0	transcript_id "g670.t1"; gene_id "g670";
# protein sequence = [MIEEAHDDSDASFEPPKTTARKRKSTSGVSTSKKAKFATSSSSASSGVLNKQYSELASSVLANGANFYTKSENQDAAS
# DAAVTLAGYTKQLEVALGEALKSSGGIPAAEPKTGVELTAAAGKIRKAAVSGIKKQMSVSTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g670
###
# start gene g671
Scaffold_10	AUGUSTUS	gene	1305197	1305928	0.83	+	.	g671
Scaffold_10	AUGUSTUS	transcript	1305197	1305928	0.83	+	.	g671.t1
Scaffold_10	AUGUSTUS	start_codon	1305197	1305199	.	+	0	transcript_id "g671.t1"; gene_id "g671";
Scaffold_10	AUGUSTUS	CDS	1305197	1305928	0.83	+	0	transcript_id "g671.t1"; gene_id "g671";
Scaffold_10	AUGUSTUS	stop_codon	1305926	1305928	.	+	0	transcript_id "g671.t1"; gene_id "g671";
# protein sequence = [MRTLSMGTAWASEGSYPWEQGRYVGGIETVKVNLALRIYSNAWHVYAGLAILNPNAREQINQYAQSATELYKMMLEAG
# GALSNGKSDQSSEYDSERESKLRQRIEWAQGVVFGDPSKTRNRKPILLSEDILDKFSLGRSNTVSSVIPDPCAMETESSPRKANSHLSLLAMVDCWAH
# LDINPFHHLDLAATPLFRLFLGVAEHLFLNPALMDMTIQSAIYDTWHRANDLEFVVAARGWSQCVNL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g671
###
# start gene g672
Scaffold_10	AUGUSTUS	gene	1314286	1314645	0.51	-	.	g672
Scaffold_10	AUGUSTUS	transcript	1314286	1314645	0.51	-	.	g672.t1
Scaffold_10	AUGUSTUS	stop_codon	1314286	1314288	.	-	0	transcript_id "g672.t1"; gene_id "g672";
Scaffold_10	AUGUSTUS	CDS	1314286	1314645	0.51	-	0	transcript_id "g672.t1"; gene_id "g672";
Scaffold_10	AUGUSTUS	start_codon	1314643	1314645	.	-	0	transcript_id "g672.t1"; gene_id "g672";
# protein sequence = [MDSSSISSGRSASSSSPLNPSINANANPSSPHLANSPSISRSTSEHVLTSSPTQESDLHPGGGGGMDPAMLAAHIEKV
# RLLIMGMETRISKREDHLQEMVKRAESEGRRWEEVVGGVRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g672
###
# start gene g673
Scaffold_10	AUGUSTUS	gene	1316065	1317404	0.26	-	.	g673
Scaffold_10	AUGUSTUS	transcript	1316065	1317404	0.26	-	.	g673.t1
Scaffold_10	AUGUSTUS	stop_codon	1316065	1316067	.	-	0	transcript_id "g673.t1"; gene_id "g673";
Scaffold_10	AUGUSTUS	CDS	1316065	1316499	0.76	-	0	transcript_id "g673.t1"; gene_id "g673";
Scaffold_10	AUGUSTUS	CDS	1316796	1317404	0.35	-	0	transcript_id "g673.t1"; gene_id "g673";
Scaffold_10	AUGUSTUS	start_codon	1317402	1317404	.	-	0	transcript_id "g673.t1"; gene_id "g673";
# protein sequence = [MNLVPTPFSRPLLTPIYTSPSTSQSQTNVTQSLPNHPSKSQTPQPSSSFPIPTTVPINRPLYKPIPHKGRHWVVTRNT
# NYRRGKDKEDEMDDLFESDWKASREAHALDFGSFALLAGELAEEMKRRGIPGDDEQMTAEIIKESLDCGASATNVTIGASVPRDASQWFTTQAPDAED
# YIRDVVYGGTEGFAYVRSLAEFVTPPELRTHTIDMGSLIRAPDEIYQSEKEWFGNLASGEQVKKEDSMEVDTQASPNTSTTIGTMEQLDRVFSYVGNA
# ITALDRQRRAQNSVVEATQMKVDDTEEDPVLRNIRLNLLALAKRAPLDTIALLPRDLIPEQIRHVIPALASAT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g673
###
# start gene g674
Scaffold_10	AUGUSTUS	gene	1317475	1318582	0.17	-	.	g674
Scaffold_10	AUGUSTUS	transcript	1317475	1318582	0.17	-	.	g674.t1
Scaffold_10	AUGUSTUS	stop_codon	1317475	1317477	.	-	0	transcript_id "g674.t1"; gene_id "g674";
Scaffold_10	AUGUSTUS	CDS	1317475	1318068	0.27	-	0	transcript_id "g674.t1"; gene_id "g674";
Scaffold_10	AUGUSTUS	CDS	1318481	1318582	0.58	-	0	transcript_id "g674.t1"; gene_id "g674";
Scaffold_10	AUGUSTUS	start_codon	1318580	1318582	.	-	0	transcript_id "g674.t1"; gene_id "g674";
# protein sequence = [MDEEEVLSVDDIDIESRPDSPQEPDKRTGTGLTLNDVRLVTSNAKLFNPPGTIYHTEAEKLEIWALDHIEKASGTVIQ
# YELDWNLDPEKDNAGEVNVDDDNNSIVPSAASADMSTPGPSDLLEIAGVRRSTRGPYRKTNATNTTTQKGVLESIDAEGRLPGSKDGLGAFPPGSDLA
# KTMLDLKLKGTLHNLLGLNNSSNFVFRKAIQDEERENAYRKGGASISFRRKSRLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g674
###
# start gene g675
Scaffold_10	AUGUSTUS	gene	1322640	1323221	0.72	-	.	g675
Scaffold_10	AUGUSTUS	transcript	1322640	1323221	0.72	-	.	g675.t1
Scaffold_10	AUGUSTUS	stop_codon	1322640	1322642	.	-	0	transcript_id "g675.t1"; gene_id "g675";
Scaffold_10	AUGUSTUS	CDS	1322640	1323221	0.72	-	0	transcript_id "g675.t1"; gene_id "g675";
Scaffold_10	AUGUSTUS	start_codon	1323219	1323221	.	-	0	transcript_id "g675.t1"; gene_id "g675";
# protein sequence = [MYNVGSSSSFIVEDSSPLISYSPAGAWSDSPANDTLLSVSSRNVVASAYLKQHLVLFWLFIPHRLHSRRDSYYNVHWY
# NIVHDLCLRKPINSSFYLGIGITIFGGHRQNYGTYQISVDGQTVVASESSAGQDVFQQVLGTVSGLSNEKHTAVVTSSSVSSIDIDYVNVQTQIGETG
# CVFYFIVMSTLNLIFIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g675
###
# start gene g676
Scaffold_10	AUGUSTUS	gene	1324985	1325670	0.87	+	.	g676
Scaffold_10	AUGUSTUS	transcript	1324985	1325670	0.87	+	.	g676.t1
Scaffold_10	AUGUSTUS	start_codon	1324985	1324987	.	+	0	transcript_id "g676.t1"; gene_id "g676";
Scaffold_10	AUGUSTUS	CDS	1324985	1325005	0.9	+	0	transcript_id "g676.t1"; gene_id "g676";
Scaffold_10	AUGUSTUS	CDS	1325164	1325670	0.93	+	0	transcript_id "g676.t1"; gene_id "g676";
Scaffold_10	AUGUSTUS	stop_codon	1325668	1325670	.	+	0	transcript_id "g676.t1"; gene_id "g676";
# protein sequence = [MGRRTITNYKGTCGKDLDALWGLSEVLNATPQWHAYGLILGRGDDDDEDNDGPLKLSGKIKKPLAITYGGESDDSMPS
# LQEVSDSDDSDDWSENESEDDDDDDDDGSDDESGYDTDQEDTVRDLLREAMDAVTAVNWQEPPVANDELDPFNAEDSKRNSFLKLLGSLRGERESNY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g676
###
# start gene g677
Scaffold_10	AUGUSTUS	gene	1325840	1326463	0.98	+	.	g677
Scaffold_10	AUGUSTUS	transcript	1325840	1326463	0.98	+	.	g677.t1
Scaffold_10	AUGUSTUS	start_codon	1325840	1325842	.	+	0	transcript_id "g677.t1"; gene_id "g677";
Scaffold_10	AUGUSTUS	CDS	1325840	1326463	0.98	+	0	transcript_id "g677.t1"; gene_id "g677";
Scaffold_10	AUGUSTUS	stop_codon	1326461	1326463	.	+	0	transcript_id "g677.t1"; gene_id "g677";
# protein sequence = [MISVDRPKAGVTLEEVSDEDDISHAKKKKKKKPKKKKKKPTAAADGEAPVEDNAATAPPPIPSATVSPAPNAQSKAPA
# KPKAATAASQSTTSFYPSETIAQSARSYLQSEQLDVLKTKTKSRSAQASLFSSTKGLFDKFGVGQEKKKDTSADKKERRNWFANLGKRTRTYMHQILN
# TADDETQGKAGMKWDIFVKVSHTFSQHRDDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g677
###
# start gene g678
Scaffold_10	AUGUSTUS	gene	1327269	1328314	0.66	-	.	g678
Scaffold_10	AUGUSTUS	transcript	1327269	1328314	0.66	-	.	g678.t1
Scaffold_10	AUGUSTUS	stop_codon	1327269	1327271	.	-	0	transcript_id "g678.t1"; gene_id "g678";
Scaffold_10	AUGUSTUS	CDS	1327269	1327975	0.82	-	2	transcript_id "g678.t1"; gene_id "g678";
Scaffold_10	AUGUSTUS	CDS	1328065	1328314	0.66	-	0	transcript_id "g678.t1"; gene_id "g678";
Scaffold_10	AUGUSTUS	start_codon	1328312	1328314	.	-	0	transcript_id "g678.t1"; gene_id "g678";
# protein sequence = [MSHSTTTTATYTLVKYSRSYPNSAQDANSEWQHYTKPTLKLILDVKKSLTTGELESVFLRIVWSMENSYAQDQSEVSF
# VSKFSHRQQGGLPLKAVYRDSVVGIRYINASNGVSVSKYLGQLRRQADSAKTFRRFQITFSSANDASQFIDSISSVCPCKANSTAGPPNIPQMMSAPS
# MVPPVLHHPIAKPPILNNSAYAQTVPVSAAFPLSHMHNNNIPLNQTDVFFPVTPSQRLSTYPTMHFPYPGAPYASVSGMPMPSSQMLMDHPNQIQSSS
# PPLLPPPSSQPPFQFGGSQTHSQSAPFTPTPTQSEHPHYSSRLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g678
###
# start gene g679
Scaffold_10	AUGUSTUS	gene	1331025	1331658	0.62	-	.	g679
Scaffold_10	AUGUSTUS	transcript	1331025	1331658	0.62	-	.	g679.t1
Scaffold_10	AUGUSTUS	stop_codon	1331025	1331027	.	-	0	transcript_id "g679.t1"; gene_id "g679";
Scaffold_10	AUGUSTUS	CDS	1331025	1331543	1	-	0	transcript_id "g679.t1"; gene_id "g679";
Scaffold_10	AUGUSTUS	CDS	1331650	1331658	0.62	-	0	transcript_id "g679.t1"; gene_id "g679";
Scaffold_10	AUGUSTUS	start_codon	1331656	1331658	.	-	0	transcript_id "g679.t1"; gene_id "g679";
# protein sequence = [MQAAQQQYAAYAASYQGGGGYPGGAAGSYGGGYVPPPPGDAPPPPPGDSQPPPPPPSGGGGDPSAVTAASAGGTPQEQ
# YAAYWFVFSFRLYSPTNSTPHHFRYRAAYGYDVNSPEFKTWVAEQAKQTEQYYAQQQAQTQGVYPGYDPSVGAGGAAAPPPPPPPDSQAPPPPPPPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g679
###
# start gene g680
Scaffold_10	AUGUSTUS	gene	1334336	1335247	0.41	+	.	g680
Scaffold_10	AUGUSTUS	transcript	1334336	1335247	0.41	+	.	g680.t1
Scaffold_10	AUGUSTUS	start_codon	1334336	1334338	.	+	0	transcript_id "g680.t1"; gene_id "g680";
Scaffold_10	AUGUSTUS	CDS	1334336	1335247	0.41	+	0	transcript_id "g680.t1"; gene_id "g680";
Scaffold_10	AUGUSTUS	stop_codon	1335245	1335247	.	+	0	transcript_id "g680.t1"; gene_id "g680";
# protein sequence = [MYQASWRPTPVDNVPPFPSQGGPLQSSLVPPPPSPSVSLYQLSLKNSGAGGSTTSLDGTPTKPAGAYRPPGARGNATP
# AIFKREDEGGFSRTPSGQNTPVRGYSKSPAPPGSAGMNGPGGPGGQGRGGRYVPGAPPPTNQNQNPSRPGALPRGDSGGQGQGQGQGPGKGDGQARKR
# NKGGKNKGGEGEGGGREGSVGRGQQGKNGANGQQRASGNGIQQNANTNGNSKKPTSIDLNGVNGKITTSTSTNAANGDGNVAKAALASAALTPLDTAL
# STPVTPGLDSALDPIAKKVRNLNKKVRFQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g680
###
# start gene g681
Scaffold_10	AUGUSTUS	gene	1336553	1337349	0.54	+	.	g681
Scaffold_10	AUGUSTUS	transcript	1336553	1337349	0.54	+	.	g681.t1
Scaffold_10	AUGUSTUS	start_codon	1336553	1336555	.	+	0	transcript_id "g681.t1"; gene_id "g681";
Scaffold_10	AUGUSTUS	CDS	1336553	1336852	0.54	+	0	transcript_id "g681.t1"; gene_id "g681";
Scaffold_10	AUGUSTUS	CDS	1336909	1337349	1	+	0	transcript_id "g681.t1"; gene_id "g681";
Scaffold_10	AUGUSTUS	stop_codon	1337347	1337349	.	+	0	transcript_id "g681.t1"; gene_id "g681";
# protein sequence = [MKVPLILTISVSLREGWVGGGFGLTHGMILGNVHFLSQSAAQAANLSYVDSSGRVIIKVDNTTNGAGDSSFGRNSVYL
# ESNELMDIGSLLIFDANHIPFGCSVWPSLFTQGQVWPQQGEIDVIEQVNLATDNRYSLHVGVDNCNQPTSVASNQTGTISTAVGDISNCTVTPTTGQN
# TVGCVTTETKSNSFGSGFASQGGGVYAMLWDTNGIALWYFARGSVPSDIGVSSSPDPTTWGEASAWYQDP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g681
###
# start gene g682
Scaffold_10	AUGUSTUS	gene	1343570	1345554	0.47	+	.	g682
Scaffold_10	AUGUSTUS	transcript	1343570	1345554	0.47	+	.	g682.t1
Scaffold_10	AUGUSTUS	start_codon	1343570	1343572	.	+	0	transcript_id "g682.t1"; gene_id "g682";
Scaffold_10	AUGUSTUS	CDS	1343570	1343782	0.66	+	0	transcript_id "g682.t1"; gene_id "g682";
Scaffold_10	AUGUSTUS	CDS	1343963	1344224	0.6	+	0	transcript_id "g682.t1"; gene_id "g682";
Scaffold_10	AUGUSTUS	CDS	1344299	1345554	0.84	+	2	transcript_id "g682.t1"; gene_id "g682";
Scaffold_10	AUGUSTUS	stop_codon	1345552	1345554	.	+	0	transcript_id "g682.t1"; gene_id "g682";
# protein sequence = [MSSSSASRSPSPHTPSPGPVDQVAVQTDFDRPSWYNTSPEEPSWTSNLKSEDTNMLQLDDLIEQHAYEESVKVVHPPK
# ESCYKYVSTLLWVISSSDLAFSLPIMFPSIPESGTKSRVETQVRVTVDLADPSSSIDPHIYDRVGSWKWLKLPPGTATKRHPDSQDMLFLTVSVSCAS
# PPHNRVLSCSSCQTREAKRVAKKIAARVRPARNSDVDEEYPDDANNSGPARKSAALLEDTSSIIQFNCAEVLDFSTGSAVLPIRITCYCRHHREKTGF
# NVNLVMMDSAGRTVGVGSSSPIMITDDHKTTSAPKHADLQPYDWCQPGGSNTTSGASSPVGIVKKAPSKRKTDVGGKKRVKPYDSSAKPNRSSRETSV
# VSNAPSPTASEPLSITTAPSPPSYPPLTSADPLSATEIPSLQFSTQESDSSPDVLTTPLDIDIPMLPESITNLEDLFTAAGVAPDATMIPPSVTSASL
# PFLFTPPPTTISMPIIHRLIPNCGPTHGGIEVTVLGANFHPTLQFNCVFGDMPASSTQRWSDNTLVCILPPRATAGMVSVWFDGFPKVEEQPPSFFTY
# SDESDRAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g682
###
# start gene g683
Scaffold_10	AUGUSTUS	gene	1345637	1346612	0.28	+	.	g683
Scaffold_10	AUGUSTUS	transcript	1345637	1346612	0.28	+	.	g683.t1
Scaffold_10	AUGUSTUS	start_codon	1345637	1345639	.	+	0	transcript_id "g683.t1"; gene_id "g683";
Scaffold_10	AUGUSTUS	CDS	1345637	1345764	0.3	+	0	transcript_id "g683.t1"; gene_id "g683";
Scaffold_10	AUGUSTUS	CDS	1345823	1346612	0.37	+	1	transcript_id "g683.t1"; gene_id "g683";
Scaffold_10	AUGUSTUS	stop_codon	1346610	1346612	.	+	0	transcript_id "g683.t1"; gene_id "g683";
# protein sequence = [MTGKIEDAKNVAMRIVGAGEGTDSQNSNEQSASNSMNMQLSTTEDFESLIADFLKLIDTPVDHPSAQVVSASKALSHM
# TKSGQSLLHLSAFLGYATIVEFLVKHGIDMDLRDRNMGILLCISLPWLARGIVSRSFSRQERIGRLNALGKTAEEVVAKGMGKTVFEEILEEISDSQE
# GVASDDEEAEWGDVEEEVEVKPVVNSSRRAKMDRRARRSRAASRKASREELRSHHTSKTPSMTPLATAVPVDGKKEKEAAAVDDEKQALSFIDMLQRT
# MAQLPGAPQLPCLTSPSSPVCLQCLGKRYTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g683
###
# start gene g684
Scaffold_10	AUGUSTUS	gene	1348273	1351766	0.3	-	.	g684
Scaffold_10	AUGUSTUS	transcript	1348273	1351766	0.3	-	.	g684.t1
Scaffold_10	AUGUSTUS	stop_codon	1348273	1348275	.	-	0	transcript_id "g684.t1"; gene_id "g684";
Scaffold_10	AUGUSTUS	CDS	1348273	1349007	0.94	-	0	transcript_id "g684.t1"; gene_id "g684";
Scaffold_10	AUGUSTUS	CDS	1350820	1350838	0.32	-	1	transcript_id "g684.t1"; gene_id "g684";
Scaffold_10	AUGUSTUS	CDS	1351207	1351766	0.75	-	0	transcript_id "g684.t1"; gene_id "g684";
Scaffold_10	AUGUSTUS	start_codon	1351764	1351766	.	-	0	transcript_id "g684.t1"; gene_id "g684";
# protein sequence = [MAAPPTRPHIVLRPSTFFKPSDTVDDDAWDSASDSEEPAQSTFTFPSWSRASTTAPKPVPRPITSDNPSSTSLAFSYT
# HLNAPNPSSYPPRNTDTPQPPKNGWTIVRTVPGRRSSTDTRSSNQDDSFDHVPSTDGDADVEGDMILGDLDPEPAAGEPSRTAPENSKSTSVRTDAET
# IVNGTSLWALWATYPSPLDELPDFEGLPNPNPTGFPILPADGLLFPAIPKPPNPPNFRAVPEVELVEGLLFEGIPKTLGDGAPKRFVVDPEVEGGVPK
# LKAEAGGGFEPKRLMVVLDSVCLGVLSVGFEVDVAKDPAGGNEKGFEEAFAEGKENGEDNDLPLSSFGVNPPPVTVEDSASFAPKPENDEGGVGIENE
# PTLAVEREVRLDLLSFLDFSSYSFCTLARNVLYLSRRKETSANESLSTDFVMAVSIEAFSPRRDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g684
###
# start gene g685
Scaffold_10	AUGUSTUS	gene	1352730	1353191	0.98	-	.	g685
Scaffold_10	AUGUSTUS	transcript	1352730	1353191	0.98	-	.	g685.t1
Scaffold_10	AUGUSTUS	stop_codon	1352730	1352732	.	-	0	transcript_id "g685.t1"; gene_id "g685";
Scaffold_10	AUGUSTUS	CDS	1352730	1353191	0.98	-	0	transcript_id "g685.t1"; gene_id "g685";
Scaffold_10	AUGUSTUS	start_codon	1353189	1353191	.	-	0	transcript_id "g685.t1"; gene_id "g685";
# protein sequence = [MEQTSPRKKRKTHSDDIQVGDHTWQDHIPGFDDDEEDDVQVLNDELLSSAETSSSRRSSAPENAIIHASIPISAKASG
# KKRFIDSQTFCPVCGTELDTNDNRKLNSHVDFCLSREAIQEAEGHSAEAEAKTRLQAQAWSRFLDSKTKPRGKRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g685
###
# start gene g686
Scaffold_10	AUGUSTUS	gene	1362349	1363021	0.27	-	.	g686
Scaffold_10	AUGUSTUS	transcript	1362349	1363021	0.27	-	.	g686.t1
Scaffold_10	AUGUSTUS	stop_codon	1362349	1362351	.	-	0	transcript_id "g686.t1"; gene_id "g686";
Scaffold_10	AUGUSTUS	CDS	1362349	1362632	0.59	-	2	transcript_id "g686.t1"; gene_id "g686";
Scaffold_10	AUGUSTUS	CDS	1362805	1362833	0.29	-	1	transcript_id "g686.t1"; gene_id "g686";
Scaffold_10	AUGUSTUS	CDS	1362978	1363021	0.54	-	0	transcript_id "g686.t1"; gene_id "g686";
Scaffold_10	AUGUSTUS	start_codon	1363019	1363021	.	-	0	transcript_id "g686.t1"; gene_id "g686";
# protein sequence = [MASLRLATSAARRAPSTDVVQVNLFSGGFATVHPNNKLTINAVEAAPLEDFSVEVCTSGPSDIFLSRTNSSLSFLQSI
# RVNLQEALKVASGNGSEEDKLEARIEAEVYESLQYALGSK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g686
###
# start gene g687
Scaffold_10	AUGUSTUS	gene	1364244	1364447	0.63	+	.	g687
Scaffold_10	AUGUSTUS	transcript	1364244	1364447	0.63	+	.	g687.t1
Scaffold_10	AUGUSTUS	start_codon	1364244	1364246	.	+	0	transcript_id "g687.t1"; gene_id "g687";
Scaffold_10	AUGUSTUS	CDS	1364244	1364447	0.63	+	0	transcript_id "g687.t1"; gene_id "g687";
Scaffold_10	AUGUSTUS	stop_codon	1364445	1364447	.	+	0	transcript_id "g687.t1"; gene_id "g687";
# protein sequence = [MPVVSSTEDTTCDASLENDNARTSESDYEEAMDISPDDERIPSTTAASPGNAAPKFSRRMPGIVFQH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g687
###
# start gene g688
Scaffold_10	AUGUSTUS	gene	1367493	1368730	0.63	-	.	g688
Scaffold_10	AUGUSTUS	transcript	1367493	1368730	0.63	-	.	g688.t1
Scaffold_10	AUGUSTUS	stop_codon	1367493	1367495	.	-	0	transcript_id "g688.t1"; gene_id "g688";
Scaffold_10	AUGUSTUS	CDS	1367493	1367950	0.91	-	2	transcript_id "g688.t1"; gene_id "g688";
Scaffold_10	AUGUSTUS	CDS	1368148	1368730	0.68	-	0	transcript_id "g688.t1"; gene_id "g688";
Scaffold_10	AUGUSTUS	start_codon	1368728	1368730	.	-	0	transcript_id "g688.t1"; gene_id "g688";
# protein sequence = [MQESKSVYRFEDSEKLHSTRLEYDMTTPIANLSKPLPPPVEERSLPALPSSSECDIDDASLFSCATPLETSHNFFNVQ
# PELEVLSCSMPPIIAHSLSVPCTSPQSLRSTSIANLSKRSMVKQRLAQMEQDHSQNSPKFPPASPRRGRTLPSPFSPSKDQHAEFKGATLVMQQTNTS
# DSIVDSYSYSDQTVPASTADLIAAQEVQNSKQTVALNHLRHTLSGVDKKISNTDRTLLSIDQRLEGLQSCIDSVVSKSSSDKSDNAHAQDLADIHESL
# HGLQALLTSNVVDILKGMEEAESKSRPSPESITSQSTVASMEIQAQVRFMIIRDHVKTDSPCLVHRHTYTLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g688
###
# start gene g689
Scaffold_10	AUGUSTUS	gene	1373897	1375135	0.72	+	.	g689
Scaffold_10	AUGUSTUS	transcript	1373897	1375135	0.72	+	.	g689.t1
Scaffold_10	AUGUSTUS	start_codon	1373897	1373899	.	+	0	transcript_id "g689.t1"; gene_id "g689";
Scaffold_10	AUGUSTUS	CDS	1373897	1375135	0.72	+	0	transcript_id "g689.t1"; gene_id "g689";
Scaffold_10	AUGUSTUS	stop_codon	1375133	1375135	.	+	0	transcript_id "g689.t1"; gene_id "g689";
# protein sequence = [MATAISSTLSAVPSMVSSSASSSDCSRVVRFDDECVLIPELQPIKRPIIITKSYTLPLWRRKTSDDELSEEPSSPVLR
# VPFPKSVSLIIVCRPSPLIACQFQGENLEVLKSWSRSNNSAKSMSRSQISISSCAEGVPHRKLERRPSLPSSPLLDNAGKPLPTIPLRSCCPDCVSIT
# EECLKEGEAWIEKFTRGARRRRSSSGESDCGFTPVASMHQGHKDIAVVRLGSSASINVDEVDKRRRSREIDAVPDFLATSPSSPPITPHVPSAIIEED
# EDQLFPLPSPRRSPNSSPANSTSASPMPSPNASSSHLSPAASSNSPTIPEEGILAKSLMRKGRCEKGLLTPEADAGPTLSSISISVSSEDIPSLSLSV
# SPDATSSPTSPTFVESARNMSPNLPPTPTSSRQQISFTIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g689
###
# start gene g690
Scaffold_10	AUGUSTUS	gene	1377691	1378467	0.98	+	.	g690
Scaffold_10	AUGUSTUS	transcript	1377691	1378467	0.98	+	.	g690.t1
Scaffold_10	AUGUSTUS	start_codon	1377691	1377693	.	+	0	transcript_id "g690.t1"; gene_id "g690";
Scaffold_10	AUGUSTUS	CDS	1377691	1378467	0.98	+	0	transcript_id "g690.t1"; gene_id "g690";
Scaffold_10	AUGUSTUS	stop_codon	1378465	1378467	.	+	0	transcript_id "g690.t1"; gene_id "g690";
# protein sequence = [MKTSQATITFAEICGLGLDIRFTDSAEPLFIDVEGDNFETLFVISTSQPPGSAAQTRLASTGPRKRLREDTPAESSRF
# KKPMKAVVQSTTDRMSIARDTTPASDRLSSSRQMPPPATPPSPGHQHSSHHTLHAPQTSASVAPKLSQELPLFLPGSSQLSILDEVALRESGLGIEHM
# SAEEFNDMFEAHGEEVNIEEVPPNPNSTAQTDRIGGGLEEDAMFTPTQTGDTLSNDEPRVSFLGNCAMCLVLNVYPGVLSAF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g690
###
# start gene g691
Scaffold_10	AUGUSTUS	gene	1381563	1382171	0.38	+	.	g691
Scaffold_10	AUGUSTUS	transcript	1381563	1382171	0.38	+	.	g691.t1
Scaffold_10	AUGUSTUS	start_codon	1381563	1381565	.	+	0	transcript_id "g691.t1"; gene_id "g691";
Scaffold_10	AUGUSTUS	CDS	1381563	1382171	0.38	+	0	transcript_id "g691.t1"; gene_id "g691";
Scaffold_10	AUGUSTUS	stop_codon	1382169	1382171	.	+	0	transcript_id "g691.t1"; gene_id "g691";
# protein sequence = [MFNISVCCRSLLMVIAVEITGIRDLLMNYISFESAICVLHKVSVIGWPTNIPWKYLQKLAAEEVRALHASWSDGKTHW
# YCMTASEHRSLVCHLTTEGKLDPKERKKRKPSKSKKHIDGNELLNTASNSSSDNNDNEPSSSISGPSNTRGVGKNAAQKVRMNHPSSKAAGPSAKHTE
# PLKETHAKGKGAESDRGNKGGKGKGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g691
###
# start gene g692
Scaffold_10	AUGUSTUS	gene	1383453	1384619	0.93	+	.	g692
Scaffold_10	AUGUSTUS	transcript	1383453	1384619	0.93	+	.	g692.t1
Scaffold_10	AUGUSTUS	start_codon	1383453	1383455	.	+	0	transcript_id "g692.t1"; gene_id "g692";
Scaffold_10	AUGUSTUS	CDS	1383453	1384619	0.93	+	0	transcript_id "g692.t1"; gene_id "g692";
Scaffold_10	AUGUSTUS	stop_codon	1384617	1384619	.	+	0	transcript_id "g692.t1"; gene_id "g692";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g692
###
# start gene g693
Scaffold_10	AUGUSTUS	gene	1391347	1392930	0.97	+	.	g693
Scaffold_10	AUGUSTUS	transcript	1391347	1392930	0.97	+	.	g693.t1
Scaffold_10	AUGUSTUS	start_codon	1391347	1391349	.	+	0	transcript_id "g693.t1"; gene_id "g693";
Scaffold_10	AUGUSTUS	CDS	1391347	1392930	0.97	+	0	transcript_id "g693.t1"; gene_id "g693";
Scaffold_10	AUGUSTUS	stop_codon	1392928	1392930	.	+	0	transcript_id "g693.t1"; gene_id "g693";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLISIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGESTDPLTVRQQEKLPERRVSPAV
# SEQSRASSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEK
# LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL
# YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR
# HMHQLLVRSEESEAMFVFAGDPTSDATSGIRHSDAVGGTFWIESRKSFGIPSQTGRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g693
###
# start gene g694
Scaffold_10	AUGUSTUS	gene	1393706	1394980	0.94	+	.	g694
Scaffold_10	AUGUSTUS	transcript	1393706	1394980	0.94	+	.	g694.t1
Scaffold_10	AUGUSTUS	start_codon	1393706	1393708	.	+	0	transcript_id "g694.t1"; gene_id "g694";
Scaffold_10	AUGUSTUS	CDS	1393706	1394980	0.94	+	0	transcript_id "g694.t1"; gene_id "g694";
Scaffold_10	AUGUSTUS	stop_codon	1394978	1394980	.	+	0	transcript_id "g694.t1"; gene_id "g694";
# protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE
# GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG
# ELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKD
# KCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKG
# VAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKCCKDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g694
###
# start gene g695
Scaffold_10	AUGUSTUS	gene	1397218	1397718	0.74	+	.	g695
Scaffold_10	AUGUSTUS	transcript	1397218	1397718	0.74	+	.	g695.t1
Scaffold_10	AUGUSTUS	start_codon	1397218	1397220	.	+	0	transcript_id "g695.t1"; gene_id "g695";
Scaffold_10	AUGUSTUS	CDS	1397218	1397718	0.74	+	0	transcript_id "g695.t1"; gene_id "g695";
Scaffold_10	AUGUSTUS	stop_codon	1397716	1397718	.	+	0	transcript_id "g695.t1"; gene_id "g695";
# protein sequence = [MSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKI
# FTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEHPMSDTSGRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g695
###
# start gene g696
Scaffold_10	AUGUSTUS	gene	1399115	1400101	1	+	.	g696
Scaffold_10	AUGUSTUS	transcript	1399115	1400101	1	+	.	g696.t1
Scaffold_10	AUGUSTUS	start_codon	1399115	1399117	.	+	0	transcript_id "g696.t1"; gene_id "g696";
Scaffold_10	AUGUSTUS	CDS	1399115	1400101	1	+	0	transcript_id "g696.t1"; gene_id "g696";
Scaffold_10	AUGUSTUS	stop_codon	1400099	1400101	.	+	0	transcript_id "g696.t1"; gene_id "g696";
# protein sequence = [MPSDITSDRAPSLCPILEGALQSVRNRVSPIHGIPPSNGWTNGTCKSVSRSIPPNLLRLRPRRLGPPAPDSEFVYNNT
# PNTTTGVSPFFANKGYHPKLSITLERVQGAEVNEYAANLKELHTYLQERIRTANEVYTKYANQKRQEAPDWKEGDRVWLNMENVKTRRPMKKLDHKWT
# GPYSILSQVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFPDKFRRQNSPPPPIFVKGESEHFVESILDSKPIKGKPEEVEYLVKWEGYDEDFNSWVGWE
# GMAGSLELMKQWHREHNRKRKPKRDQWELLEKQAEDDRGEAVGSTGGTGNEREK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g696
###
# start gene g697
Scaffold_10	AUGUSTUS	gene	1401218	1401977	0.69	-	.	g697
Scaffold_10	AUGUSTUS	transcript	1401218	1401977	0.69	-	.	g697.t1
Scaffold_10	AUGUSTUS	stop_codon	1401218	1401220	.	-	0	transcript_id "g697.t1"; gene_id "g697";
Scaffold_10	AUGUSTUS	CDS	1401218	1401525	0.75	-	2	transcript_id "g697.t1"; gene_id "g697";
Scaffold_10	AUGUSTUS	CDS	1401689	1401977	0.69	-	0	transcript_id "g697.t1"; gene_id "g697";
Scaffold_10	AUGUSTUS	start_codon	1401975	1401977	.	-	0	transcript_id "g697.t1"; gene_id "g697";
# protein sequence = [MRPYPRSQASSALRVENDRLKAEVEEFRTLLAQSRGQVSTLTSLLRDTSSSLDLRSQELEASRWSLEEVARDRVEYQR
# VLSQFQAIEAELPEPAVRVVVSSDAYAELDSANARALRQQDRLEELEEMVCSYRDRAHVAEGLIRQYPEDEGLYEVELPSLSEVQRKLDASEALVRRL
# ATFAHRLYRADPAICSITITGM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g697
###
# start gene g698
Scaffold_10	AUGUSTUS	gene	1404384	1405352	0.99	+	.	g698
Scaffold_10	AUGUSTUS	transcript	1404384	1405352	0.99	+	.	g698.t1
Scaffold_10	AUGUSTUS	start_codon	1404384	1404386	.	+	0	transcript_id "g698.t1"; gene_id "g698";
Scaffold_10	AUGUSTUS	CDS	1404384	1405352	0.99	+	0	transcript_id "g698.t1"; gene_id "g698";
Scaffold_10	AUGUSTUS	stop_codon	1405350	1405352	.	+	0	transcript_id "g698.t1"; gene_id "g698";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPP
# FGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAI
# SVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGL
# SRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATEPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g698
###
# start gene g699
Scaffold_10	AUGUSTUS	gene	1405637	1407364	0.93	+	.	g699
Scaffold_10	AUGUSTUS	transcript	1405637	1407364	0.93	+	.	g699.t1
Scaffold_10	AUGUSTUS	start_codon	1405637	1405639	.	+	0	transcript_id "g699.t1"; gene_id "g699";
Scaffold_10	AUGUSTUS	CDS	1405637	1407364	0.93	+	0	transcript_id "g699.t1"; gene_id "g699";
Scaffold_10	AUGUSTUS	stop_codon	1407362	1407364	.	+	0	transcript_id "g699.t1"; gene_id "g699";
# protein sequence = [MVDCGATALFLNQDFATRNHVTCAPLHKPIDVFNIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGL
# PWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLNEGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAG
# ILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEE
# NLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPK
# VMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAA
# VRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQ
# DDGQWHP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g699
###
# start gene g700
Scaffold_10	AUGUSTUS	gene	1410354	1412007	0.65	+	.	g700
Scaffold_10	AUGUSTUS	transcript	1410354	1412007	0.65	+	.	g700.t1
Scaffold_10	AUGUSTUS	start_codon	1410354	1410356	.	+	0	transcript_id "g700.t1"; gene_id "g700";
Scaffold_10	AUGUSTUS	CDS	1410354	1410438	0.72	+	0	transcript_id "g700.t1"; gene_id "g700";
Scaffold_10	AUGUSTUS	CDS	1410560	1412007	0.73	+	2	transcript_id "g700.t1"; gene_id "g700";
Scaffold_10	AUGUSTUS	stop_codon	1412005	1412007	.	+	0	transcript_id "g700.t1"; gene_id "g700";
# protein sequence = [MCLLIITYDYDTQYISVIIWDQFASAPLILAPRRGQPPVVTPARGQSITRIESPILQAIARRTGKQPQPRAASESPRD
# PPPHFDLDTGDHDDQDPPVDPDDPGVDNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGDPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETL
# GTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILNPDLDSLPAWTSSFMALVKD
# LQDNFGVYDAQGEAEDALGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLAAYRLEVLRIDNRYWKREETKKR
# EAGKPFIARNPKKGSSDFKTGSTNQHNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNLGADGKVLPSERERRMKNNLCLFCG
# GKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g700
###
# start gene g701
Scaffold_10	AUGUSTUS	gene	1414362	1415659	0.46	+	.	g701
Scaffold_10	AUGUSTUS	transcript	1414362	1415659	0.46	+	.	g701.t1
Scaffold_10	AUGUSTUS	start_codon	1414362	1414364	.	+	0	transcript_id "g701.t1"; gene_id "g701";
Scaffold_10	AUGUSTUS	CDS	1414362	1414690	0.46	+	0	transcript_id "g701.t1"; gene_id "g701";
Scaffold_10	AUGUSTUS	CDS	1414741	1415659	0.98	+	1	transcript_id "g701.t1"; gene_id "g701";
Scaffold_10	AUGUSTUS	stop_codon	1415657	1415659	.	+	0	transcript_id "g701.t1"; gene_id "g701";
# protein sequence = [MPFSLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTLEEHQEHVKEVLRRLRKHRLYANPDKCEFNMDTVEYL
# GYILSPDGLTMSKEKVQTILEWHVPRKVKDIHDIVVPMTRLTRKGAPWIWDNNCQEAFENLKIAFTSVPILAHWEPNRPIIVETDASDYAIAAILSIQ
# TVDGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKDLEYFSTTKILTCQQVRWSEYLHQFNMVIRFRPGKLGEKP
# DSITRRWDVYPKEGDIGYVQVNPHNFRPIFTNEQLTTSLRATFLEGPMLRASIIMDIEALHQAIILALPKDPSSVVGLELAKDPSNERWSLGSDRLLR
# LDDRIYVPNHGDLRLQVLRYFHDHPLSHFGQNRTLEAVRRQYT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g701
###
# start gene g702
Scaffold_10	AUGUSTUS	gene	1415795	1416986	0.77	+	.	g702
Scaffold_10	AUGUSTUS	transcript	1415795	1416986	0.77	+	.	g702.t1
Scaffold_10	AUGUSTUS	start_codon	1415795	1415797	.	+	0	transcript_id "g702.t1"; gene_id "g702";
Scaffold_10	AUGUSTUS	CDS	1415795	1416458	0.77	+	0	transcript_id "g702.t1"; gene_id "g702";
Scaffold_10	AUGUSTUS	CDS	1416511	1416986	0.93	+	2	transcript_id "g702.t1"; gene_id "g702";
Scaffold_10	AUGUSTUS	stop_codon	1416984	1416986	.	+	0	transcript_id "g702.t1"; gene_id "g702";
# protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSDHGSEFVSAFFRAHGKA
# LSMELHYTSGYHPEADGQTEHVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNTSTGITPFFANKGYHPNITVWPEVDMKSDLARDFIINLDEL
# HVFLREEILLAQSCYKEQADRKRISHPEFPIGSEVFVLAKHIRSTLDLVPCLTSSSSWTILRRIHPVFHVSQLEPVTPNPFPNHTQSPPPPIEVDGEE
# EYNIAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPVLRSCTPRNRAKATGCLSAEDEWDSSEVINNTAVTP
# LVPGERE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g702
###
# start gene g703
Scaffold_10	AUGUSTUS	gene	1418102	1419856	1	+	.	g703
Scaffold_10	AUGUSTUS	transcript	1418102	1419856	1	+	.	g703.t1
Scaffold_10	AUGUSTUS	start_codon	1418102	1418104	.	+	0	transcript_id "g703.t1"; gene_id "g703";
Scaffold_10	AUGUSTUS	CDS	1418102	1419856	1	+	0	transcript_id "g703.t1"; gene_id "g703";
Scaffold_10	AUGUSTUS	stop_codon	1419854	1419856	.	+	0	transcript_id "g703.t1"; gene_id "g703";
# protein sequence = [MASNGAVPPPIPEVSADLKFDGGVKVSWTPVKRRIVNSLKTQGLLGYTDGTITKPSPIIITISPPTRSPSLEAGSETA
# PTPSPEPTRATAIFSLNPSLEEWIFRNDRARGIIESHVDDLPSLMPDVDEKTAKEVLDTLENEFARKDGMRKVLTERNLRSLTFRETIPIDEFFNQLR
# ALRKDAVEAGNTITDSQFREIAIAAFPTNAFDNIIQNITANTSLYSTAALVIQQISFQYSRVENRPDAVVSGDRISQAHTASTTPISPHAALLSRIEQ
# LESMIAGKMARSGNGDKKCYNCGRVGHLKDECFRKGGGKEGQYPSWWRGKKDDTVNQNPTSSMAIGEPTLHYAMAASDSPHGTGDLYADSGATDHFFR
# DRNDFMTYVKCERMGQSSEISTGLVIKGVGKAKKTVVENGKIMVLIFEGALHCPNISSDLISIARLDKLGYQIHFGNGRVKFYTPGGTHFLTGKGSNG
# LYKIEEAKTTALTTKSRSLHRPVDLSTWHRRLAHAGNFRLDLLKDNNLVDGFAVAKDTMAGEGKCENCLMGGAVRRPFDAHVEVEKTAGTSPSRSYRA
# YENDVERRILLLTSHC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g703
###
# start gene g704
Scaffold_10	AUGUSTUS	gene	1426056	1426547	0.49	+	.	g704
Scaffold_10	AUGUSTUS	transcript	1426056	1426547	0.49	+	.	g704.t1
Scaffold_10	AUGUSTUS	start_codon	1426056	1426058	.	+	0	transcript_id "g704.t1"; gene_id "g704";
Scaffold_10	AUGUSTUS	CDS	1426056	1426547	0.49	+	0	transcript_id "g704.t1"; gene_id "g704";
Scaffold_10	AUGUSTUS	stop_codon	1426545	1426547	.	+	0	transcript_id "g704.t1"; gene_id "g704";
# protein sequence = [MSASRTTTTTISATTAGPSRSRTTNSPPADTVDNDEEELEEDDDEAIRRAEEKVRRMKARKAAAAAKKKAEEEAARKA
# AEEAQRQKEAAAWELEERRRVMAAAATARSQRGSSPGETSASNRHPVVEIRQRKDKAKAKTKAQVSTEKTLVTAYLLTFPFIACR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g704
###
# start gene g705
Scaffold_10	AUGUSTUS	gene	1431625	1432382	0.64	-	.	g705
Scaffold_10	AUGUSTUS	transcript	1431625	1432382	0.64	-	.	g705.t1
Scaffold_10	AUGUSTUS	stop_codon	1431625	1431627	.	-	0	transcript_id "g705.t1"; gene_id "g705";
Scaffold_10	AUGUSTUS	CDS	1431625	1432141	0.7	-	1	transcript_id "g705.t1"; gene_id "g705";
Scaffold_10	AUGUSTUS	CDS	1432231	1432382	0.64	-	0	transcript_id "g705.t1"; gene_id "g705";
Scaffold_10	AUGUSTUS	start_codon	1432380	1432382	.	-	0	transcript_id "g705.t1"; gene_id "g705";
# protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFK
# ALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKRE
# ETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNLSLRLFGAVHAEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g705
###
# start gene g706
Scaffold_10	AUGUSTUS	gene	1434131	1434601	0.26	-	.	g706
Scaffold_10	AUGUSTUS	transcript	1434131	1434601	0.26	-	.	g706.t1
Scaffold_10	AUGUSTUS	stop_codon	1434131	1434133	.	-	0	transcript_id "g706.t1"; gene_id "g706";
Scaffold_10	AUGUSTUS	CDS	1434131	1434601	0.26	-	0	transcript_id "g706.t1"; gene_id "g706";
Scaffold_10	AUGUSTUS	start_codon	1434599	1434601	.	-	0	transcript_id "g706.t1"; gene_id "g706";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPHRGQPPVVAPARGRSTARIDSPILQAIARRTVTSLPRFCVKEKGRNLMGTPTNQSNTQYASSLLSNLFNSKG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g706
###
# start gene g707
Scaffold_10	AUGUSTUS	gene	1451204	1451389	0.42	-	.	g707
Scaffold_10	AUGUSTUS	transcript	1451204	1451389	0.42	-	.	g707.t1
Scaffold_10	AUGUSTUS	stop_codon	1451204	1451206	.	-	0	transcript_id "g707.t1"; gene_id "g707";
Scaffold_10	AUGUSTUS	CDS	1451204	1451389	0.42	-	0	transcript_id "g707.t1"; gene_id "g707";
Scaffold_10	AUGUSTUS	start_codon	1451387	1451389	.	-	0	transcript_id "g707.t1"; gene_id "g707";
# protein sequence = [MNNGYHAQALSKLRKYDKEWNANKVQSYEDLNENIDIQLKIGILNQGNLSRLGILELKRVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g707
###
# start gene g708
Scaffold_10	AUGUSTUS	gene	1452450	1452701	0.79	-	.	g708
Scaffold_10	AUGUSTUS	transcript	1452450	1452701	0.79	-	.	g708.t1
Scaffold_10	AUGUSTUS	stop_codon	1452450	1452452	.	-	0	transcript_id "g708.t1"; gene_id "g708";
Scaffold_10	AUGUSTUS	CDS	1452450	1452701	0.79	-	0	transcript_id "g708.t1"; gene_id "g708";
Scaffold_10	AUGUSTUS	start_codon	1452699	1452701	.	-	0	transcript_id "g708.t1"; gene_id "g708";
# protein sequence = [MVPDGLSQITPGGMANQASRSKSKDYVDEDGGNQLILLWEMGKQKSHINLMILKIKLTLEVVYLYETAQEADDIELDV
# QEALG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g708
###
# start gene g709
Scaffold_10	AUGUSTUS	gene	1453903	1455455	0.51	-	.	g709
Scaffold_10	AUGUSTUS	transcript	1453903	1455455	0.51	-	.	g709.t1
Scaffold_10	AUGUSTUS	stop_codon	1453903	1453905	.	-	0	transcript_id "g709.t1"; gene_id "g709";
Scaffold_10	AUGUSTUS	CDS	1453903	1454849	0.99	-	2	transcript_id "g709.t1"; gene_id "g709";
Scaffold_10	AUGUSTUS	CDS	1454921	1455455	0.51	-	0	transcript_id "g709.t1"; gene_id "g709";
Scaffold_10	AUGUSTUS	start_codon	1455453	1455455	.	-	0	transcript_id "g709.t1"; gene_id "g709";
# protein sequence = [MKAVCQKKHIAQVVLEWPSCRDKTKVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRD
# CPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKKKFFNYFGSMTLNESEARFSQSKRELYGLKLALEASYYHVYGCRHLTVETDASYIKGMLDNP
# SCGATHGPDGLSQITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRN
# YILESKNATCEVFSRNLFPTFDEEFVQKNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLSEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQ
# PQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRISCKEYQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYI
# IHGRDSLSSWSEARAVNMRMLEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g709
###
# start gene g710
Scaffold_10	AUGUSTUS	gene	1455803	1456234	0.38	-	.	g710
Scaffold_10	AUGUSTUS	transcript	1455803	1456234	0.38	-	.	g710.t1
Scaffold_10	AUGUSTUS	stop_codon	1455803	1455805	.	-	0	transcript_id "g710.t1"; gene_id "g710";
Scaffold_10	AUGUSTUS	CDS	1455803	1456234	0.38	-	0	transcript_id "g710.t1"; gene_id "g710";
Scaffold_10	AUGUSTUS	start_codon	1456232	1456234	.	-	0	transcript_id "g710.t1"; gene_id "g710";
# protein sequence = [MMCKQEAGFAWQPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFKDVCKIIKSKIDSGIYEPSNASYRLKWFC
# VIKKDGKSLRLVHSFGTFDKVTIQHSGVPPAIADLARSFSGRSCGGTLDLYIGYDERELDICLET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g710
###
# start gene g711
Scaffold_10	AUGUSTUS	gene	1456912	1457540	0.69	-	.	g711
Scaffold_10	AUGUSTUS	transcript	1456912	1457540	0.69	-	.	g711.t1
Scaffold_10	AUGUSTUS	stop_codon	1456912	1456914	.	-	0	transcript_id "g711.t1"; gene_id "g711";
Scaffold_10	AUGUSTUS	CDS	1456912	1457461	0.89	-	1	transcript_id "g711.t1"; gene_id "g711";
Scaffold_10	AUGUSTUS	CDS	1457518	1457540	0.69	-	0	transcript_id "g711.t1"; gene_id "g711";
Scaffold_10	AUGUSTUS	start_codon	1457538	1457540	.	-	0	transcript_id "g711.t1"; gene_id "g711";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR
# IERHIHGDPLVGTT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g711
###
# start gene g712
Scaffold_10	AUGUSTUS	gene	1458112	1459299	0.68	-	.	g712
Scaffold_10	AUGUSTUS	transcript	1458112	1459299	0.68	-	.	g712.t1
Scaffold_10	AUGUSTUS	stop_codon	1458112	1458114	.	-	0	transcript_id "g712.t1"; gene_id "g712";
Scaffold_10	AUGUSTUS	CDS	1458112	1459299	0.68	-	0	transcript_id "g712.t1"; gene_id "g712";
Scaffold_10	AUGUSTUS	start_codon	1459297	1459299	.	-	0	transcript_id "g712.t1"; gene_id "g712";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID
# DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP
# FKFGEVTVYLQLHVQNKAHFKCY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g712
###
# start gene g713
Scaffold_10	AUGUSTUS	gene	1459329	1459937	0.83	-	.	g713
Scaffold_10	AUGUSTUS	transcript	1459329	1459937	0.83	-	.	g713.t1
Scaffold_10	AUGUSTUS	stop_codon	1459329	1459331	.	-	0	transcript_id "g713.t1"; gene_id "g713";
Scaffold_10	AUGUSTUS	CDS	1459329	1459937	0.83	-	0	transcript_id "g713.t1"; gene_id "g713";
Scaffold_10	AUGUSTUS	start_codon	1459935	1459937	.	-	0	transcript_id "g713.t1"; gene_id "g713";
# protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD
# HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS
# DRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g713
###
# start gene g714
Scaffold_10	AUGUSTUS	gene	1459989	1460723	0.99	-	.	g714
Scaffold_10	AUGUSTUS	transcript	1459989	1460723	0.99	-	.	g714.t1
Scaffold_10	AUGUSTUS	stop_codon	1459989	1459991	.	-	0	transcript_id "g714.t1"; gene_id "g714";
Scaffold_10	AUGUSTUS	CDS	1459989	1460723	0.99	-	0	transcript_id "g714.t1"; gene_id "g714";
Scaffold_10	AUGUSTUS	start_codon	1460721	1460723	.	-	0	transcript_id "g714.t1"; gene_id "g714";
# protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g714
###
# start gene g715
Scaffold_10	AUGUSTUS	gene	1463000	1463359	1	-	.	g715
Scaffold_10	AUGUSTUS	transcript	1463000	1463359	1	-	.	g715.t1
Scaffold_10	AUGUSTUS	stop_codon	1463000	1463002	.	-	0	transcript_id "g715.t1"; gene_id "g715";
Scaffold_10	AUGUSTUS	CDS	1463000	1463359	1	-	0	transcript_id "g715.t1"; gene_id "g715";
Scaffold_10	AUGUSTUS	start_codon	1463357	1463359	.	-	0	transcript_id "g715.t1"; gene_id "g715";
# protein sequence = [MEEDQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPAQGRSTTRIDSPILQAIVRRTGKQPQRRAASESPRDPPPHFDL
# DTGDHDDQDPPVDPDDPGADNNHDNLDDDSGGLLLTCLNFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g715
###
# start gene g716
Scaffold_10	AUGUSTUS	gene	1468699	1469712	0.43	+	.	g716
Scaffold_10	AUGUSTUS	transcript	1468699	1469712	0.43	+	.	g716.t1
Scaffold_10	AUGUSTUS	start_codon	1468699	1468701	.	+	0	transcript_id "g716.t1"; gene_id "g716";
Scaffold_10	AUGUSTUS	CDS	1468699	1468731	0.43	+	0	transcript_id "g716.t1"; gene_id "g716";
Scaffold_10	AUGUSTUS	CDS	1468789	1469712	0.49	+	0	transcript_id "g716.t1"; gene_id "g716";
Scaffold_10	AUGUSTUS	stop_codon	1469710	1469712	.	+	0	transcript_id "g716.t1"; gene_id "g716";
# protein sequence = [MDRALSVFPGQTVVQRLQALEEELRVVKRDRDVAVEELSTASHKASELKTALLQQQGLVDETNALATRQRRRLEEVQE
# ELHRTRDRAAFVEQMIKEYPDEGFYEVVLPPLSQLEEDLKGAQEDLRRVATYAHRLYRSDPATVLHHHSRYIGAIIEAVVAFLRRGLASDDPDVVAHN
# FQLALDYMQTARGIHGDLYMRSISSIQWFFNNAVDEDEGLHRLVLEHSRFDNDGPILTAAQHAGFAAPPEGSLEPPLHRRMLALSTAFPHRDGSGRWD
# DIVPAIPSLDQSMVVWEQLMLEYLHHITDTPCPCQCYRTSLPRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g716
###
# start gene g717
Scaffold_10	AUGUSTUS	gene	1471574	1473382	0.29	-	.	g717
Scaffold_10	AUGUSTUS	transcript	1471574	1473382	0.29	-	.	g717.t1
Scaffold_10	AUGUSTUS	stop_codon	1471574	1471576	.	-	0	transcript_id "g717.t1"; gene_id "g717";
Scaffold_10	AUGUSTUS	CDS	1471574	1472194	0.94	-	0	transcript_id "g717.t1"; gene_id "g717";
Scaffold_10	AUGUSTUS	CDS	1472279	1472643	0.43	-	2	transcript_id "g717.t1"; gene_id "g717";
Scaffold_10	AUGUSTUS	CDS	1472728	1473382	0.71	-	0	transcript_id "g717.t1"; gene_id "g717";
Scaffold_10	AUGUSTUS	start_codon	1473380	1473382	.	-	0	transcript_id "g717.t1"; gene_id "g717";
# protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD
# IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTCDSADYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTK
# IDLRAGYNNVRVAQGHEWKTHSELGMGLRYLVMPFGLTNAPPHDEHPMWTRQEGPERLRANHPKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVI
# DWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPLDPETGEIHPIAFHARSMISAELNYDIYDKEL
# LAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIP
# PERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLIKRGGRIYVPDVGTYEGRSYSRTTTIN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g717
###
# start gene g718
Scaffold_10	AUGUSTUS	gene	1475727	1477372	0.46	-	.	g718
Scaffold_10	AUGUSTUS	transcript	1475727	1477372	0.46	-	.	g718.t1
Scaffold_10	AUGUSTUS	stop_codon	1475727	1475729	.	-	0	transcript_id "g718.t1"; gene_id "g718";
Scaffold_10	AUGUSTUS	CDS	1475727	1476611	0.96	-	0	transcript_id "g718.t1"; gene_id "g718";
Scaffold_10	AUGUSTUS	CDS	1476704	1477372	0.47	-	0	transcript_id "g718.t1"; gene_id "g718";
Scaffold_10	AUGUSTUS	start_codon	1477370	1477372	.	-	0	transcript_id "g718.t1"; gene_id "g718";
# protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP
# RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA
# PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREGNERIYEGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPD
# TPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGP
# GDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGD
# DRSAWKTWVLSLERMFGVRPTIMLGKRTSALPQLVISLVQHSPTSTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g718
###
# start gene g719
Scaffold_10	AUGUSTUS	gene	1478190	1478966	1	-	.	g719
Scaffold_10	AUGUSTUS	transcript	1478190	1478966	1	-	.	g719.t1
Scaffold_10	AUGUSTUS	stop_codon	1478190	1478192	.	-	0	transcript_id "g719.t1"; gene_id "g719";
Scaffold_10	AUGUSTUS	CDS	1478190	1478966	1	-	0	transcript_id "g719.t1"; gene_id "g719";
Scaffold_10	AUGUSTUS	start_codon	1478964	1478966	.	-	0	transcript_id "g719.t1"; gene_id "g719";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV
# SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g719
###
# start gene g720
Scaffold_10	AUGUSTUS	gene	1480956	1482007	0.26	-	.	g720
Scaffold_10	AUGUSTUS	transcript	1480956	1482007	0.26	-	.	g720.t1
Scaffold_10	AUGUSTUS	stop_codon	1480956	1480958	.	-	0	transcript_id "g720.t1"; gene_id "g720";
Scaffold_10	AUGUSTUS	CDS	1480956	1481203	0.95	-	2	transcript_id "g720.t1"; gene_id "g720";
Scaffold_10	AUGUSTUS	CDS	1481320	1481353	0.34	-	0	transcript_id "g720.t1"; gene_id "g720";
Scaffold_10	AUGUSTUS	CDS	1481714	1482007	0.78	-	0	transcript_id "g720.t1"; gene_id "g720";
Scaffold_10	AUGUSTUS	start_codon	1482005	1482007	.	-	0	transcript_id "g720.t1"; gene_id "g720";
# protein sequence = [MDHPMDDVPATNESESPPAANDTEVPTAIPRTRRGLISRRPMNVIPDNDDLETPSAISSNRRRKLSLSSDDDDQSSSQ
# AEDIHEKPQKVTDVSTSFLMGDVIDKGRTIENRLKEELEELKGIHSSAKAEASNATQKRDEEIARLKKEFEDHRKAVPQDFVAKDPEIEILTAKLSTA
# ESEIKEKTVSHAQKM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g720
###
# start gene g721
Scaffold_10	AUGUSTUS	gene	1485652	1486290	0.64	-	.	g721
Scaffold_10	AUGUSTUS	transcript	1485652	1486290	0.64	-	.	g721.t1
Scaffold_10	AUGUSTUS	stop_codon	1485652	1485654	.	-	0	transcript_id "g721.t1"; gene_id "g721";
Scaffold_10	AUGUSTUS	CDS	1485652	1486290	0.64	-	0	transcript_id "g721.t1"; gene_id "g721";
Scaffold_10	AUGUSTUS	start_codon	1486288	1486290	.	-	0	transcript_id "g721.t1"; gene_id "g721";
# protein sequence = [MAQVHPAPAFTRMNGSSSYPEASTSALDTDSNPPHCPSSPFSENLITAPLYSHVTQCRTLHEASSSSLVSNANFSLSL
# LPDTSSLEASSSSRVLNANLSLLQDSPSLEAHNPPSTVNTTSSDLSSEVRTSMGELPSKPGIPVELLTNSDQRFVTDLELFDTRSRRLFNEQKNSLEF
# AEKCIEVLVQQCIVSLLFYIPILKYVLLTFMLPFRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g721
###
# start gene g722
Scaffold_10	AUGUSTUS	gene	1491377	1491721	0.46	+	.	g722
Scaffold_10	AUGUSTUS	transcript	1491377	1491721	0.46	+	.	g722.t1
Scaffold_10	AUGUSTUS	start_codon	1491377	1491379	.	+	0	transcript_id "g722.t1"; gene_id "g722";
Scaffold_10	AUGUSTUS	CDS	1491377	1491721	0.46	+	0	transcript_id "g722.t1"; gene_id "g722";
Scaffold_10	AUGUSTUS	stop_codon	1491719	1491721	.	+	0	transcript_id "g722.t1"; gene_id "g722";
# protein sequence = [MGDHPATPVSNSALSSTTSSTNTNLNGSASGASTTVFRAKPPIDIDTIREFPMVPSGREEYLKRQGGTDELVKGLDNL
# HATSESIFRAQKEEILLRRHQINTLKEQCRVSEWRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g722
###
# start gene g723
Scaffold_10	AUGUSTUS	gene	1500771	1501484	0.99	-	.	g723
Scaffold_10	AUGUSTUS	transcript	1500771	1501484	0.99	-	.	g723.t1
Scaffold_10	AUGUSTUS	stop_codon	1500771	1500773	.	-	0	transcript_id "g723.t1"; gene_id "g723";
Scaffold_10	AUGUSTUS	CDS	1500771	1501484	0.99	-	0	transcript_id "g723.t1"; gene_id "g723";
Scaffold_10	AUGUSTUS	start_codon	1501482	1501484	.	-	0	transcript_id "g723.t1"; gene_id "g723";
# protein sequence = [MTISPFRTLSTSCQDIVSKSASLEHPDLGPTNQGENALPIVIHSENNPYSSDSTPPSASVLSYPMDAPTSGWFFEAFH
# YLNVALGPQYLDLLQKWMDYERKNNWLNPHKLAGFSPENRPSVLLAWMKNRPRPLPKVDKRGFFTPKFVQEVWAWWASLQPDWRSLDKNGLPMSFEEF
# GDDLSSLNKHGRNAWVGLLACLKWWKVGLGYHVADDNEAPVHEWLTIIADMTRMLDKLVAE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g723
###
# start gene g724
Scaffold_10	AUGUSTUS	gene	1504338	1505426	0.58	-	.	g724
Scaffold_10	AUGUSTUS	transcript	1504338	1505426	0.58	-	.	g724.t1
Scaffold_10	AUGUSTUS	stop_codon	1504338	1504340	.	-	0	transcript_id "g724.t1"; gene_id "g724";
Scaffold_10	AUGUSTUS	CDS	1504338	1505426	0.58	-	0	transcript_id "g724.t1"; gene_id "g724";
Scaffold_10	AUGUSTUS	start_codon	1505424	1505426	.	-	0	transcript_id "g724.t1"; gene_id "g724";
# protein sequence = [MSCLNLPLEIREDQAYVYVPGVIQGPREPDARAGAYNHYLRPVIDEMLVAYTRGIQCASSDNQETPYERTHRVVLANI
# SMDAKASHPFAGLIDIGSHTYCATCQTWHKAYLNSVNYEDWEAIDDEYLREGAEKWRDAESRAERERVEHLYGVRFSEFWRLPYYSPSKQVSIDPMHA
# LKNIFGNFFCDALRLDNPCSTREPKNKDTTPVSSIAHYYQFTPPPPLSLVNSAPITPTDTAEEDLVTAVLEWEHLSNDLQHFRHQRMLNLLVEIDTYK
# RELIDIHHLLSSLRPSTDLLQAQLRSRLKSKKWGALLYVCNDLMVFPVQISGGIVRKEMITKSDITKDDMIETLIEWVAIGWVSLKLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g724
###
# start gene g725
Scaffold_10	AUGUSTUS	gene	1506563	1507006	0.97	-	.	g725
Scaffold_10	AUGUSTUS	transcript	1506563	1507006	0.97	-	.	g725.t1
Scaffold_10	AUGUSTUS	stop_codon	1506563	1506565	.	-	0	transcript_id "g725.t1"; gene_id "g725";
Scaffold_10	AUGUSTUS	CDS	1506563	1507006	0.97	-	0	transcript_id "g725.t1"; gene_id "g725";
Scaffold_10	AUGUSTUS	start_codon	1507004	1507006	.	-	0	transcript_id "g725.t1"; gene_id "g725";
# protein sequence = [MASDLHSRIFLQQNSSNNGSFDFGTSTSSTIQVASTPAACPDSGSGTANGSVNRQNDSVIDLPVPSADENSSISVPTS
# GLNSATQNSLNHFTIDTSNFGLSVMAQIILDRDSLEFTPLDPSALEAIVETIQETVHVRDQCSHLMTNS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g725
###
# start gene g726
Scaffold_10	AUGUSTUS	gene	1508310	1509599	0.86	-	.	g726
Scaffold_10	AUGUSTUS	transcript	1508310	1509599	0.86	-	.	g726.t1
Scaffold_10	AUGUSTUS	stop_codon	1508310	1508312	.	-	0	transcript_id "g726.t1"; gene_id "g726";
Scaffold_10	AUGUSTUS	CDS	1508310	1509599	0.86	-	0	transcript_id "g726.t1"; gene_id "g726";
Scaffold_10	AUGUSTUS	start_codon	1509597	1509599	.	-	0	transcript_id "g726.t1"; gene_id "g726";
# protein sequence = [MQSNSFCAGGSFLSNGTLINVGGNPVVADHTSAADFGDKDGLQAIRIIEPCDDDGHCSIRISEFHDSVRMASPRWYNT
# VLRIDDGSAMIIGGSKKGGWINNDTVNNPTYEYYPPKDIHGSNGMPINSPFLKDTLNSNLFPIAFSLPDGRVFLAANNDAMIYDWKTDTEERLPPIPN
# GVRVTYPMTGTGLLLPLSSGNNYTPEVLLCGGSTVDDKKPGSQISSQDPASSQCSRMVLTKEGIQAGWEVDHMPDARLMPDAVLLPTGQIIIVNGAGS
# GISGYGNVVNQVGVSNAANPVLTPVLYNLSADLGSRFNSQGIPSSSIPRLYHSVATLTPDASIMIAGSNPNLDRSEIEYGTEYRVEWLSPPYMRGARP
# EIRKHKGNVGFKETLSIEVNRLKSNSDLKRALFHNRFFSLFVKYLMRFSLLQWSSWI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g726
###
# start gene g727
Scaffold_10	AUGUSTUS	gene	1512600	1512875	0.55	-	.	g727
Scaffold_10	AUGUSTUS	transcript	1512600	1512875	0.55	-	.	g727.t1
Scaffold_10	AUGUSTUS	stop_codon	1512600	1512602	.	-	0	transcript_id "g727.t1"; gene_id "g727";
Scaffold_10	AUGUSTUS	CDS	1512600	1512875	0.55	-	0	transcript_id "g727.t1"; gene_id "g727";
Scaffold_10	AUGUSTUS	start_codon	1512873	1512875	.	-	0	transcript_id "g727.t1"; gene_id "g727";
# protein sequence = [MAQCDSQPETHDALNDHSDSDSSPILPPYSQFYYSNGDRKIDPTPLPLYTPREAPNKAIVESVGLSEDEHRHSVAVVQ
# DIPIFSQKACTIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g727
###
# start gene g728
Scaffold_10	AUGUSTUS	gene	1521609	1522691	0.7	-	.	g728
Scaffold_10	AUGUSTUS	transcript	1521609	1522691	0.7	-	.	g728.t1
Scaffold_10	AUGUSTUS	stop_codon	1521609	1521611	.	-	0	transcript_id "g728.t1"; gene_id "g728";
Scaffold_10	AUGUSTUS	CDS	1521609	1522691	0.7	-	0	transcript_id "g728.t1"; gene_id "g728";
Scaffold_10	AUGUSTUS	start_codon	1522689	1522691	.	-	0	transcript_id "g728.t1"; gene_id "g728";
# protein sequence = [MPVPAQVPSLLVPMNPSVPRNETILEHRSEQLYQIALPPPAPHTRRSVSHNYLEQENKLMREQLESAGKLLDANFAHM
# RLMEAENAWLRNKVFAKKRTKKRIAVNSGTSRHLTGEENMHELLKYEMKQVLEGLKSKFRTIRKEIKKAEQAEAHAKKVAEKVRKAAEKALQKEAKAA
# QQRALGRGRGCTRGHVGRRSHGGARCTRGNVVGRGRGSGVQQEDKDDTETEGSESESRLSSSDDNTPDEDSTSKINLPNPIHGLSNPSPQPSSPYPVH
# PRPKPRPLMNHQVYVTPVVEADNSTGSSGDDSEFLEGEGGEGSVGRASIEDTEALEEETKIRCIIGHKWIGRGLRFLVDWDDGDIT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g728
###
# start gene g729
Scaffold_10	AUGUSTUS	gene	1523240	1524052	0.97	-	.	g729
Scaffold_10	AUGUSTUS	transcript	1523240	1524052	0.97	-	.	g729.t1
Scaffold_10	AUGUSTUS	stop_codon	1523240	1523242	.	-	0	transcript_id "g729.t1"; gene_id "g729";
Scaffold_10	AUGUSTUS	CDS	1523240	1524052	0.97	-	0	transcript_id "g729.t1"; gene_id "g729";
Scaffold_10	AUGUSTUS	start_codon	1524050	1524052	.	-	0	transcript_id "g729.t1"; gene_id "g729";
# protein sequence = [MTNNPDDLEMPLLISSEESDLLDEVESLQLPANREEQLKLAVTAYLNSNGKLSVRGVAKAYDISHTTLQRRIEGGVSR
# AEAHAHEQNLSPAQEGILVEWIKVQGHRGVPLSLASVTDYASDIAGKAMGKNWLDRFRTRHPELSLKNTTPLEESRARALTPAAVSGFYDLFDRTVSE
# HHIPPENIYNMDEKGIQLGIGARTAVLVDRSQKSVASIEPGNRDLVTIIETVCADGTALHPSVIFEARRRDARWGEENPANARSVITVLLSGLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g729
###
# start gene g730
Scaffold_10	AUGUSTUS	gene	1526378	1526716	0.98	+	.	g730
Scaffold_10	AUGUSTUS	transcript	1526378	1526716	0.98	+	.	g730.t1
Scaffold_10	AUGUSTUS	start_codon	1526378	1526380	.	+	0	transcript_id "g730.t1"; gene_id "g730";
Scaffold_10	AUGUSTUS	CDS	1526378	1526716	0.98	+	0	transcript_id "g730.t1"; gene_id "g730";
Scaffold_10	AUGUSTUS	stop_codon	1526714	1526716	.	+	0	transcript_id "g730.t1"; gene_id "g730";
# protein sequence = [MDKFKSKLTTSHYEWDKVQHQLSSSHKIKPLGKATFKDAADQKTAFTKVEAIRMKAAAAVKGGNCLDYITDVLELLKT
# EGHVTEEVVAAYKKEYDDNYTRVSKAVWGVDLQP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g730
###
# start gene g731
Scaffold_10	AUGUSTUS	gene	1532728	1533655	0.59	-	.	g731
Scaffold_10	AUGUSTUS	transcript	1532728	1533655	0.59	-	.	g731.t1
Scaffold_10	AUGUSTUS	stop_codon	1532728	1532730	.	-	0	transcript_id "g731.t1"; gene_id "g731";
Scaffold_10	AUGUSTUS	CDS	1532728	1532951	1	-	2	transcript_id "g731.t1"; gene_id "g731";
Scaffold_10	AUGUSTUS	CDS	1533055	1533655	0.59	-	0	transcript_id "g731.t1"; gene_id "g731";
Scaffold_10	AUGUSTUS	start_codon	1533653	1533655	.	-	0	transcript_id "g731.t1"; gene_id "g731";
# protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL
# DTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAAL
# GRPSDSSESKSKVKEPEVFDGSDPLGQPKNGLSLISSTPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETEKHPEIQHPVQHPGC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g731
###
# start gene g732
Scaffold_10	AUGUSTUS	gene	1534432	1535544	0.65	+	.	g732
Scaffold_10	AUGUSTUS	transcript	1534432	1535544	0.65	+	.	g732.t1
Scaffold_10	AUGUSTUS	start_codon	1534432	1534434	.	+	0	transcript_id "g732.t1"; gene_id "g732";
Scaffold_10	AUGUSTUS	CDS	1534432	1535544	0.65	+	0	transcript_id "g732.t1"; gene_id "g732";
Scaffold_10	AUGUSTUS	stop_codon	1535542	1535544	.	+	0	transcript_id "g732.t1"; gene_id "g732";
# protein sequence = [MEARGMDLTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIF
# EAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQ
# LTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR
# TLEAVHRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTLLPNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g732
###
# start gene g733
Scaffold_10	AUGUSTUS	gene	1539329	1540807	0.46	+	.	g733
Scaffold_10	AUGUSTUS	transcript	1539329	1540807	0.46	+	.	g733.t1
Scaffold_10	AUGUSTUS	start_codon	1539329	1539331	.	+	0	transcript_id "g733.t1"; gene_id "g733";
Scaffold_10	AUGUSTUS	CDS	1539329	1540807	0.46	+	0	transcript_id "g733.t1"; gene_id "g733";
Scaffold_10	AUGUSTUS	stop_codon	1540805	1540807	.	+	0	transcript_id "g733.t1"; gene_id "g733";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD
# LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG
# TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN
# LCQVHAAGLHSAARYSEDLLLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g733
###
# start gene g734
Scaffold_10	AUGUSTUS	gene	1541449	1545968	0.83	+	.	g734
Scaffold_10	AUGUSTUS	transcript	1541449	1545968	0.83	+	.	g734.t1
Scaffold_10	AUGUSTUS	start_codon	1541449	1541451	.	+	0	transcript_id "g734.t1"; gene_id "g734";
Scaffold_10	AUGUSTUS	CDS	1541449	1542901	0.85	+	0	transcript_id "g734.t1"; gene_id "g734";
Scaffold_10	AUGUSTUS	CDS	1542976	1545968	0.97	+	2	transcript_id "g734.t1"; gene_id "g734";
Scaffold_10	AUGUSTUS	stop_codon	1545966	1545968	.	+	0	transcript_id "g734.t1"; gene_id "g734";
# protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK
# KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD
# LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESF
# LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTL
# GLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKS
# TGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFL
# QNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR
# IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNI
# PIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQL
# SRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY
# AGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELK
# DGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKG
# MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYL
# YETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFVRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDE
# RIKFIRLIKKFQVDDQGRLYHRILINLINHN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g734
###
# start gene g735
Scaffold_10	AUGUSTUS	gene	1546217	1547247	0.21	+	.	g735
Scaffold_10	AUGUSTUS	transcript	1546217	1547247	0.21	+	.	g735.t1
Scaffold_10	AUGUSTUS	start_codon	1546217	1546219	.	+	0	transcript_id "g735.t1"; gene_id "g735";
Scaffold_10	AUGUSTUS	CDS	1546217	1546881	0.39	+	0	transcript_id "g735.t1"; gene_id "g735";
Scaffold_10	AUGUSTUS	CDS	1546959	1547247	0.27	+	1	transcript_id "g735.t1"; gene_id "g735";
Scaffold_10	AUGUSTUS	stop_codon	1547245	1547247	.	+	0	transcript_id "g735.t1"; gene_id "g735";
# protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR
# ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA
# LSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQ
# LDLMVEDEDEYWTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g735
###
# start gene g736
Scaffold_10	AUGUSTUS	gene	1547595	1548182	0.91	-	.	g736
Scaffold_10	AUGUSTUS	transcript	1547595	1548182	0.91	-	.	g736.t1
Scaffold_10	AUGUSTUS	stop_codon	1547595	1547597	.	-	0	transcript_id "g736.t1"; gene_id "g736";
Scaffold_10	AUGUSTUS	CDS	1547595	1547932	1	-	2	transcript_id "g736.t1"; gene_id "g736";
Scaffold_10	AUGUSTUS	CDS	1548014	1548182	0.91	-	0	transcript_id "g736.t1"; gene_id "g736";
Scaffold_10	AUGUSTUS	start_codon	1548180	1548182	.	-	0	transcript_id "g736.t1"; gene_id "g736";
# protein sequence = [MFLYPRLIPCRRIVAALPIPPLVPTKVPKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTP
# PAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTRHSYRDSG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g736
###
# start gene g737
Scaffold_10	AUGUSTUS	gene	1550664	1551422	0.98	-	.	g737
Scaffold_10	AUGUSTUS	transcript	1550664	1551422	0.98	-	.	g737.t1
Scaffold_10	AUGUSTUS	stop_codon	1550664	1550666	.	-	0	transcript_id "g737.t1"; gene_id "g737";
Scaffold_10	AUGUSTUS	CDS	1550664	1551422	0.98	-	0	transcript_id "g737.t1"; gene_id "g737";
Scaffold_10	AUGUSTUS	start_codon	1551420	1551422	.	-	0	transcript_id "g737.t1"; gene_id "g737";
# protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE
# VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRR
# IHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDDSLGCC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g737
###
# start gene g738
Scaffold_10	AUGUSTUS	gene	1554627	1556161	0.76	-	.	g738
Scaffold_10	AUGUSTUS	transcript	1554627	1556161	0.76	-	.	g738.t1
Scaffold_10	AUGUSTUS	stop_codon	1554627	1554629	.	-	0	transcript_id "g738.t1"; gene_id "g738";
Scaffold_10	AUGUSTUS	CDS	1554627	1555287	0.99	-	1	transcript_id "g738.t1"; gene_id "g738";
Scaffold_10	AUGUSTUS	CDS	1555501	1555836	0.85	-	1	transcript_id "g738.t1"; gene_id "g738";
Scaffold_10	AUGUSTUS	CDS	1555908	1556161	0.86	-	0	transcript_id "g738.t1"; gene_id "g738";
Scaffold_10	AUGUSTUS	start_codon	1556159	1556161	.	-	0	transcript_id "g738.t1"; gene_id "g738";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEENNNSSTAPCTLVTDNL
# SKSDPSPHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSAVYRVVSLVTPVDLVVLVVPAVPAVLVDLVDLVL
# PYLLTSPTSNVLCWNSSRVQGGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNW
# DSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPF
# SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKSFPPRRKEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g738
###
# start gene g739
Scaffold_10	AUGUSTUS	gene	1562087	1562572	0.87	+	.	g739
Scaffold_10	AUGUSTUS	transcript	1562087	1562572	0.87	+	.	g739.t1
Scaffold_10	AUGUSTUS	start_codon	1562087	1562089	.	+	0	transcript_id "g739.t1"; gene_id "g739";
Scaffold_10	AUGUSTUS	CDS	1562087	1562572	0.87	+	0	transcript_id "g739.t1"; gene_id "g739";
Scaffold_10	AUGUSTUS	stop_codon	1562570	1562572	.	+	0	transcript_id "g739.t1"; gene_id "g739";
# protein sequence = [MAYSYLVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFSGLSVKRSPWNFTIPLDI
# IRKPMGKLSVSIRLSNSTSGSIVPTNKMTGRLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g739
###
# start gene g740
Scaffold_10	AUGUSTUS	gene	1568678	1569151	0.53	-	.	g740
Scaffold_10	AUGUSTUS	transcript	1568678	1569151	0.53	-	.	g740.t1
Scaffold_10	AUGUSTUS	stop_codon	1568678	1568680	.	-	0	transcript_id "g740.t1"; gene_id "g740";
Scaffold_10	AUGUSTUS	CDS	1568678	1569151	0.53	-	0	transcript_id "g740.t1"; gene_id "g740";
Scaffold_10	AUGUSTUS	start_codon	1569149	1569151	.	-	0	transcript_id "g740.t1"; gene_id "g740";
# protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR
# ISAYNSQANGKIERAHLDRRQALIKATGGDVSKWFYFLKMILWADRVTPRCGLGCFPYFLVTGAEPLLPFDIVLLVKST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g740
###
# start gene g741
Scaffold_10	AUGUSTUS	gene	1569400	1570584	0.8	-	.	g741
Scaffold_10	AUGUSTUS	transcript	1569400	1570584	0.8	-	.	g741.t1
Scaffold_10	AUGUSTUS	stop_codon	1569400	1569402	.	-	0	transcript_id "g741.t1"; gene_id "g741";
Scaffold_10	AUGUSTUS	CDS	1569400	1570584	0.8	-	0	transcript_id "g741.t1"; gene_id "g741";
Scaffold_10	AUGUSTUS	start_codon	1570582	1570584	.	-	0	transcript_id "g741.t1"; gene_id "g741";
# protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK
# KFQVDDQGRLYHRKLINLINHN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g741
###
# start gene g742
Scaffold_10	AUGUSTUS	gene	1570844	1571383	0.63	-	.	g742
Scaffold_10	AUGUSTUS	transcript	1570844	1571383	0.63	-	.	g742.t1
Scaffold_10	AUGUSTUS	stop_codon	1570844	1570846	.	-	0	transcript_id "g742.t1"; gene_id "g742";
Scaffold_10	AUGUSTUS	CDS	1570844	1571383	0.63	-	0	transcript_id "g742.t1"; gene_id "g742";
Scaffold_10	AUGUSTUS	start_codon	1571381	1571383	.	-	0	transcript_id "g742.t1"; gene_id "g742";
# protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC
# VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY
# STR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g742
###
# start gene g743
Scaffold_10	AUGUSTUS	gene	1571578	1572835	0.46	-	.	g743
Scaffold_10	AUGUSTUS	transcript	1571578	1572835	0.46	-	.	g743.t1
Scaffold_10	AUGUSTUS	stop_codon	1571578	1571580	.	-	0	transcript_id "g743.t1"; gene_id "g743";
Scaffold_10	AUGUSTUS	CDS	1571578	1572055	0.95	-	1	transcript_id "g743.t1"; gene_id "g743";
Scaffold_10	AUGUSTUS	CDS	1572148	1572388	0.53	-	2	transcript_id "g743.t1"; gene_id "g743";
Scaffold_10	AUGUSTUS	CDS	1572463	1572835	0.87	-	0	transcript_id "g743.t1"; gene_id "g743";
Scaffold_10	AUGUSTUS	start_codon	1572833	1572835	.	-	0	transcript_id "g743.t1"; gene_id "g743";
# protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV
# GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ
# VFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVR
# YESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g743
###
# start gene g744
Scaffold_10	AUGUSTUS	gene	1573218	1574190	0.65	-	.	g744
Scaffold_10	AUGUSTUS	transcript	1573218	1574190	0.65	-	.	g744.t1
Scaffold_10	AUGUSTUS	stop_codon	1573218	1573220	.	-	0	transcript_id "g744.t1"; gene_id "g744";
Scaffold_10	AUGUSTUS	CDS	1573218	1573982	0.93	-	0	transcript_id "g744.t1"; gene_id "g744";
Scaffold_10	AUGUSTUS	CDS	1574032	1574190	0.65	-	0	transcript_id "g744.t1"; gene_id "g744";
Scaffold_10	AUGUSTUS	start_codon	1574188	1574190	.	-	0	transcript_id "g744.t1"; gene_id "g744";
# protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAKHTEKMMSVCSTKIVQMEKKSTPMK
# EQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIP
# SSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKLLCARYA
# IGESVQGLKRITTYQLYPKMEKLKFWTIHLGYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g744
###
# start gene g745
Scaffold_10	AUGUSTUS	gene	1574582	1575139	0.98	-	.	g745
Scaffold_10	AUGUSTUS	transcript	1574582	1575139	0.98	-	.	g745.t1
Scaffold_10	AUGUSTUS	stop_codon	1574582	1574584	.	-	0	transcript_id "g745.t1"; gene_id "g745";
Scaffold_10	AUGUSTUS	CDS	1574582	1575139	0.98	-	0	transcript_id "g745.t1"; gene_id "g745";
Scaffold_10	AUGUSTUS	start_codon	1575137	1575139	.	-	0	transcript_id "g745.t1"; gene_id "g745";
# protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLE
# TVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGI
# KLESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g745
###
# start gene g746
Scaffold_10	AUGUSTUS	gene	1575238	1575444	0.8	-	.	g746
Scaffold_10	AUGUSTUS	transcript	1575238	1575444	0.8	-	.	g746.t1
Scaffold_10	AUGUSTUS	stop_codon	1575238	1575240	.	-	0	transcript_id "g746.t1"; gene_id "g746";
Scaffold_10	AUGUSTUS	CDS	1575238	1575444	0.8	-	0	transcript_id "g746.t1"; gene_id "g746";
Scaffold_10	AUGUSTUS	start_codon	1575442	1575444	.	-	0	transcript_id "g746.t1"; gene_id "g746";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g746
###
# start gene g747
Scaffold_10	AUGUSTUS	gene	1577603	1578088	0.87	-	.	g747
Scaffold_10	AUGUSTUS	transcript	1577603	1578088	0.87	-	.	g747.t1
Scaffold_10	AUGUSTUS	stop_codon	1577603	1577605	.	-	0	transcript_id "g747.t1"; gene_id "g747";
Scaffold_10	AUGUSTUS	CDS	1577603	1578088	0.87	-	0	transcript_id "g747.t1"; gene_id "g747";
Scaffold_10	AUGUSTUS	start_codon	1578086	1578088	.	-	0	transcript_id "g747.t1"; gene_id "g747";
# protein sequence = [MDIEKFNLKWSSTLTTLRNYGYDIPWDTLISKYISKLPSGPRYVYLKQTLEEEFDQPGIIPNRDLFDKFAIRLENTRN
# RELLDLADSGGGAYNRRFQRNGNGGTSDKPSEPQKPKDSPNVSKPNNKPSAYVTTVTSPTSNTTSKIEPVDNVNPVPNVIPDH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g747
###
# command line:
# augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000005