# This output was generated with AUGUSTUS (version 3.4.0).
# AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de),
# O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Sources of extrinsic information: M RM 
# Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ...
# saccharomyces version. Using default transition matrix.
# Looks like split/input_1/input_1.fa_chunk_0000004 is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 2065898, name = Scaffold_6) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
Scaffold_6	AUGUSTUS	gene	1126	1812	0.38	-	.	g1
Scaffold_6	AUGUSTUS	transcript	1126	1812	0.38	-	.	g1.t1
Scaffold_6	AUGUSTUS	stop_codon	1126	1128	.	-	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_6	AUGUSTUS	CDS	1126	1812	0.38	-	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_6	AUGUSTUS	start_codon	1810	1812	.	-	0	transcript_id "g1.t1"; gene_id "g1";
# protein sequence = [MKDVALPLPVTEPSPRKLQRRLRIIPFLSSLLTTIRTNLSAGTPPSSSTSYDDHEDINPQLNLDLQDPDTVVTSEEED
# GFISKVVVEQSWGSGTRSKPTSDSSDPASQDHKDSKSGETQPVHLMKTADEREVDVDGKLNLYLVCLLRFWLKIKHFFYPRPFDVGSEKRYDEDDWYS
# KKTMAQLASIWLILNLALGCVSVPRPWTIIDLIFNAGVRITLYFAVLANFGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1
###
# start gene g2
Scaffold_6	AUGUSTUS	gene	9696	10853	0.94	+	.	g2
Scaffold_6	AUGUSTUS	transcript	9696	10853	0.94	+	.	g2.t1
Scaffold_6	AUGUSTUS	start_codon	9696	9698	.	+	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_6	AUGUSTUS	CDS	9696	10853	0.94	+	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_6	AUGUSTUS	stop_codon	10851	10853	.	+	0	transcript_id "g2.t1"; gene_id "g2";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK
# QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDRAN
# AMSPPSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g2
###
# start gene g3
Scaffold_6	AUGUSTUS	gene	11805	14600	0.71	+	.	g3
Scaffold_6	AUGUSTUS	transcript	11805	14600	0.71	+	.	g3.t1
Scaffold_6	AUGUSTUS	start_codon	11805	11807	.	+	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_6	AUGUSTUS	CDS	11805	14600	0.71	+	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_6	AUGUSTUS	stop_codon	14598	14600	.	+	0	transcript_id "g3.t1"; gene_id "g3";
# protein sequence = [MSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARY
# FTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDL
# YLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREA
# FISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWR
# TAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQVLEGLETVKKH
# GLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQRHPRAVTQPL
# DVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTS
# GYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALH
# LGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPE
# PVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g3
###
# start gene g4
Scaffold_6	AUGUSTUS	gene	23248	24518	0.38	+	.	g4
Scaffold_6	AUGUSTUS	transcript	23248	24518	0.38	+	.	g4.t1
Scaffold_6	AUGUSTUS	start_codon	23248	23250	.	+	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_6	AUGUSTUS	CDS	23248	23782	0.48	+	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_6	AUGUSTUS	CDS	23824	24518	0.45	+	2	transcript_id "g4.t1"; gene_id "g4";
Scaffold_6	AUGUSTUS	stop_codon	24516	24518	.	+	0	transcript_id "g4.t1"; gene_id "g4";
# protein sequence = [MLAGHAGEEYDALTKGVDAGEDVAGEVHQNLKSAESRLGIALQGRFKDDEEQSTKKGKKPAASSKKRARKAESTTEAV
# NERPPKKTKTSKVKSAQFVHDETPPRSMRLAAGPFAYGPPSSEAGPSRLPERPEPQEDEEDYEKQGQELRDRLGAQWQRILQESWRRREQDEQGELPQ
# SGDPVPSPFSARNSTTSSYTGRTPRTRTPPMDAPKPFEEMEPEGMETPTAPPSPKLPPVKGTGMSSELSDLPTPTPSPPPVKSTLDAPAMGSDGKLKD
# AMEMEFSYSETEDVPMVESEDEIRAEPSTSSRKGKERAAPQTLVSRMRSVDLQGPEDPYRPPHTGKSKQPAKSRRKRETTPVSNSALLGFLNSFLYSR
# TWMMLLPWTPTFNVRRKWSGKGDGDEDAGVPVASSSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g4
###
# start gene g5
Scaffold_6	AUGUSTUS	gene	26776	27655	0.43	-	.	g5
Scaffold_6	AUGUSTUS	transcript	26776	27655	0.43	-	.	g5.t1
Scaffold_6	AUGUSTUS	stop_codon	26776	26778	.	-	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_6	AUGUSTUS	CDS	26776	27489	0.99	-	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_6	AUGUSTUS	CDS	27548	27655	0.43	-	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_6	AUGUSTUS	start_codon	27653	27655	.	-	0	transcript_id "g5.t1"; gene_id "g5";
# protein sequence = [MSWLSLALETKLSRKREREVSLEPVAGSSAKSNTVSDSMLHNSKEEKDYTRTPAKKNRIHRSVELDATAEEEDSQASG
# HHRSRSNSSDDSNTNSPPLTQADLGIAASPPQEMKIKVRQISQGVEDLTWRNMKKQQKGSDADESDAQSQKIPKLPMTSVEEDKNMEEEALPSTSSSA
# SASRRDSDANPTVEAALHLKRKYPERGPSAEPPSGLESNTLSSTPNMLGTGAEASSKRPRDDSDKDDNPRVPKRPTPPPEETEKHSSIKQVRFALYN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g5
###
# start gene g6
Scaffold_6	AUGUSTUS	gene	33098	34108	0.73	+	.	g6
Scaffold_6	AUGUSTUS	transcript	33098	34108	0.73	+	.	g6.t1
Scaffold_6	AUGUSTUS	start_codon	33098	33100	.	+	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_6	AUGUSTUS	CDS	33098	34108	0.73	+	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_6	AUGUSTUS	stop_codon	34106	34108	.	+	0	transcript_id "g6.t1"; gene_id "g6";
# protein sequence = [MTTDHSPIDAPFGSWATDKILSDMQPNRSVHRVGHGYVSVFEERHVFKVFHDEDPSEPLLIMPKVGHELRMMLIAGSD
# SVHLIGRLFDNTKQKLIGFIMPYEQALAPGVNIGGEPGERAKFSKEQKREIIDKLCRLIERLQAKQIIHGDVKPSNLLLCSDGQVRLCDWALASVNGD
# NFVAYAVSDHYASCRRCCLPQEPLALEEDLYATGVSIWEIWMEKVPFEDVEEDIVDELVMGGIRPDLQAVDDPEIAALIQSYLDAGPACSNKPGQTRI
# VCTQVDVTFNNCRATPAHVETRVVKCYHCQDPDATQQCAEPFRLPNVLVESSSPVCPKCNPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g6
###
# start gene g7
Scaffold_6	AUGUSTUS	gene	38822	39466	0.97	-	.	g7
Scaffold_6	AUGUSTUS	transcript	38822	39466	0.97	-	.	g7.t1
Scaffold_6	AUGUSTUS	stop_codon	38822	38824	.	-	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_6	AUGUSTUS	CDS	38822	39466	0.97	-	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_6	AUGUSTUS	start_codon	39464	39466	.	-	0	transcript_id "g7.t1"; gene_id "g7";
# protein sequence = [MLNPGIYEILKARDSAAPSSHSADTSLPQFRTPEAAEVHIQESTVTYDLPSSSSWPDDLHPMTVLFPRGKVTFKVTFD
# FGKRTVHPSSAQQSTRTIVKRFILDAMGSLIRNVEFNIEFENDWIGKNTEITFSVVGGQECPAEGSAPGRRSLRNRRSDSEGSNWLTESMNGTMGKRS
# GSGCHGGMLDKGAGTWVLKNSMDRPIYGPVPQPKAGGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g7
###
# start gene g8
Scaffold_6	AUGUSTUS	gene	45705	48020	0.14	-	.	g8
Scaffold_6	AUGUSTUS	transcript	45705	48020	0.14	-	.	g8.t1
Scaffold_6	AUGUSTUS	stop_codon	45705	45707	.	-	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_6	AUGUSTUS	CDS	45705	46715	0.79	-	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_6	AUGUSTUS	CDS	47305	47569	0.15	-	1	transcript_id "g8.t1"; gene_id "g8";
Scaffold_6	AUGUSTUS	CDS	47974	48020	0.66	-	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_6	AUGUSTUS	start_codon	48018	48020	.	-	0	transcript_id "g8.t1"; gene_id "g8";
# protein sequence = [MEGHQQLAVTIPLTFFVYGEFRFSPQPSLAAKDDSKRLSGFEMRDYMKKFADNYLEGVIRYGFHIIGVMRPNNNSSSG
# WNVRVEDVRTKQQQTLTFDRIVLCTGAQYDLYIPLIFLSHTHKVYLIQFDAAGVTKDSPLRNTQDAFWGVRINDEGVPKPNGFHMLVKEGKIDIVAPA
# RVASYSSDGESVILNNGGKLKADTVVLATGYTSSWHPLFDGTFLIVVTGVFVLFADMQAEQTAAGLGINRHPPGPSLVKPRTNGITMSVFPILLQHIL
# AVNSGLPRSIVVLFQQRTSSTEILLSMEPWYVNSPRLPEIYPNISLQFTTNNGYAFEVTAHWISSYFLNDSNLKLPSSPEEALAHADRNSAWLRKRYP
# DMLLWANESYSSNLAFWTWPQVIDEMLSDMGLKVYRSGGSWFTWPFKVIELKEIEKLKEERDKLRSKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g8
###
# start gene g9
Scaffold_6	AUGUSTUS	gene	63233	63529	0.71	-	.	g9
Scaffold_6	AUGUSTUS	transcript	63233	63529	0.71	-	.	g9.t1
Scaffold_6	AUGUSTUS	stop_codon	63233	63235	.	-	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_6	AUGUSTUS	CDS	63233	63529	0.71	-	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_6	AUGUSTUS	start_codon	63527	63529	.	-	0	transcript_id "g9.t1"; gene_id "g9";
# protein sequence = [MSQQKALLLEKAKGAFVVSTVPILKPGPGQISIKVIAAALNPVDWKIQAWDFFMKKYPAILGTDIAGDVEEIGEGVEG
# FSKGDKVYVLKPRLPRTFRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g9
###
# start gene g10
Scaffold_6	AUGUSTUS	gene	65793	66470	0.26	+	.	g10
Scaffold_6	AUGUSTUS	transcript	65793	66470	0.26	+	.	g10.t1
Scaffold_6	AUGUSTUS	start_codon	65793	65795	.	+	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_6	AUGUSTUS	CDS	65793	66470	0.26	+	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_6	AUGUSTUS	stop_codon	66468	66470	.	+	0	transcript_id "g10.t1"; gene_id "g10";
# protein sequence = [MNFSVYRTSPSEGNSVSQKSGGSIADRKKALQNSGLSISTSNKRSSKDLHVNGTPISAAFSGANGVSPPSPNTSASST
# ISSSSGSTAAALSTLTGLTAPSTVPGSSTSNPIHSSSSTSSSSSSTSTSNTAFSFTSTSASFGSSPASASTSSISASNSSIYSHAFVSPSTFGPPSPG
# SSPSSSPTLPTRSFSTSSEYNAFNAQFPSIDELDEIRWAIRRFNTVQPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g10
###
# start gene g11
Scaffold_6	AUGUSTUS	gene	66544	67266	1	+	.	g11
Scaffold_6	AUGUSTUS	transcript	66544	67266	1	+	.	g11.t1
Scaffold_6	AUGUSTUS	start_codon	66544	66546	.	+	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_6	AUGUSTUS	CDS	66544	67266	1	+	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_6	AUGUSTUS	stop_codon	67264	67266	.	+	0	transcript_id "g11.t1"; gene_id "g11";
# protein sequence = [MGSTSSLRSNRSIKDLKEINTNGTGEASPSSSPASGIPSTDTGGSIRGQAPLASPVPATPGTPHAALRNFMVPVVERP
# SSTPSTPFRGSGSIWDSRPGSPTPTSTSKAPPVVPNKPSALSNSRSFYGNFDDPIPITGPTSPTSLDPSPSINGTSPLPSFTTPPSSSSLLTSPTVSN
# SSTTIPQKNTCTPTELYNYLREHKIILLDVRERAEFEKGHIELGKESKGVAWVCIEPDVLRRTE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g11
###
# start gene g12
Scaffold_6	AUGUSTUS	gene	67302	69197	1	+	.	g12
Scaffold_6	AUGUSTUS	transcript	67302	69197	1	+	.	g12.t1
Scaffold_6	AUGUSTUS	start_codon	67302	67304	.	+	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_6	AUGUSTUS	CDS	67302	69197	1	+	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_6	AUGUSTUS	stop_codon	69195	69197	.	+	0	transcript_id "g12.t1"; gene_id "g12";
# protein sequence = [MAPDESLSSSVTSYSIEDSLSLAPTSEASAFNNRHKFDLVVLYDRRSTSFSSTPPSKPSSSLVSTPSAFPVPGSHVTS
# EASNPDMSTLLRAIWEREFRKTLRRMPMMLVGGYEAWVKEFGISESGMSSNGPAARTTTVVNGTPNGVATNGAHSSSVPPPPMPPSISPQGSQGRNPF
# APGGPLASPAISTPSATFSLQHPGSNGSRSRASTSPSRPGAAGMGHKVNHSVDKSATSGSSHSRAPAESAHPNVSLSRSGRATPPFGPSTPLSPNLSG
# NGMKRPPTTGRTSFSSSSSMVTGATPLGASGPMSTLPEGALAPTILNGATPITYPSISTYSLPSASLSSVTTRSPAPFDGMNGMNGIASPPLPPQASI
# NPSVSRRRTSDYIDQSQEALALSGMNSPGYSTPGLGSPGYANGIGGTSGMNAYNGPSSSGLNGMNTYGGYNGYNANGAVNGISTIPRTTIDYPELSST
# HPILRPPPAAAAGTLERQDSIKRFPTPPSSSTTGAGSTTLSYPVPSSLSSPSFKSSTSIAPSGISSTALKKLGLSPLHPVPRLKSAEWPPRYWADSPI
# GTSGLKNMGNTCYMNAPIQCLSATVPFARFFTGECRCLSFSFSKTNWLISPWQRLISKLRLTT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g12
###
# start gene g13
Scaffold_6	AUGUSTUS	gene	70936	71742	0.85	+	.	g13
Scaffold_6	AUGUSTUS	transcript	70936	71742	0.85	+	.	g13.t1
Scaffold_6	AUGUSTUS	start_codon	70936	70938	.	+	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_6	AUGUSTUS	CDS	70936	71742	0.85	+	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_6	AUGUSTUS	stop_codon	71740	71742	.	+	0	transcript_id "g13.t1"; gene_id "g13";
# protein sequence = [MYVEGVIFPPQMAEPVHHTTSDRDVQIVRYLFQTLLPLELVDDIIEDAEYWPCIHVERSEPILVDAKRSISRGLKMAW
# CYLVSSPVPEALDSAGQGLGQSRVRRVDLKVQGHDQGWGKLSFPVTVILYMLRCSTPLPATHPGPWSWFEATIIKAFRESNLVWLPAALNGPVDPASV
# LAGSNFDQTFEGFTRWHIAANAIATQVKQDHSVVWTEQEAQAPGNVIGLRGRESLGHELVRALQPGDRIAILALAEVRVRRSLADVAGAYMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g13
###
# start gene g14
Scaffold_6	AUGUSTUS	gene	75694	76044	0.8	+	.	g14
Scaffold_6	AUGUSTUS	transcript	75694	76044	0.8	+	.	g14.t1
Scaffold_6	AUGUSTUS	start_codon	75694	75696	.	+	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_6	AUGUSTUS	CDS	75694	76044	0.8	+	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_6	AUGUSTUS	stop_codon	76042	76044	.	+	0	transcript_id "g14.t1"; gene_id "g14";
# protein sequence = [MKTGIVYLSSTTFPLEFSNCVLVTVQYLLLIININPESSQPMPSNMRTIALAAFLASATIMASALPTDGQMQQARAAV
# VKMRQEPAPNSTETTTTASTTPTSTSDSASCGVSDIFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g14
###
# start gene g15
Scaffold_6	AUGUSTUS	gene	78993	80020	0.71	+	.	g15
Scaffold_6	AUGUSTUS	transcript	78993	80020	0.71	+	.	g15.t1
Scaffold_6	AUGUSTUS	start_codon	78993	78995	.	+	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_6	AUGUSTUS	CDS	78993	79525	0.71	+	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_6	AUGUSTUS	CDS	79612	80020	0.93	+	1	transcript_id "g15.t1"; gene_id "g15";
Scaffold_6	AUGUSTUS	stop_codon	80018	80020	.	+	0	transcript_id "g15.t1"; gene_id "g15";
# protein sequence = [MDSNGTKFISSASYSPDAFKLDMSTRTGELISFSLPSLANPDLVSLLCQGLPLQNLPRVTQRLSDILTSFKEGKEYVF
# DWDSLQREQVLQAMQCLGQYLGQFEPALSYEGTDKRVVWRKSCWFASEGIAYPLLDTEHEISKFDGDLKDGLSGLVALQNSDVRASLEFLKRVLDSTL
# VSKSWGIGLHPDGNLLSALITDGPGLGVYDFDGTYREPGVGGTILMGGSTLYRWSKGTYLPTFHDVSIGQEQKKTSIVAFFNLPDMEDIPQSAGPDTV
# KNSFFHDIRVIKEDDKSPTGELAPLWRTIVQRHNLILPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g15
###
# start gene g16
Scaffold_6	AUGUSTUS	gene	81452	82356	0.76	-	.	g16
Scaffold_6	AUGUSTUS	transcript	81452	82356	0.76	-	.	g16.t1
Scaffold_6	AUGUSTUS	stop_codon	81452	81454	.	-	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_6	AUGUSTUS	CDS	81452	81932	0.81	-	1	transcript_id "g16.t1"; gene_id "g16";
Scaffold_6	AUGUSTUS	CDS	82091	82356	0.79	-	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_6	AUGUSTUS	start_codon	82354	82356	.	-	0	transcript_id "g16.t1"; gene_id "g16";
# protein sequence = [MQGSGSDTPLQETILYEFFSRYASTDLGCVLIFSGHNKSLIALAVLIARARPTAILSLITTQALYTKSIGELEKKLEK
# VEFELQKAQVKALYSQCEQGLTCMSSGKIFTQLPRPVVAIIDVSLSPVPTLLTTSCIFNYLSFHSSFHSSIPSSFPSVQILFILEKPYVGYAYDTIRN
# ISQDKVPIISWLSAPATFLFHHIGPKKLGGHAPEGWETVEGRKEVKSLLSRKADQGDSPDVQIEPHTKLVNC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g16
###
# start gene g17
Scaffold_6	AUGUSTUS	gene	84354	85924	0.27	+	.	g17
Scaffold_6	AUGUSTUS	transcript	84354	85924	0.27	+	.	g17.t1
Scaffold_6	AUGUSTUS	start_codon	84354	84356	.	+	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_6	AUGUSTUS	CDS	84354	84387	0.52	+	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_6	AUGUSTUS	CDS	84509	84760	0.56	+	2	transcript_id "g17.t1"; gene_id "g17";
Scaffold_6	AUGUSTUS	CDS	85080	85924	0.99	+	2	transcript_id "g17.t1"; gene_id "g17";
Scaffold_6	AUGUSTUS	stop_codon	85922	85924	.	+	0	transcript_id "g17.t1"; gene_id "g17";
# protein sequence = [MKKNNNLSTALACRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPGDP
# SGPGPGGPWVVLVPVPRPKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALK
# WAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPN
# NNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCKSERPENRRAVLPRLKKPPKQPLRLLKRNRKTSPQLLFPGTK
# RELR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g17
###
# start gene g18
Scaffold_6	AUGUSTUS	gene	89642	91150	0.95	+	.	g18
Scaffold_6	AUGUSTUS	transcript	89642	91150	0.95	+	.	g18.t1
Scaffold_6	AUGUSTUS	start_codon	89642	89644	.	+	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_6	AUGUSTUS	CDS	89642	91150	0.95	+	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_6	AUGUSTUS	stop_codon	91148	91150	.	+	0	transcript_id "g18.t1"; gene_id "g18";
# protein sequence = [MVIRFRPGKLGEKPDSITRRWDIYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAI
# ILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVLRQYTWPKVRDFVRDYVTSCTICGR
# NKPRRHQPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFF
# RALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLLIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFV
# VNLDELHAFLREEILLAQSHYKEQADRKRISHPEFPIGSEVFVLAKHIRSTCPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEP
# VTPNPFPNRTQSPPPPIEVDGEEEYVQRCRNP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g18
###
# start gene g19
Scaffold_6	AUGUSTUS	gene	95642	96298	0.91	-	.	g19
Scaffold_6	AUGUSTUS	transcript	95642	96298	0.91	-	.	g19.t1
Scaffold_6	AUGUSTUS	stop_codon	95642	95644	.	-	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_6	AUGUSTUS	CDS	95642	96298	0.91	-	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_6	AUGUSTUS	start_codon	96296	96298	.	-	0	transcript_id "g19.t1"; gene_id "g19";
# protein sequence = [MFLSKQEELDQFLEENLQKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYWKLNEYTVKNHYPLPLVADIISQLQGARY
# FTKFDVRWSYNNVRIKKGHEWKGAFATTRGLMNAIFADLIAAGKVAVYLDDILVFSNDLQEHQQVVWEVLTQLEKHDLYLHPEKCEFEQRQIEYLGLI
# ISEREVRMDSVKVAAVRNWPVPTNLLELQGFLGFANFYRCFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g19
###
# start gene g20
Scaffold_6	AUGUSTUS	gene	101047	101496	0.87	-	.	g20
Scaffold_6	AUGUSTUS	transcript	101047	101496	0.87	-	.	g20.t1
Scaffold_6	AUGUSTUS	stop_codon	101047	101049	.	-	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_6	AUGUSTUS	CDS	101047	101496	0.87	-	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_6	AUGUSTUS	start_codon	101494	101496	.	-	0	transcript_id "g20.t1"; gene_id "g20";
# protein sequence = [MEECSSAKSSMNKPQVFKGKDSTEVCHFLAQFQNWALEQPDLTKIQVKLIKLALGFFTEITGDWATPHLLHSSAENPP
# FGGSWEEFLKEFRQCFESVDPGMEARNAIKYLKQGKAQTVAEFAQKFKDICQVHAAGLHSAARYSEDLLLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g20
###
# start gene g21
Scaffold_6	AUGUSTUS	gene	104391	104636	0.54	+	.	g21
Scaffold_6	AUGUSTUS	transcript	104391	104636	0.54	+	.	g21.t1
Scaffold_6	AUGUSTUS	start_codon	104391	104393	.	+	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_6	AUGUSTUS	CDS	104391	104636	0.54	+	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_6	AUGUSTUS	stop_codon	104634	104636	.	+	0	transcript_id "g21.t1"; gene_id "g21";
# protein sequence = [MPAIDRPGQPPATTHAEKGKAFRDKLYQPPPDLPDEYPVNFTDTLSGDLPFQDITDTEVAEAIADTATHQPLDSHNNP
# TTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g21
###
# start gene g22
Scaffold_6	AUGUSTUS	gene	113239	113745	0.63	-	.	g22
Scaffold_6	AUGUSTUS	transcript	113239	113745	0.63	-	.	g22.t1
Scaffold_6	AUGUSTUS	stop_codon	113239	113241	.	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_6	AUGUSTUS	CDS	113239	113745	0.63	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_6	AUGUSTUS	start_codon	113743	113745	.	-	0	transcript_id "g22.t1"; gene_id "g22";
# protein sequence = [MDFLITNLGEEDIILGLPWLRKVNPEIDWEKGQLSVKPPRVDIEEVKDEQTSHPHLVASTIDRRTREFLIEGPQCEPT
# HTEMGLEENEATTATGESPIHQIQANHKTRWAWVKAGILEEQTEEVWCSAGFTYSQQLAERPTATNPLEPLKRWSLTRDAKAMAVHLNCH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g22
###
# start gene g23
Scaffold_6	AUGUSTUS	gene	116398	116850	0.28	-	.	g23
Scaffold_6	AUGUSTUS	transcript	116398	116850	0.28	-	.	g23.t1
Scaffold_6	AUGUSTUS	stop_codon	116398	116400	.	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_6	AUGUSTUS	CDS	116398	116850	0.28	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_6	AUGUSTUS	start_codon	116848	116850	.	-	0	transcript_id "g23.t1"; gene_id "g23";
# protein sequence = [MSTPVPPVPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPKVFKGKDGAEAWHFMAQFQNWASEQPDLTKSQVK
# LIKSALDFFTESAGDWATPICYISVQKTPLSVTSLPRFCVKEKGRNLMGTPTNQSNTQYASSLLLNLFNSKG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g23
###
# start gene g24
Scaffold_6	AUGUSTUS	gene	118289	118612	0.84	+	.	g24
Scaffold_6	AUGUSTUS	transcript	118289	118612	0.84	+	.	g24.t1
Scaffold_6	AUGUSTUS	start_codon	118289	118291	.	+	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_6	AUGUSTUS	CDS	118289	118612	0.84	+	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_6	AUGUSTUS	stop_codon	118610	118612	.	+	0	transcript_id "g24.t1"; gene_id "g24";
# protein sequence = [MWRRTADLQTILRACPRYEDYQDILKRVSDDVCLLDILGTKEGIEESGAFTKTGTQCSTPTEPNYAPLGIWEELEIIH
# HNIAGEGIIPEADWQEENIDSNDAEPKAI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g24
###
# start gene g25
Scaffold_6	AUGUSTUS	gene	123624	124966	0.24	+	.	g25
Scaffold_6	AUGUSTUS	transcript	123624	124966	0.24	+	.	g25.t1
Scaffold_6	AUGUSTUS	start_codon	123624	123626	.	+	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_6	AUGUSTUS	CDS	123624	124081	0.3	+	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_6	AUGUSTUS	CDS	124144	124966	0.4	+	1	transcript_id "g25.t1"; gene_id "g25";
Scaffold_6	AUGUSTUS	stop_codon	124964	124966	.	+	0	transcript_id "g25.t1"; gene_id "g25";
# protein sequence = [MEVPQKGLSMQGPNDPVRLRTVAGGTFWFGSPVASSLSVRIPIKGVGQVLLPSIMPPTPRPTLVPRTSNAHPYRAENQ
# CRCSDRLLESQLADSQRENSSLTSALRNTSRALESRQREVEQLRFSRREVLEREMEDCRVLDQFPALDEALGGSCISERFRKVQEDLQNATRERRVAV
# EKLITSTRKNSQLRTTLLHQQGLVDESNALATRQRRLVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHR
# LYRCDPATVLHHHHRYLGAIIEAVVAFLRRGLDSDDLDVIVHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYRMILEHSRFDSDSP
# FLTAAHHAGFVPPPDDSVEPPLHRRMLALSTALPHSDGVGRWEDIVPASPVSTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g25
###
# start gene g26
Scaffold_6	AUGUSTUS	gene	132279	133739	0.61	-	.	g26
Scaffold_6	AUGUSTUS	transcript	132279	133739	0.61	-	.	g26.t1
Scaffold_6	AUGUSTUS	stop_codon	132279	132281	.	-	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_6	AUGUSTUS	CDS	132279	133739	0.61	-	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_6	AUGUSTUS	start_codon	133737	133739	.	-	0	transcript_id "g26.t1"; gene_id "g26";
# protein sequence = [MDGVQHSSWIYGQDLTARLVPNPVHVPPRLSNPSVIPYQGSVSMQSHAVGAESQRDPNQQRTLVVHEEAVPPQGAPLG
# TPFVTGAQTNRPGMVVDSAHSQESVAMIQQQARVIETLQEQLREVKKGFTAGKVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVGPQPRSWQAT
# EPISFNRNTPTGAKDGNPQVEQAGQIPDTLSVDQRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGSFNPPPRVPPPHFSSQSRDRERPLSQGG
# QGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSDQGEQNQSSRNGGRREEDRGELPTGAPEVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRS
# TWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLKGSTLASRTGRSLNESS
# VPNLDPLTKRTRQGGD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g26
###
# start gene g27
Scaffold_6	AUGUSTUS	gene	146155	146421	0.72	-	.	g27
Scaffold_6	AUGUSTUS	transcript	146155	146421	0.72	-	.	g27.t1
Scaffold_6	AUGUSTUS	stop_codon	146155	146157	.	-	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_6	AUGUSTUS	CDS	146155	146323	0.72	-	1	transcript_id "g27.t1"; gene_id "g27";
Scaffold_6	AUGUSTUS	CDS	146414	146421	0.72	-	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_6	AUGUSTUS	start_codon	146419	146421	.	-	0	transcript_id "g27.t1"; gene_id "g27";
# protein sequence = [MISVNKSVSAAKKSSQYSLGSDEVAMRDVFWKLSEAPWPPRNASSKLSGMFAKPLAAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g27
###
# start gene g28
Scaffold_6	AUGUSTUS	gene	146577	148112	0.39	-	.	g28
Scaffold_6	AUGUSTUS	transcript	146577	148112	0.39	-	.	g28.t1
Scaffold_6	AUGUSTUS	stop_codon	146577	146579	.	-	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_6	AUGUSTUS	CDS	146577	147592	0.98	-	2	transcript_id "g28.t1"; gene_id "g28";
Scaffold_6	AUGUSTUS	CDS	148058	148112	0.39	-	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_6	AUGUSTUS	start_codon	148110	148112	.	-	0	transcript_id "g28.t1"; gene_id "g28";
# protein sequence = [MDYSTNIKELNLRLTSSICEVEGANDGVDDGADNGVDDSTEDGDSDGADDGANDGANDGADDGANDGANDGADDGADD
# GANDGANDGTDNGADDGADNGADDGANHGADDGAEDGADGGANHGAEDGADDGVNHGADDGADDGVNHGADDGADDGVNHGADDGADDGVNHGADDGA
# DDGVNHGADDGADDGVNHGTDDGAEDGAEDGANHGADDGADDGVNHGAEDGAEDGANHGADDGADDGANHGADDGADDGANHGADDGANHGADDGANH
# GADDGADDGANHGADDGAADGADDGANNGADDGANDGADDGANDGADDGTNNGADDGANDGAVNGANDGADHGAEKLIAVEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g28
###
# start gene g29
Scaffold_6	AUGUSTUS	gene	152291	153743	0.61	-	.	g29
Scaffold_6	AUGUSTUS	transcript	152291	153743	0.61	-	.	g29.t1
Scaffold_6	AUGUSTUS	stop_codon	152291	152293	.	-	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_6	AUGUSTUS	CDS	152291	153174	0.92	-	2	transcript_id "g29.t1"; gene_id "g29";
Scaffold_6	AUGUSTUS	CDS	153228	153359	0.91	-	2	transcript_id "g29.t1"; gene_id "g29";
Scaffold_6	AUGUSTUS	CDS	153437	153743	0.67	-	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_6	AUGUSTUS	start_codon	153741	153743	.	-	0	transcript_id "g29.t1"; gene_id "g29";
# protein sequence = [MAAIRTASLDRSPSTATITVNAERASSLLTFGSRSSSRAGESSISSLNNIHSRNPVFRPTHGHNRNCSSLLSSQPVGG
# SQGSSSEENCTTSRPLSVEARRQLDIPDELEVILANQSPRTSVHSIEDHTSFRSLDSLDAPQDVSKIIDLDNMLDVDEDNTKKLFHFTGELEKLNESG
# GSDRASSVEQLEKAFKTAAKIDLHYDFSGQGGLLQVDIPPLPVLPSMIAVDSSKSVELTNSSISSQEAHYCGSTQATSSSLEIFPISCLLDAKEPTLL
# PGSDSISSTDSQDLPDTFTPKVLESSVSSASRPSDGELDKSFKFGGFTKSLSQEVELEKPISFSDIIPSPSRVRALSNASSFVDDSVINSIIAKEVRR
# GFEFHDYRPSFYPPPVSNSTGSRRNNHSKQDSMMNFTYLLTVMSSMLVSRIHLIMVCQVCEKSPLQKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g29
###
# start gene g30
Scaffold_6	AUGUSTUS	gene	157230	157646	0.95	-	.	g30
Scaffold_6	AUGUSTUS	transcript	157230	157646	0.95	-	.	g30.t1
Scaffold_6	AUGUSTUS	stop_codon	157230	157232	.	-	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_6	AUGUSTUS	CDS	157230	157646	0.95	-	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_6	AUGUSTUS	start_codon	157644	157646	.	-	0	transcript_id "g30.t1"; gene_id "g30";
# protein sequence = [MATSPSDSSNDNVLAWLDRLRTSVQDAGGKAGPVAFTDVCFSGNGGDMDDEDDEDDEGEDHDRSGGRRLTHAQRIRLV
# PVHEGNDCEVGEGNGDQGGRGDDDALQSSLPDSHVPLGLIANLSLSSNKKKQVKETSNGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g30
###
# start gene g31
Scaffold_6	AUGUSTUS	gene	158121	158294	0.99	-	.	g31
Scaffold_6	AUGUSTUS	transcript	158121	158294	0.99	-	.	g31.t1
Scaffold_6	AUGUSTUS	stop_codon	158121	158123	.	-	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_6	AUGUSTUS	CDS	158121	158294	0.99	-	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_6	AUGUSTUS	start_codon	158292	158294	.	-	0	transcript_id "g31.t1"; gene_id "g31";
# protein sequence = [MKTPPKPSAPDKRPRPRQDNDDDSDDEDNEYLFEGGISVGVGGVTGTNGNRKSTGRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g31
###
# start gene g32
Scaffold_6	AUGUSTUS	gene	158365	159014	0.28	+	.	g32
Scaffold_6	AUGUSTUS	transcript	158365	159014	0.28	+	.	g32.t1
Scaffold_6	AUGUSTUS	start_codon	158365	158367	.	+	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_6	AUGUSTUS	CDS	158365	158502	0.28	+	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_6	AUGUSTUS	CDS	158634	159014	0.47	+	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_6	AUGUSTUS	stop_codon	159012	159014	.	+	0	transcript_id "g32.t1"; gene_id "g32";
# protein sequence = [MQTENEIWVSGASPLVNHELRQSGPSPWKMPINIAVKLCCSSNFIGTAHRIHTPSNHSDPRNPSGAFNPQHASKFPGS
# HGRRTARVGTFWWKDLALDQLLPVDKEKETALKAAEARKMASGTRNQNPQTQQQPAALAPGDETIDEEDNEDEDNENDDDEADEAEDSEEDADG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g32
###
# start gene g33
Scaffold_6	AUGUSTUS	gene	165979	166600	0.9	-	.	g33
Scaffold_6	AUGUSTUS	transcript	165979	166600	0.9	-	.	g33.t1
Scaffold_6	AUGUSTUS	stop_codon	165979	165981	.	-	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_6	AUGUSTUS	CDS	165979	166218	0.99	-	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_6	AUGUSTUS	CDS	166316	166440	0.99	-	2	transcript_id "g33.t1"; gene_id "g33";
Scaffold_6	AUGUSTUS	CDS	166489	166600	0.91	-	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_6	AUGUSTUS	start_codon	166598	166600	.	-	0	transcript_id "g33.t1"; gene_id "g33";
# protein sequence = [MFRNDSDANLNTHALEASAMEESCDDDDDDDDDDEVYSAVVAQSLTRLVSVEPDDDLVHSSSSESNNVPPQLDEPYTA
# PERWTQPVPLEFIPVFFDDERVEAIFKIVSEVQRDGLDCPGFNVKGTNEEELAAEFILLMKASIRCGDWSKVLSPNRHFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g33
###
# start gene g34
Scaffold_6	AUGUSTUS	gene	166752	167687	0.34	-	.	g34
Scaffold_6	AUGUSTUS	transcript	166752	167687	0.34	-	.	g34.t1
Scaffold_6	AUGUSTUS	stop_codon	166752	166754	.	-	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_6	AUGUSTUS	CDS	166752	167687	0.34	-	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_6	AUGUSTUS	start_codon	167685	167687	.	-	0	transcript_id "g34.t1"; gene_id "g34";
# protein sequence = [MHHAVDSPPGQGSAPSLSTSSLGFNVEARPLPTALEIRGVEPLPPPPVCRPYTSMQVPDTTDGYGRIVGLQGHSRVTT
# APGFSGLTTIQRTNHSRLDHASQSLPQAPRKRRGKAIRPPALGRRDQGPSIEDCVNIALGGIEVVSIDILVYPPMPPTPDINVWTSFFQISSTYITTL
# QFYRLPRQPIIYDINKDSYRMVLEALGLFHQYSHLPTSTTVFDLFSDITIKLKQRYNLPSISSSIPLSAQELLPLHLMGFSNHGRANGAYNTSKLRPM
# PYEMNTTIRNLLNGNGVYVVPKLVITRENHFCLHARE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g34
###
# start gene g35
Scaffold_6	AUGUSTUS	gene	171330	172390	0.53	-	.	g35
Scaffold_6	AUGUSTUS	transcript	171330	172390	0.53	-	.	g35.t1
Scaffold_6	AUGUSTUS	stop_codon	171330	171332	.	-	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_6	AUGUSTUS	CDS	171330	171569	1	-	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_6	AUGUSTUS	CDS	171617	171627	0.89	-	2	transcript_id "g35.t1"; gene_id "g35";
Scaffold_6	AUGUSTUS	CDS	171688	172390	0.55	-	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_6	AUGUSTUS	start_codon	172388	172390	.	-	0	transcript_id "g35.t1"; gene_id "g35";
# protein sequence = [MPPRESNHLASLQGGLAAPLPYPAHGSPVPPQESNRLTPLRGGLASSLPYSVHGSEGFERGNFDREGYRGGFTPSTIN
# SGTGDNMGYGGHSERSYGGGKGDYFEGRGAYGGNRADTYGDYDESTRVGGNYQRDRDIRGGEGNTGYQDYHQDSDMRYSEYRQEQDRYSWNGFTYDGN
# AGATWDRGMENGNMASMGSGKLEGHRRYQSSLIHGKIEGPPQYARVAPQELERIAQSQERKMQQEYDQDLLPTRKHAPKPPDSEALKVHARSQKTPSD
# DEMEEAERAEFEHDPEANEDEEDDSPNYTEDLPITSRQRKIHF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g35
###
# start gene g36
Scaffold_6	AUGUSTUS	gene	177066	178235	0.28	+	.	g36
Scaffold_6	AUGUSTUS	transcript	177066	178235	0.28	+	.	g36.t1
Scaffold_6	AUGUSTUS	start_codon	177066	177068	.	+	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_6	AUGUSTUS	CDS	177066	178235	0.28	+	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_6	AUGUSTUS	stop_codon	178233	178235	.	+	0	transcript_id "g36.t1"; gene_id "g36";
# protein sequence = [MMSDPLGQLRVCFTPLASAVVDTPEATLIACVGGSAKTSPFTLAMYKDYGDSFRHPPRLSSATLDTIDSIQARNIFPQ
# DLPAYQRASVAVRTNGVVHPFWRDWALAEPCEFLTPEPLHHWHKMFWDHDAKWAIQAVGGVQIDFLFSIHQSAVGYRHFKEGISALKQVTGRTQRDIQ
# RYLIPLISGAVSSKFVAALRSLTDFRYAGQAPRFSKTSSLRVQKALEEFHANKSEILNLKARVNPKGVLIDNWEIPKLEFLQSVEPSICASGPVMQWT
# ADVTEHAHIYLVKDPARSGNNHDMEVFICRSLDRQARVRRFDLMTAMKDAQVDFRLGDVEGDEGGDGEHIQEGGNEEEITYISTTEELVTQLNPVSHK
# LLGLSVLNRTFFSKPVC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g36
###
# start gene g37
Scaffold_6	AUGUSTUS	gene	191283	191543	0.78	-	.	g37
Scaffold_6	AUGUSTUS	transcript	191283	191543	0.78	-	.	g37.t1
Scaffold_6	AUGUSTUS	stop_codon	191283	191285	.	-	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_6	AUGUSTUS	CDS	191283	191543	0.78	-	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_6	AUGUSTUS	start_codon	191541	191543	.	-	0	transcript_id "g37.t1"; gene_id "g37";
# protein sequence = [MIAYSHVMAIDRHCKYVSRGGVNDSESVSSALNNVDDEERYFGSTVEPAHTVEGTTVRNWDNSSCYITCEQGKSGVVP
# PISDLPDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g37
###
# start gene g38
Scaffold_6	AUGUSTUS	gene	192006	192488	0.41	-	.	g38
Scaffold_6	AUGUSTUS	transcript	192006	192488	0.41	-	.	g38.t1
Scaffold_6	AUGUSTUS	stop_codon	192006	192008	.	-	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_6	AUGUSTUS	CDS	192006	192424	0.44	-	2	transcript_id "g38.t1"; gene_id "g38";
Scaffold_6	AUGUSTUS	CDS	192467	192488	0.46	-	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_6	AUGUSTUS	start_codon	192486	192488	.	-	0	transcript_id "g38.t1"; gene_id "g38";
# protein sequence = [MKLQDRRQLFDLINQKLLPCKWKANRITSQINYGTNTEVLKKRLTMCLIVDTRREDDLHNFVSGKDKGVFSDIEIFCA
# VGTVEDFDEGRNVGGKVADVVDVPLSFSRSLYVVVSLSFNVEILKALTTTRLRVMLMSASGAGEATNG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g38
###
# start gene g39
Scaffold_6	AUGUSTUS	gene	193891	194763	0.87	+	.	g39
Scaffold_6	AUGUSTUS	transcript	193891	194763	0.87	+	.	g39.t1
Scaffold_6	AUGUSTUS	start_codon	193891	193893	.	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_6	AUGUSTUS	CDS	193891	194763	0.87	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_6	AUGUSTUS	stop_codon	194761	194763	.	+	0	transcript_id "g39.t1"; gene_id "g39";
# protein sequence = [MSNNHVYADYSDYAAYVSYTDEIPEYSPNPTPTSALNSNASISNTPTPPYTSPPPPPPPPSASLISTLPEFSEGRTDD
# ELETLYDKVWTGYGAGDLRNFENGAGIEGSGYGDGYGAGPSSPTSRNSSYLASPTSTTSYSSANSISMATNGSATPSSVPRPPSLPSSSIAYPPTPRS
# SRPLPLPPGAHGPPSATIPPSLSSASVPAHSAAASIFRNSVASGSDGRSTPTLDSPLSARGRQLPTAPGASSATSPASSNISPAGYFESVPGVPLNSG
# GLVPPPPPWVLETDWD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g39
###
# start gene g40
Scaffold_6	AUGUSTUS	gene	198563	199387	0.67	+	.	g40
Scaffold_6	AUGUSTUS	transcript	198563	199387	0.67	+	.	g40.t1
Scaffold_6	AUGUSTUS	start_codon	198563	198565	.	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_6	AUGUSTUS	CDS	198563	199387	0.67	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_6	AUGUSTUS	stop_codon	199385	199387	.	+	0	transcript_id "g40.t1"; gene_id "g40";
# protein sequence = [MTKARAKDDITKYFVNRRPIPLDLLTLVNFTDPPTQRGAGLLRNLRGGERHNTTDTSPSLLTASSSTGASGLSSSTST
# AGPGTSAPTPGDTSRTDSRSVYPCTIHHNGRMGGNYILYAESASARSEWKEKLEEAVGLRKVVQESNKVFEIETLSSDTFLVPSMGLGADRGERGAAG
# GGLGPSYENAFTGKVTCSVPFNTPDGRGLVAIGCAEGVWIGFRHDSRCKSIGVLHPATTFLIDLTAMRRVLHLKMVTQCAMLEDFGIFLVLADKVCLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g40
###
# start gene g41
Scaffold_6	AUGUSTUS	gene	204790	205204	0.78	-	.	g41
Scaffold_6	AUGUSTUS	transcript	204790	205204	0.78	-	.	g41.t1
Scaffold_6	AUGUSTUS	stop_codon	204790	204792	.	-	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_6	AUGUSTUS	CDS	204790	205066	0.93	-	1	transcript_id "g41.t1"; gene_id "g41";
Scaffold_6	AUGUSTUS	CDS	205158	205204	0.78	-	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_6	AUGUSTUS	start_codon	205202	205204	.	-	0	transcript_id "g41.t1"; gene_id "g41";
# protein sequence = [MALKSTEEERAFLRARANAWRPSDGYAFYEAANDPNEWDPELEVYHTGPRSGISSRDSSARVSVEALVPTTNTNEPLH
# LHPPSESHQDSESNRNSYISDPEMSFMPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g41
###
# start gene g42
Scaffold_6	AUGUSTUS	gene	205658	206821	1	-	.	g42
Scaffold_6	AUGUSTUS	transcript	205658	206821	1	-	.	g42.t1
Scaffold_6	AUGUSTUS	stop_codon	205658	205660	.	-	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_6	AUGUSTUS	CDS	205658	206821	1	-	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_6	AUGUSTUS	start_codon	206819	206821	.	-	0	transcript_id "g42.t1"; gene_id "g42";
# protein sequence = [MAWSTIKYGVALKSKYLPVFWDRKAQTVTDLNSELGLVDEKLVNAAHDKKGKHLAIGWPEDTNKTRRTVLIATLEYEI
# IDWKLKVKIGGLGVMSSLMGKAMTDVDLIWVVPKVKDLEYPAGDPDDPIEVVIFNETYLVDVEVHVFDHITYVIIDSPVFRAQTKADPYPSRMDDLSS
# AIFYSTWNQAIAATIRRYPHIDIYHINDYHGALAPIYLLPKVFPVCLSLHNAEFQGLWPLRTKEEMREVCSAFNISKKHCVKYVQFGNTFNLLHAAAE
# FVSLHQKSVGVAGVSDKYGKRSWARYPALWTLKHVDSLPNPDPTDIAALDEKPIKSKGVKVDRIAEKARPESKRQAQEWAGIEQNPNSNLFVFVGRWS
# KQKGVDLIADVMPGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g42
###
# start gene g43
Scaffold_6	AUGUSTUS	gene	207665	208666	0.83	-	.	g43
Scaffold_6	AUGUSTUS	transcript	207665	208666	0.83	-	.	g43.t1
Scaffold_6	AUGUSTUS	stop_codon	207665	207667	.	-	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_6	AUGUSTUS	CDS	207665	208666	0.83	-	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_6	AUGUSTUS	start_codon	208664	208666	.	-	0	transcript_id "g43.t1"; gene_id "g43";
# protein sequence = [MPLSRSLLGCSDPSVSLDHFDPTAPTRHLFTQFNFLRSTYTALQDGFTLTQLGNWTYEIQRPGSGGVSTEMGLWSISR
# EGMQNVQVLNGTHNGTVWMFMTNENVTKSYDFNCSTNLDWIKAPYPVEPGNSTGAVVRNLIYPFENYTLQASLSPYFNDGNAPYFGCLESITMDPYGF
# KVLVVDSDWVGAPPVLTLFTPGHDARLLSASSSSNGLDNVDISLGFNLDMDCDSVTNSITLNMSTSGHGSAPLIGNVSCLSVSPFNSTGLSGVPQTAW
# VWNATLTNFPDGLLTITVANPTSAVGVETGVSSLRSQPTSKKFHSQFLFAYIGNRPSHP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g43
###
# start gene g44
Scaffold_6	AUGUSTUS	gene	210091	210723	0.73	-	.	g44
Scaffold_6	AUGUSTUS	transcript	210091	210723	0.73	-	.	g44.t1
Scaffold_6	AUGUSTUS	stop_codon	210091	210093	.	-	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_6	AUGUSTUS	CDS	210091	210723	0.73	-	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_6	AUGUSTUS	start_codon	210721	210723	.	-	0	transcript_id "g44.t1"; gene_id "g44";
# protein sequence = [MALVIGLLVLSSLFSLPNVVHASPYNEQLIQYNLNLNKTATSPLDYYTNRTNTTYTPSPSNWRSLPIYTVLLDKFANG
# EPSNDDFFKTPYESDWRETQLRFGGDLKGMGDDRMLDYLQGMGVRVIYVAGTIFLNEIWEADGRLGSCCRDWNDSFYLTGYSPLDFSVLDPHWGTWDE
# WVQTIDKIHARGMYFMADFTVGTMSDLIGFKGCV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g44
###
# start gene g45
Scaffold_6	AUGUSTUS	gene	212010	212456	0.87	-	.	g45
Scaffold_6	AUGUSTUS	transcript	212010	212456	0.87	-	.	g45.t1
Scaffold_6	AUGUSTUS	stop_codon	212010	212012	.	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_6	AUGUSTUS	CDS	212010	212456	0.87	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_6	AUGUSTUS	start_codon	212454	212456	.	-	0	transcript_id "g45.t1"; gene_id "g45";
# protein sequence = [MVYRFPLPFAKTLVPFDEHGKESLAAKAVVDMIMQQVAGELHLPMPPKGTGTGSAQLPEIVIDNARSSSLKGYTPSKT
# FEFEITNEDGTGSCRGGCTCFVRPALKKPGVYEVGITDIWADKYVIGRSLTMDPEALQALNTTFPFRWPE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g45
###
# start gene g46
Scaffold_6	AUGUSTUS	gene	214189	215006	0.29	-	.	g46
Scaffold_6	AUGUSTUS	transcript	214189	215006	0.29	-	.	g46.t1
Scaffold_6	AUGUSTUS	stop_codon	214189	214191	.	-	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_6	AUGUSTUS	CDS	214189	214700	0.77	-	2	transcript_id "g46.t1"; gene_id "g46";
Scaffold_6	AUGUSTUS	CDS	214763	215006	0.33	-	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_6	AUGUSTUS	start_codon	215004	215006	.	-	0	transcript_id "g46.t1"; gene_id "g46";
# protein sequence = [MVRVLLLGGHGKVALHMTKLLAAHNHKISSVIRNPDHAIEISDQYPENPSLIEPVVASIEETDEEGAKELMKGVEWVI
# WSAGAGGKGGPERTKAVDEIAAKRFIKAALLAPSVTKFLMVSASSSRRSPASYWTDSDRVAFKKTWDSIGVYSEAKTVADEYLYDESRKSSKTIWVDI
# CLRPGSLSDSHGTGKVDLGKAKLVGSVPREDVAAVAVELLEKETGGGLWVDLIGGSEPISSAVERVVSQRITSRE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g46
###
# start gene g47
Scaffold_6	AUGUSTUS	gene	224378	224722	0.53	-	.	g47
Scaffold_6	AUGUSTUS	transcript	224378	224722	0.53	-	.	g47.t1
Scaffold_6	AUGUSTUS	stop_codon	224378	224380	.	-	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_6	AUGUSTUS	CDS	224378	224722	0.53	-	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_6	AUGUSTUS	start_codon	224720	224722	.	-	0	transcript_id "g47.t1"; gene_id "g47";
# protein sequence = [MMSIIRANFIVFPISPRNSPQAVAHLISKVSVDHILTGHESSMQDLVREALEIVKTSAMNHVPQVSLAPFFEDLFLEN
# PVTNADDLPFKRRNPHDILFYIHSSGVYIFDIFMLC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g47
###
# start gene g48
Scaffold_6	AUGUSTUS	gene	233902	234483	0.33	+	.	g48
Scaffold_6	AUGUSTUS	transcript	233902	234483	0.33	+	.	g48.t1
Scaffold_6	AUGUSTUS	start_codon	233902	233904	.	+	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_6	AUGUSTUS	CDS	233902	234483	0.33	+	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_6	AUGUSTUS	stop_codon	234481	234483	.	+	0	transcript_id "g48.t1"; gene_id "g48";
# protein sequence = [MLPPSKDSVGARILKKMGWRVGQGIGPRISLKQRRLQDLQASTGSAFSVNTSEIIPDEDAEEASKHTYAPRDTPVLVV
# ERKDNSHGLGYRPGMSLNDSLGVKGSGGSSTGPNISCKCLFNMQFDRQGLMRVFCSKAGFGLGALNDADEDDLDVYDGSSANVRNRLAYDASDDPERD
# RTFLAGSKSKLVGNSHF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g48
###
# start gene g49
Scaffold_6	AUGUSTUS	gene	234967	236441	0.95	+	.	g49
Scaffold_6	AUGUSTUS	transcript	234967	236441	0.95	+	.	g49.t1
Scaffold_6	AUGUSTUS	start_codon	234967	234969	.	+	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_6	AUGUSTUS	CDS	234967	235971	0.96	+	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_6	AUGUSTUS	CDS	236076	236441	0.96	+	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_6	AUGUSTUS	stop_codon	236439	236441	.	+	0	transcript_id "g49.t1"; gene_id "g49";
# protein sequence = [MSQKDRDRLKNIAANLHSTTGPPATASASDQISPPAPAPTATTPRIPRTDPQIARAALTGFKPFPSDPVKQARYTAYL
# QSQADTSSTIMLEPLPHQSIPEFNSEMEEYAQSAIVFKPVSGAMAGRFTSAAVVEHGPKVIEGLHTPAFEEQSSSNEEKKAAEEKELSPKENAARMGM
# YGHLTRETVPWQPARLLCKRFGVKDPNPEPKTEDPTQSSVPDFQDPSAFDPSVPSGTAAADYGIVSINNNNTGASTSGPRDLANVGLGDEDDTQGRDT
# LTYERPSVDVFKAIFASDDEDSSDEEGGDEGDKGPDIETSGPSSETIMSTKISPLSSIPVVERKEEEEKRKAIVSFMDDEAGDTLNVVVEKPKKKRKK
# DKEKDREKDKETGGLKLKGEKEVEKEVKSKRRNAVDENEDDMWVEKPAPPAVTVASDVEMADTSTALSVGSEVPRGRKRAIDFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g49
###
# start gene g50
Scaffold_6	AUGUSTUS	gene	241259	242356	0.98	-	.	g50
Scaffold_6	AUGUSTUS	transcript	241259	242356	0.98	-	.	g50.t1
Scaffold_6	AUGUSTUS	stop_codon	241259	241261	.	-	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_6	AUGUSTUS	CDS	241259	242356	0.98	-	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_6	AUGUSTUS	start_codon	242354	242356	.	-	0	transcript_id "g50.t1"; gene_id "g50";
# protein sequence = [MSLRLPFTPTFPSFGAKTKKSSAEWLRRQSRDPYVKQRALGAVIASTKTSSILGNLGSNNDGISSSISSPLAFRSRSA
# FKLIEIHEKYDQFLLKPDVRVVVDLGAAPGGWSQVVSQVVHGKDPTQVDAREDVDEVVEYPVDQDEEGTEEDSDTKDTWHRKRKSKIKAKNRPKPLPP
# KPLEFYDPLNFDAEIEHLSSSSLDLQSKVKIIAVDRLSMDPITGVQTLKADFLHPRTEGMIRSLIGGPSITPYKLTLSTPDTPKVDVVLSDIAPNTVG
# VPAVDSEANFQVAQAVFQFAYKYLRTADEIGRTRGGVLVMKHFAHPKMDVFRKEVLEEYFKDVIYTKPRASRQESKEGYFLCRGFWPREYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g50
###
# start gene g51
Scaffold_6	AUGUSTUS	gene	243317	243670	0.9	+	.	g51
Scaffold_6	AUGUSTUS	transcript	243317	243670	0.9	+	.	g51.t1
Scaffold_6	AUGUSTUS	start_codon	243317	243319	.	+	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_6	AUGUSTUS	CDS	243317	243670	0.9	+	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_6	AUGUSTUS	stop_codon	243668	243670	.	+	0	transcript_id "g51.t1"; gene_id "g51";
# protein sequence = [MLMQERQEHLLRTRIEKDYGVTVELSTELSSFEEHEDHVIAHIVKHVPNAGENTEETVKVDFLVGADGGRSTVRKQLG
# LPFMGDDSESLKEIGMVAGDIEALEGTLDQKVGPSVNSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g51
###
# start gene g52
Scaffold_6	AUGUSTUS	gene	244403	245038	0.61	+	.	g52
Scaffold_6	AUGUSTUS	transcript	244403	245038	0.61	+	.	g52.t1
Scaffold_6	AUGUSTUS	start_codon	244403	244405	.	+	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_6	AUGUSTUS	CDS	244403	245038	0.61	+	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_6	AUGUSTUS	stop_codon	245036	245038	.	+	0	transcript_id "g52.t1"; gene_id "g52";
# protein sequence = [MLSKTTELFHKTFQPASPEKMAEGWRRGYELRMFGVNYRKSGITLDEKYSYGADEAVDPYRSGDDGTVRAGDRAPDAP
# KLSPVGQTNATTYTTFLDLYNPAYHTILIFADPGRNREAIETILETIQGLPSSKEIIKTIVVLPQTSSSANDASTSSADMVLLDTEGYAYKHYDVAGD
# SQQPTVFIVRPDGFIGGLVFGVEGIKKYFGLILKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g52
###
# start gene g53
Scaffold_6	AUGUSTUS	gene	247276	247680	0.6	-	.	g53
Scaffold_6	AUGUSTUS	transcript	247276	247680	0.6	-	.	g53.t1
Scaffold_6	AUGUSTUS	stop_codon	247276	247278	.	-	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_6	AUGUSTUS	CDS	247276	247556	0.87	-	2	transcript_id "g53.t1"; gene_id "g53";
Scaffold_6	AUGUSTUS	CDS	247656	247680	0.61	-	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_6	AUGUSTUS	start_codon	247678	247680	.	-	0	transcript_id "g53.t1"; gene_id "g53";
# protein sequence = [MLPLLIVNKPLKEVLTGRAFAGNGKEPSQEDLNRRAFAGNGKEPSPEDLNRRAFAGNGEEPSPEDLNRRAFAGNGKEP
# SQEDLNRRAFAGNGEEPTQEDLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g53
###
# start gene g54
Scaffold_6	AUGUSTUS	gene	248166	248810	0.87	+	.	g54
Scaffold_6	AUGUSTUS	transcript	248166	248810	0.87	+	.	g54.t1
Scaffold_6	AUGUSTUS	start_codon	248166	248168	.	+	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_6	AUGUSTUS	CDS	248166	248810	0.87	+	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_6	AUGUSTUS	stop_codon	248808	248810	.	+	0	transcript_id "g54.t1"; gene_id "g54";
# protein sequence = [MAAPPYRNLLALVSVSLLFSIVLNVYNLKKLHNPIAGELGLKYLLIFESFPTTLVGPSPVPPVASELPMTVNPAVLNF
# MLAQHYEITNASEWATLVPHKGSRVRLPSKSSPGDEFEVALFYDLHCLDVIRAVFVSMRDGSSAHSTEAEECLGTIRQAILCAADITLEPTEIVCYDG
# ESCNNFGPEASGDNVEHSCRDWVQVREFVESNQEGWDF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g54
###
# start gene g55
Scaffold_6	AUGUSTUS	gene	249427	249738	0.54	-	.	g55
Scaffold_6	AUGUSTUS	transcript	249427	249738	0.54	-	.	g55.t1
Scaffold_6	AUGUSTUS	stop_codon	249427	249429	.	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_6	AUGUSTUS	CDS	249427	249738	0.54	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_6	AUGUSTUS	start_codon	249736	249738	.	-	0	transcript_id "g55.t1"; gene_id "g55";
# protein sequence = [MTEQVLPSGGAVLMRNGAPIITTLTGVIDRIPFDSPNKIEERISGQPIVKIDTNIAMLWTPYDFLINDKVDHIGTDIW
# SFAKLDGKWVVSSVADNALAPETVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g55
###
# start gene g56
Scaffold_6	AUGUSTUS	gene	255223	256664	0.75	+	.	g56
Scaffold_6	AUGUSTUS	transcript	255223	256664	0.75	+	.	g56.t1
Scaffold_6	AUGUSTUS	start_codon	255223	255225	.	+	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_6	AUGUSTUS	CDS	255223	255769	0.93	+	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_6	AUGUSTUS	CDS	255823	256664	0.8	+	2	transcript_id "g56.t1"; gene_id "g56";
Scaffold_6	AUGUSTUS	stop_codon	256662	256664	.	+	0	transcript_id "g56.t1"; gene_id "g56";
# protein sequence = [MDVKTNVFCASGMHLPNGSYATFGGNGAITVGGNIGSNTTDGGSAASYDMTYQDYDGRKAIRILNPCTNDDDFTSEEC
# QWFDNPDVLSMQKERWYSAAEPLGDGTIVLIGGFVNGGYINRNYPNTDPTYEGGAAEPTYEFYPANGTTATIMQFMVKTSGLNSYAHTYLMPSGKMLV
# QANYSTMLWDPATNTETDLPDMPGEVVRVYPASGGVAMLPLTPANNYTPTVLFCGGSNMTDEMWGNYSWPVIDTFYYPASNDCQRLTPEPADGSTPAY
# EQDDDMLEGRTMGQFIILPTGELLMVNGGENGTAGYSENTDTTLEYGQMPYGMSLAAAPVGKPALYNPNAPAGSRWSNDGFATSTIPRLYHSSAILLP
# DASVMIAGSNPNVDVNLTTYFPRPTRPKFSILPISRLVIVQFLPASRPLFHMVVLTSTYLFPHLPTQVPRTMLQPILLLWLFVLDGPRTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g56
###
# start gene g57
Scaffold_6	AUGUSTUS	gene	256684	257016	0.86	-	.	g57
Scaffold_6	AUGUSTUS	transcript	256684	257016	0.86	-	.	g57.t1
Scaffold_6	AUGUSTUS	stop_codon	256684	256686	.	-	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_6	AUGUSTUS	CDS	256684	257016	0.86	-	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_6	AUGUSTUS	start_codon	257014	257016	.	-	0	transcript_id "g57.t1"; gene_id "g57";
# protein sequence = [MTRAPTTPPTIAPVCDELALLSVELEELEPDPVPDVSVDASWLGEQCSRGSGLCFDVSSANYDEGAVGRDAVNDDEYH
# CGSRLEDICVRWHLRGMHDYGTITVTVYVVLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g57
###
# start gene g58
Scaffold_6	AUGUSTUS	gene	260004	261266	0.32	-	.	g58
Scaffold_6	AUGUSTUS	transcript	260004	261266	0.32	-	.	g58.t1
Scaffold_6	AUGUSTUS	stop_codon	260004	260006	.	-	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_6	AUGUSTUS	CDS	260004	260568	1	-	1	transcript_id "g58.t1"; gene_id "g58";
Scaffold_6	AUGUSTUS	CDS	260803	261266	0.48	-	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_6	AUGUSTUS	start_codon	261264	261266	.	-	0	transcript_id "g58.t1"; gene_id "g58";
# protein sequence = [MRTNPAFKDFVQRCTRHPDAHRLDMKNFINRPIPRLLRYELLLKGILEETPVGPIAASNRQGGSSTSSRGANAEHEDH
# SSIPQVLDVIRRLGKDTEPGVVNAKSKVELWKYNEGLVFKQGEWIDMDLLAESRSLIHSGKLLRQTDGLEWSGWTEFLTEPPVQRGTGPGLLRGLRSQ
# GTIGQGLEASSPNELLASPEGSTPIETSSSEMSPSPSSRLLYPITLHHLGRQSVSPTTSSLIPPLPAGPSSSRTAQQAKPPPNVILYTESATARAEWG
# AKLQEALGIRRVVQESNKVFEIETLSSETFVTPAGLDAPGVGSAGVLGIGYSPDTVTGKVTCSVPFSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g58
###
# start gene g59
Scaffold_6	AUGUSTUS	gene	261724	263258	0.39	-	.	g59
Scaffold_6	AUGUSTUS	transcript	261724	263258	0.39	-	.	g59.t1
Scaffold_6	AUGUSTUS	stop_codon	261724	261726	.	-	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_6	AUGUSTUS	CDS	261724	262079	0.65	-	2	transcript_id "g59.t1"; gene_id "g59";
Scaffold_6	AUGUSTUS	CDS	262184	263258	0.39	-	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_6	AUGUSTUS	start_codon	263256	263258	.	-	0	transcript_id "g59.t1"; gene_id "g59";
# protein sequence = [MPPRMTSGHSTVLPLPTAVVTMLTRCYVPTCVDDKPCYAWDCPKRGLSIQRMLSSSSSNIVPVVVNIPIISSYPYLEE
# ERKPWKETVPEEVFSRIPEGEVKRQVAIHDLITKETDYLADLIVLETQFMLPLSEWVVSISGSQNSENGLVATTTSSHSPPPTPSGSTAAFVSPLPMR
# NSSSSFSSSSSKSSPLLAFSPALQTLFPLLQALITAQTRLLDNLRVRARESQYGIIEGIGDLYLERAASSEWRAGWGGGWVQGRGFVSTADRAKEGWT
# GGRGYDEWVGVWATCGLGGLGIFSPAISTTTDEYGNEDWKKIIVEQEMQRQQKQRESNLTAAEDESTGEVGTETGGIKEPREPRESSRSADPVSSPSS
# LIDTAANSTSPAALKTNKKKAGKEKEENSDASYLREAIRAMRALWGYGKVKTFQLSMNVGASGGDDNKGSMGVMGEAAIKWEWFNLVSEEERKEIGKT
# EVKRQA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g59
###
# start gene g60
Scaffold_6	AUGUSTUS	gene	263582	265128	0.21	-	.	g60
Scaffold_6	AUGUSTUS	transcript	263582	265128	0.21	-	.	g60.t1
Scaffold_6	AUGUSTUS	stop_codon	263582	263584	.	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_6	AUGUSTUS	CDS	263582	264316	0.78	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_6	AUGUSTUS	CDS	264453	264898	0.35	-	2	transcript_id "g60.t1"; gene_id "g60";
Scaffold_6	AUGUSTUS	CDS	264990	265128	0.42	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_6	AUGUSTUS	start_codon	265126	265128	.	-	0	transcript_id "g60.t1"; gene_id "g60";
# protein sequence = [MENKRPLSPEVPDEDLQQLYDQVWAGFGSEDTQSIESASSYPFNCLYNLPDVVYNYGSPSTTGGSNIYQHQQDTDNYS
# GYISSPISPVSTAAATYARSARSASIRSNGRERSGSGSARRLPLPPTPANGWNAPTQMTTAKEYQRQGHVSSMSTSSISSVASSRKLPATPTSAPVVT
# LAGRICTVWVSDFPLVLGRQTCNLEGTAQIPYQTNRSMQVVSGSSANTSPALVAAPLPPSQSPRSYFDEKSRKDPGLSMNRWNSTTSSIVNGVNAQGL
# RIPPPPPLLSFQRPSQLTQPQYSMPEPDLYADPNAGPSNIVRRPTDMLRELKDGAKYDRYHPEERHDQLGVDADEASYDWDEDYELQQQRFAADAPRS
# YQSYSSSQSQPQGSSSRRNRKPKNRRDWTYEYSEGNDNEYSSDEFINYSLLSHLAVQLRIKSREAFM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g60
###
# start gene g61
Scaffold_6	AUGUSTUS	gene	270557	271753	0.92	-	.	g61
Scaffold_6	AUGUSTUS	transcript	270557	271753	0.92	-	.	g61.t1
Scaffold_6	AUGUSTUS	stop_codon	270557	270559	.	-	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_6	AUGUSTUS	CDS	270557	271429	1	-	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_6	AUGUSTUS	CDS	271493	271753	0.92	-	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_6	AUGUSTUS	start_codon	271751	271753	.	-	0	transcript_id "g61.t1"; gene_id "g61";
# protein sequence = [MTLGISIPSPMTRGSPSSDDSSQVHTPVSPIFAEPSQRHSTAAEPSSRLANGGNKRKSTRRVNTAERRATHNAVERAR
# RETLNGRFLDLAALLPNLSQIRRPSKSAIVNSSIAHIHASRRHRLLASRELRTLKLESDALRRELNDWRDRAGIPRIQEPHRGDAFSTILSGEIEILP
# IPDADEEEGEYMYGDEEGAGEGAVYATGGSPEFAAPPPPQMNTNVSQRTSSNGYDLSIEQQQMMRRAAAPMVASPSGMVVENPVMGMIYNNNMGSGPY
# PAVSFAPDLDQNKWRPSVNEQGIMASVSRRSSIATSDVRRNRDRAMSTSTTGSSGGGSPAHMAYYDPGWNATMGGMAPNMGANMGAMITNGNMGNGGA
# YSTVM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g61
###
# start gene g62
Scaffold_6	AUGUSTUS	gene	288745	289187	0.45	+	.	g62
Scaffold_6	AUGUSTUS	transcript	288745	289187	0.45	+	.	g62.t1
Scaffold_6	AUGUSTUS	start_codon	288745	288747	.	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_6	AUGUSTUS	CDS	288745	288749	0.45	+	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_6	AUGUSTUS	CDS	288860	289187	0.97	+	1	transcript_id "g62.t1"; gene_id "g62";
Scaffold_6	AUGUSTUS	stop_codon	289185	289187	.	+	0	transcript_id "g62.t1"; gene_id "g62";
# protein sequence = [MFREKAINQGYWTGDPGDDVRTASHPFYGQEDGDLPPLDELANDPTQPNYTPYNSKDEEKADGIFVNDDDEIQDVKDF
# LVAEGFDYDREDGNWGIDVYCEAVMKIQQLLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g62
###
# start gene g63
Scaffold_6	AUGUSTUS	gene	290541	290948	0.56	+	.	g63
Scaffold_6	AUGUSTUS	transcript	290541	290948	0.56	+	.	g63.t1
Scaffold_6	AUGUSTUS	start_codon	290541	290543	.	+	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_6	AUGUSTUS	CDS	290541	290948	0.56	+	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_6	AUGUSTUS	stop_codon	290946	290948	.	+	0	transcript_id "g63.t1"; gene_id "g63";
# protein sequence = [MKEVSILFTALKNSPVTTQRITKDKATKYPAQKVVEAMFESAWKELGLEQSGKLPVMHFFTYQYLRNWNPREVLKYEI
# TRDAAKHGKGTCNDNCYATATPVEGKHAHFDFEIELDVEREDGKLQVFSKKGVKVDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g63
###
# start gene g64
Scaffold_6	AUGUSTUS	gene	293063	293764	0.57	-	.	g64
Scaffold_6	AUGUSTUS	transcript	293063	293764	0.57	-	.	g64.t1
Scaffold_6	AUGUSTUS	stop_codon	293063	293065	.	-	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_6	AUGUSTUS	CDS	293063	293764	0.57	-	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_6	AUGUSTUS	start_codon	293762	293764	.	-	0	transcript_id "g64.t1"; gene_id "g64";
# protein sequence = [MRIDRKWNTTELLDFIATKLPNAMRYIQLTPRVVHTVYNRLLDDKKYAFFSPVVLCLKDGRTWKAYPGKAGNWPDGEL
# VRLKCVSKRNYGWEDNWIVLCTSVRCYIHSISLLGHLGARCGREELMAAGEQFMVGLNPSPPPPTISDEDDETSGRQDKGKGRARASSKDVKRDARRL
# RENRPLFLSESSESSDGDNPAADAGYSSDDYPGTTEAITASLGQQNRPTTRGEYSFH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g64
###
# start gene g65
Scaffold_6	AUGUSTUS	gene	294081	294575	0.6	-	.	g65
Scaffold_6	AUGUSTUS	transcript	294081	294575	0.6	-	.	g65.t1
Scaffold_6	AUGUSTUS	stop_codon	294081	294083	.	-	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_6	AUGUSTUS	CDS	294081	294575	0.6	-	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_6	AUGUSTUS	start_codon	294573	294575	.	-	0	transcript_id "g65.t1"; gene_id "g65";
# protein sequence = [MTSHKRKHMRVQSSSPSPTDTNAESAKDSESDDDNMSDSHSPVGSTLRHAAHVYHSASRGSSTYKANKADTMKAKVMG
# KMRAKSDLFRAAQAESNGGYKKRRIELSPVKASSSKARTSTQRPSYSKSGSASRTLSTSKSKIVSSSTGKVFSSIYLTDIQADNYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g65
###
# start gene g66
Scaffold_6	AUGUSTUS	gene	294754	295326	0.98	-	.	g66
Scaffold_6	AUGUSTUS	transcript	294754	295326	0.98	-	.	g66.t1
Scaffold_6	AUGUSTUS	stop_codon	294754	294756	.	-	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_6	AUGUSTUS	CDS	294754	295326	0.98	-	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_6	AUGUSTUS	start_codon	295324	295326	.	-	0	transcript_id "g66.t1"; gene_id "g66";
# protein sequence = [MRLLGRIEHGEYHDDCEGLDPAIIDKYYGIDNEGSEIEDDLQDSAESDSGSDSGADLEGIVQQWLFPQITLRIYSMST
# TERITEDIRSQFHHAPVRVPKHENPFASEIQLNTFNECLVSCLEENIIPSGFGVLGEEWGDEGYPSFEILKSGRRGTRELRIPLPVDEWLPRAELWVQ
# ALVLMDSLLEIDTD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g66
###
# start gene g67
Scaffold_6	AUGUSTUS	gene	297368	298021	0.31	+	.	g67
Scaffold_6	AUGUSTUS	transcript	297368	298021	0.31	+	.	g67.t1
Scaffold_6	AUGUSTUS	start_codon	297368	297370	.	+	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_6	AUGUSTUS	CDS	297368	298021	0.31	+	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_6	AUGUSTUS	stop_codon	298019	298021	.	+	0	transcript_id "g67.t1"; gene_id "g67";
# protein sequence = [MPSLARWVLRKIEDHDPPMSTVRKLTLSQELPLLKLDWLRPSVGALIMIERETFDGLYAELIGLHSQILLKIHFAREA
# LEHERKVLAYTQLPTDILPATGCSTKHHREVCYPVWNGVWWNQIARKIFHPEQSRRIEEISKIPAILRSIPWEGITGTCAELFICTLEIAGAFTVEAE
# IVTAAASAVREYLITLHPSEAEFCFDDEQAADDAMATVTAT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g67
###
# start gene g68
Scaffold_6	AUGUSTUS	gene	305805	307269	0.23	-	.	g68
Scaffold_6	AUGUSTUS	transcript	305805	307269	0.23	-	.	g68.t1
Scaffold_6	AUGUSTUS	stop_codon	305805	305807	.	-	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_6	AUGUSTUS	CDS	305805	306310	0.89	-	2	transcript_id "g68.t1"; gene_id "g68";
Scaffold_6	AUGUSTUS	CDS	306395	306583	0.36	-	2	transcript_id "g68.t1"; gene_id "g68";
Scaffold_6	AUGUSTUS	CDS	306635	306656	0.5	-	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_6	AUGUSTUS	CDS	307009	307269	0.4	-	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_6	AUGUSTUS	start_codon	307267	307269	.	-	0	transcript_id "g68.t1"; gene_id "g68";
# protein sequence = [MSFILSSGAADMAMAWQTLSASQRSTIKQQYQAAGIKLLVSAFGSTETPTTSGKDPQQLASTMAAWVKQYGVDGIGKF
# EGIFTKGNAYNTQFYNQGASEYTTCDGLLTASSSNNPKSSVFEIEANGFELNKIVIGKPGSTGTGDATNGQMSTGMLAGYAGVMSWEYPDANSQWITT
# VRGSAYPIDGFSDSGSSGSSTSTADAASPTSVGSSGGSSTDAASPTSLGSSGSSTDGASPTSSPSSVANSDSASPTSLGSSSSSTPTPDGASPTSTDT
# DSGSTAASTDAGSIPTTDSSSPTSPATSASTAASTGTFNNGMWTPSASTHI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g68
###
# start gene g69
Scaffold_6	AUGUSTUS	gene	308818	311256	0.85	-	.	g69
Scaffold_6	AUGUSTUS	transcript	308818	311256	0.85	-	.	g69.t1
Scaffold_6	AUGUSTUS	stop_codon	308818	308820	.	-	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_6	AUGUSTUS	CDS	308818	311256	0.85	-	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_6	AUGUSTUS	start_codon	311254	311256	.	-	0	transcript_id "g69.t1"; gene_id "g69";
# protein sequence = [MIINDSAFLSSRFAGKNIVIASKKAGNPCPMFPDIVSPPPPLKSSKSHTRSKSKSSHVDVTMPMKTYDGSDDDTITSH
# TTRTGSVASTSTAKTPKAPRTAKKGAKTPRSRSVSRTRNIPVEVDDEDEVEDLPPPAAKTTRKAPTTTTRSRSISRTRSVASIVDSDGGTGTEDEVFL
# KRSTSTRSKGKAKETGASSRSTDDEGGVSSKKKGNKGRSQSKTRVSVIPEDMSDNGAVEPPPPPPKSTKKSVARKPSTRAGAASKSTSSAKQNHQHEE
# DQDSDVLEPAPSSKGSKPISNSVAAAAALFDDNVEIDTTEQIHDPQPVRPTRTTRKSTKPPVGLGTSTTTKKSTLTRSTSAASVRGAKSRAKEEVDDD
# DDPLDDIHMHVPPISPPSVELGLKAEGESQRESVPQLSAAKPTNSQRKLNTKKKLPPVNLKTDFSDQDAVPPPPPVPPRSPSRPKTKPLPTHTPEIDD
# GGEVVPERHTEEKEPVERSGMSSRSRSGTRESSSTDTYSKEPMSKPTTLLKSATMKKKGSFLNSRSSTQSRTGVSIDQVMNISSDEGDEDEVENVIRM
# VEPVQTKSRILTHVKPPPQGKTKGKDTPALTSTTDPTSDDSLIPAWGSVQAKIAQIEKTVETESGTSGRISPLKPKLANSFIDEPKPDVSTVTTLEVE
# DRDVQMDELPDLAKNEINEEVKEDVREVSPLPRPAVTPPRPQQQQVPTSPFKTPFRFGMGPGNPFNVPPTPGAPMESIPAGIPIPLSREPFVPTQELS
# ETELSMTVEEWVRYHMQIEYDKFKEDGEREIDAFLRTAEQVRKTIEAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g69
###
# start gene g70
Scaffold_6	AUGUSTUS	gene	314056	315039	0.48	+	.	g70
Scaffold_6	AUGUSTUS	transcript	314056	315039	0.48	+	.	g70.t1
Scaffold_6	AUGUSTUS	start_codon	314056	314058	.	+	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_6	AUGUSTUS	CDS	314056	315039	0.48	+	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_6	AUGUSTUS	stop_codon	315037	315039	.	+	0	transcript_id "g70.t1"; gene_id "g70";
# protein sequence = [MFIVRTIVRADDFWGTIMAGARRSSISLLTRRTTINGKHNSKNTEKPTTRTKVEKVEEDGKTTDYDSEDYENGNFDQP
# TTVTERSSPTRALDWLCLSLGLITNLVQVVDEAKLILRETSPYFIWNERLLRAHVSIKFLVLDPDCIQKTIPCIRVCSCRRPTSVLKLLVSTYEHQLP
# FISVHSTRPVVKIPEIPLTLETEQQEQQAEADASFLLGHLSVLFGLLMMDSSENQEIVLDSLPLLHLGHEDIKPNSNSKHKLKQQKLGQLVENASELG
# VFYAVISRRGLSGNGIAADTPDPGQSHEENDAARGADVAKGVISFLRYLLDSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g70
###
# start gene g71
Scaffold_6	AUGUSTUS	gene	317127	318251	0.98	+	.	g71
Scaffold_6	AUGUSTUS	transcript	317127	318251	0.98	+	.	g71.t1
Scaffold_6	AUGUSTUS	start_codon	317127	317129	.	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_6	AUGUSTUS	CDS	317127	318251	0.98	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_6	AUGUSTUS	stop_codon	318249	318251	.	+	0	transcript_id "g71.t1"; gene_id "g71";
# protein sequence = [MQEVADFHSVEILAFDPSASSADLAFIPLITLNTAAKSILFFSGTTVIFRDPNDELKILDIIRPFYEIKLEDRQPFVP
# PNQVFFPVSLRIFYHHIDEYQPDSFEAVLNDEYAIILRPKTLALYSLRAFRRGSHPPSASLSPSQVHEFQWRIDSCVMQRQISPSAPYLSNDSKPSSL
# NILIRYSSLFPWPVNLLHHYILYPMIRTSRQRPNKHSSTTAGFAITSNNLPYKFPPVLSQTIVSPVRLFAITDMALGPYGTAVWFDSHTDYDGEVGQR
# LAGLMLEFSKHRDETGSNNITAADQVSTTPSMVFGAHETDDWNRLAIDEGEGRIAVGSTTGKSSLKTMLKDSDRSFPLAVMIRNGYVSVKGMNFIGRE
# RK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g71
###
# start gene g72
Scaffold_6	AUGUSTUS	gene	335916	336272	0.86	+	.	g72
Scaffold_6	AUGUSTUS	transcript	335916	336272	0.86	+	.	g72.t1
Scaffold_6	AUGUSTUS	start_codon	335916	335918	.	+	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_6	AUGUSTUS	CDS	335916	336272	0.86	+	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_6	AUGUSTUS	stop_codon	336270	336272	.	+	0	transcript_id "g72.t1"; gene_id "g72";
# protein sequence = [MSAQTALLIGASGQTGQHLLKELLNSPKFSQVFEYGRRVTDLETISHGKEKLQQKVIDFEKLNESGLKDGQWDVVFIT
# YVSSLNLNCARSLTSYTILRLGTTRKNAGSAEAFEKIDRE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g72
###
# start gene g73
Scaffold_6	AUGUSTUS	gene	337621	338777	0.41	-	.	g73
Scaffold_6	AUGUSTUS	transcript	337621	338777	0.41	-	.	g73.t1
Scaffold_6	AUGUSTUS	stop_codon	337621	337623	.	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_6	AUGUSTUS	CDS	337621	338442	0.97	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_6	AUGUSTUS	CDS	338565	338777	0.41	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_6	AUGUSTUS	start_codon	338775	338777	.	-	0	transcript_id "g73.t1"; gene_id "g73";
# protein sequence = [MLLQALVSWTNSTEKDGGIDLVSKLATQISDTTAECDKLTQELVSVVDQINQVTKLIENHWASALAIALRKLQAELND
# AWSEAEKLAEEMDGLTRELDDIDDTGVYSDEGEIFIRTAAVVTVPKPASHDAVSASGKLIDLKPSNVASTSSQFLRPPSAVEPKEGEESKSSPEDNDT
# RSLRSRRSARSGKSSSRVGMITAARTRSMRTSLGSLRLPGRSSRSIHSPSGIQSAPVDGPHPPVPSIPKVFTPDTSHPPSSNSLTPTSNAPHSSTPSP
# LDRKQSRNISTESLVDEPAPELPPPLRFLYYLQLLSRGSERRRLKTSGSSPIAVSANLRLNPHFPSWTTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g73
###
# start gene g74
Scaffold_6	AUGUSTUS	gene	347438	347797	0.81	+	.	g74
Scaffold_6	AUGUSTUS	transcript	347438	347797	0.81	+	.	g74.t1
Scaffold_6	AUGUSTUS	start_codon	347438	347440	.	+	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_6	AUGUSTUS	CDS	347438	347797	0.81	+	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_6	AUGUSTUS	stop_codon	347795	347797	.	+	0	transcript_id "g74.t1"; gene_id "g74";
# protein sequence = [MDAAQTPGYGACKFVLVFLGVTASHRAMCVDQENFVTVVRGVEAAVGVKTQGLDSPQTTANASQAILDFASAQSNIRF
# NSDVKTAMGNAASILEQIASDDNTQFNLKGSGHGQTPLVTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g74
###
# start gene g75
Scaffold_6	AUGUSTUS	gene	353018	353381	0.64	+	.	g75
Scaffold_6	AUGUSTUS	transcript	353018	353381	0.64	+	.	g75.t1
Scaffold_6	AUGUSTUS	start_codon	353018	353020	.	+	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_6	AUGUSTUS	CDS	353018	353045	0.64	+	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_6	AUGUSTUS	CDS	353149	353381	0.69	+	2	transcript_id "g75.t1"; gene_id "g75";
Scaffold_6	AUGUSTUS	stop_codon	353379	353381	.	+	0	transcript_id "g75.t1"; gene_id "g75";
# protein sequence = [MSRIFSSCSVTVSLINLYATSGRNASSFHSRTHPSGYDDTVVGGIELRTPLSASAANKWYARVPSRSGEPVREQQHIL
# GEDDDEEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g75
###
# start gene g76
Scaffold_6	AUGUSTUS	gene	353858	354475	0.65	-	.	g76
Scaffold_6	AUGUSTUS	transcript	353858	354475	0.65	-	.	g76.t1
Scaffold_6	AUGUSTUS	stop_codon	353858	353860	.	-	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_6	AUGUSTUS	CDS	353858	354475	0.65	-	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_6	AUGUSTUS	start_codon	354473	354475	.	-	0	transcript_id "g76.t1"; gene_id "g76";
# protein sequence = [MVICVASSSHTGSDRHTPFYTHSIKHSRSHSKSSWSNSRRTSPAAGSPERDPSPEQPRFDEHFPYHGYPQVADPFYPA
# DSSNYWINAMQLAQIHQSHGPTQYIPISQSRLDEVDASYYSYGDYPPTVMSSVRHQRPLRVPMHEPVPPYDAASYTLPNASTNSAHGSQIYAYDHRGC
# REDISGVGIFPTRLEHLLEGDHSVNWGYA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g76
###
# start gene g77
Scaffold_6	AUGUSTUS	gene	359904	360827	0.57	+	.	g77
Scaffold_6	AUGUSTUS	transcript	359904	360827	0.57	+	.	g77.t1
Scaffold_6	AUGUSTUS	start_codon	359904	359906	.	+	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_6	AUGUSTUS	CDS	359904	359924	0.57	+	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_6	AUGUSTUS	CDS	360220	360391	0.57	+	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_6	AUGUSTUS	CDS	360466	360827	0.7	+	2	transcript_id "g77.t1"; gene_id "g77";
Scaffold_6	AUGUSTUS	stop_codon	360825	360827	.	+	0	transcript_id "g77.t1"; gene_id "g77";
# protein sequence = [MSVNVLIPRTLELYKLLGIFPDIIDRSSPPPTNLRSFAMPDDGKPPNLTPIAQSLVNTPDRPLVSQNRQEQLLREHIF
# ADYGIQVELGTELKSFEQQPDHVVVHVVNIVDSKIVEESFTVDWLVGADGARGVVRKQLGLTFLGESPEMDAVTGDIYVLGDPLDHVRMGIFIRLTGV
# TLNMLLNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g77
###
# start gene g78
Scaffold_6	AUGUSTUS	gene	367319	368657	0.32	+	.	g78
Scaffold_6	AUGUSTUS	transcript	367319	368657	0.32	+	.	g78.t1
Scaffold_6	AUGUSTUS	start_codon	367319	367321	.	+	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_6	AUGUSTUS	CDS	367319	367889	0.32	+	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_6	AUGUSTUS	CDS	367942	368657	0.51	+	2	transcript_id "g78.t1"; gene_id "g78";
Scaffold_6	AUGUSTUS	stop_codon	368655	368657	.	+	0	transcript_id "g78.t1"; gene_id "g78";
# protein sequence = [METDPAEFCIVAQDTVIHTGMFSSISYNRQISDSVLSEGDPVKREDEESNLNDVGYDDIGGCRKQMAQIRELVELPLR
# HPQLFKSIGIKPPRGILMFGPPGTGKTLMARAVANETGAFFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDSIAPKREKVSFTVTMN
# VELLVNFFVSDQRRTRSNVVVMAATNRPNSIDPALRRFGRFDREVDIGIPDPTGRLEILRIHTKNMKLADDVDLEQVCRSPSVNQFSLISKTYQIAAD
# THGYVGSDVASLCSEAAMQQIREKMDLIDLDEDTIDAEVLDSLGVTMENFRFALGTSNPSALRETVVEVPTTTWDDIGGLEKVKQELQETVQYPVDHP
# EKFLKYGMSPSKGVLFYGPPGTGKTLLAKAIAHECNANFISIKVTDIYYVLFIDHT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g78
###
# start gene g79
Scaffold_6	AUGUSTUS	gene	368690	369276	0.26	+	.	g79
Scaffold_6	AUGUSTUS	transcript	368690	369276	0.26	+	.	g79.t1
Scaffold_6	AUGUSTUS	start_codon	368690	368692	.	+	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_6	AUGUSTUS	CDS	368690	368953	0.3	+	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_6	AUGUSTUS	CDS	368992	369276	0.46	+	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_6	AUGUSTUS	stop_codon	369274	369276	.	+	0	transcript_id "g79.t1"; gene_id "g79";
# protein sequence = [MWFGESEANVRDVFDKARAAAPCVMFFDELDSIAKARGGSSGDAGGAGDRVLNQILTEMDGMNAKKTSSSSVPQTGQI
# KLILPSSDLVPSRVSILKATLKNSPLAPDVDLNFLAKSTHGFSGADLTEICQRSAKLAIRESIDADIRRTREKQEKEGDDAKMEEDVEDEDDPVPEIT
# RYALSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g79
###
# start gene g80
Scaffold_6	AUGUSTUS	gene	373836	375722	0.85	-	.	g80
Scaffold_6	AUGUSTUS	transcript	373836	375722	0.85	-	.	g80.t1
Scaffold_6	AUGUSTUS	stop_codon	373836	373838	.	-	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_6	AUGUSTUS	CDS	373836	375722	0.85	-	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_6	AUGUSTUS	start_codon	375720	375722	.	-	0	transcript_id "g80.t1"; gene_id "g80";
# protein sequence = [MSDSVPALDRHFEAVVPPPSASLSDPIHCTVVQIDLREINRLLADIKGVKNVAVRSRQDGTPEAFVSVGPQENLDSTV
# IKSSLANFLPGYAIPDIHVLARPLPLIAGDFDFASMEADIIQQNTASMSASAAVVRDIVAELLDIEPGMVSGESDFFLLGGNSLLLGKLSYLIRKRTN
# ASIAVAAIFTNSSINGIASLVEVEQRKLSLESLVDERMQPYPSTRNNSELTLGSNGNRSPNSEGQKERGQNHPLNLIVQAIPMALFYPLKTAVTWSIL
# LFILSYLAPAINQDYFQRMLALICAIVIARLCVRVCAPVAAIVCKWVVIGKYKPGNHRMWSLYYLRWWLVNQSLVSAGRGIFAMHPELNKLYYRLLGA
# HIGKDVSISKHAHLGEFDLLTLEDGCRIDSSLVRGFCVEREGYFRLAPITIGRRAVVNSYTQISPGAIIPEGSVYGPHASSHESPSPPSYAAYNRTLF
# MEPNWPLKFFVAWPIIIAVTFVSYIPWFIILWLMVSKTAIVEPGTNNALVSVVYWFSNPERVLWHAVSRMVRAICTPLLQVVFGIMVKRTLGLNSEHQ
# ASDATQLVLLRRYINSILLSQGKLKEAFSLIGTHYEGVSVSSLFFSSDIQLTLSASSYTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g80
###
# start gene g81
Scaffold_6	AUGUSTUS	gene	375815	376444	0.52	-	.	g81
Scaffold_6	AUGUSTUS	transcript	375815	376444	0.52	-	.	g81.t1
Scaffold_6	AUGUSTUS	stop_codon	375815	375817	.	-	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_6	AUGUSTUS	CDS	375815	376444	0.52	-	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_6	AUGUSTUS	start_codon	376442	376444	.	-	0	transcript_id "g81.t1"; gene_id "g81";
# protein sequence = [MPIASPPTTYQLERPGCSGIACGPYLSIRDPSNIEHELPRGKTGAVSVRGLPTFAGYEVSPDINVPLDTSAFSSEGWF
# DSGDMGYMDEDGYLFITGRSKEIINKGGEVISPFEVEEAIITAARDHVKVTPFAHISTGSILTESAQTTLAFAIDHSVLQEAIGVVIVPVPGRPVIGL
# AQLLDLLKEHLHPSKWPFAIVYMQDLPKNRQVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g81
###
# start gene g82
Scaffold_6	AUGUSTUS	gene	382205	384207	0.75	+	.	g82
Scaffold_6	AUGUSTUS	transcript	382205	384207	0.75	+	.	g82.t1
Scaffold_6	AUGUSTUS	start_codon	382205	382207	.	+	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_6	AUGUSTUS	CDS	382205	382471	0.75	+	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_6	AUGUSTUS	CDS	382537	384207	0.99	+	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_6	AUGUSTUS	stop_codon	384205	384207	.	+	0	transcript_id "g82.t1"; gene_id "g82";
# protein sequence = [MIAFNARFTLLAALLSLIAVSLNPLVEAAAISARRPDTSSSASGTHHKTTREPVLPLPTRSEKALSSKKSEKGEKKKK
# EGSSKGHKHDGRALDEFIQVSPWDHTHNVISVNIEHRDELRVLPGHHDHDDGHRNDLVDIDIKKRGEQAHFHTRRHSEFHDGKVIIGGKNDHVHIHAR
# RHHDHDHDKVVVKGDNDHVHIHGRDHDHDHDHNHDHDHDHNHDHDHDHDHRRARRFRPHPRSLETMQKRACQATPGYIDINVSIIYCVLCFPSLTFRI
# LSLSQSDGKRLASMAYNQTMQEYDVSESEASTFNLMNCGTSEASSLVTLACNDIPQGGCLTYMYNGTSEDMTCQRCVDQSSVPPTACQTFMYNITSGQ
# VNPTNCNMVATQADDADTEPNTGDGPDAGDEIPDGEGEEPNAEQAASINARDASSTNSSSVTPVSLVFRPLAKELEVEDTGSNNTSFNSTNTSGNSTS
# FNATSIDSDPDSTSPNNTSTTSANQTFTTTITVTSTSTSTGSSSSAVQSAAVASPSTTGMKVEVFNDPNETNAPPFSSSTDSPLSSTMTSSSANTTPT
# SSMMDADAVASSIAASSSTDMMAASFTTSSSSTGTSSVSASTSSSSSNSPSATAAAAGLNARSTEPYLWQFKRFDQD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g82
###
# start gene g83
Scaffold_6	AUGUSTUS	gene	385821	386330	0.34	-	.	g83
Scaffold_6	AUGUSTUS	transcript	385821	386330	0.34	-	.	g83.t1
Scaffold_6	AUGUSTUS	stop_codon	385821	385823	.	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_6	AUGUSTUS	CDS	385821	386330	0.34	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_6	AUGUSTUS	start_codon	386328	386330	.	-	0	transcript_id "g83.t1"; gene_id "g83";
# protein sequence = [MVQNRENNYISSVTSTTSPGMAGAGAYRFQQDHQDANQGQGHGASFDTEHEYYRDQAGQQYYDEAPPVPAVPMQRAPL
# QPRQQYTFGQVSVGQPAVAENANPFGVDDYDGEHVAYGSQPAAGYYDNSQAYGNYAAYSPPQTAHTAGAHPSGQQASRASIIDESDAYGGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g83
###
# start gene g84
Scaffold_6	AUGUSTUS	gene	386745	387308	0.4	-	.	g84
Scaffold_6	AUGUSTUS	transcript	386745	387308	0.4	-	.	g84.t1
Scaffold_6	AUGUSTUS	stop_codon	386745	386747	.	-	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_6	AUGUSTUS	CDS	386745	387064	0.43	-	2	transcript_id "g84.t1"; gene_id "g84";
Scaffold_6	AUGUSTUS	CDS	387110	387308	0.78	-	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_6	AUGUSTUS	start_codon	387306	387308	.	-	0	transcript_id "g84.t1"; gene_id "g84";
# protein sequence = [MSLHNAAIDRRTGHFRRAGTAAAANGNGAGDNDDGNGNNTGNGSGNGSGQGSSSAAASSSTAGKFLEPTTAAATSANT
# QPTSQSANASGTSQSNSTSASAAAAQTSSSSSSSSVAPTTTSTSSATSTSTSSSTTSSATLSATSQTSSSTISLSQSSIPASTSTSVSIHISFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g84
###
# start gene g85
Scaffold_6	AUGUSTUS	gene	390761	392149	0.16	+	.	g85
Scaffold_6	AUGUSTUS	transcript	390761	392149	0.16	+	.	g85.t1
Scaffold_6	AUGUSTUS	start_codon	390761	390763	.	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_6	AUGUSTUS	CDS	390761	391096	0.56	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_6	AUGUSTUS	CDS	391149	391280	0.28	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_6	AUGUSTUS	CDS	391376	392149	0.53	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_6	AUGUSTUS	stop_codon	392147	392149	.	+	0	transcript_id "g85.t1"; gene_id "g85";
# protein sequence = [MYIRRILLLQEVLKSYLLATTTSAATTAAAAATTTSQTAATTTSSSHAVTSAANTTSATTSATTSSSSSSSTSATSSP
# TSNTTSSTSSTSKATSTGSSTSAASTPAVATSAETVVVASRTVATYITYTPSSSGTGTAAVASSSTTTTSSGVSAGSIETPFNRCPIQRRIRNRRRDD
# EHFDAAQFRNSAVLLDDEFGTDNFSARPPTMIARHMANAPAAPPVTYGNYPGADPYAGGDPFTTGEQFHTGDPYNHYNAYPTYTQEPVYTLNPGETFA
# RNPIAPNGSAEMDPTSAHNSYLNRQPTLRGPDTQFAGAPQQHYLDMNRVGSPPNMPASAEYNTGMPSPTSATPLYNPHSSAEHSSVLPTPTTATVSQK
# PHAPVEYPSVGTPAPAPPAYYGDAQKRPETVYDPEDAYGGM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g85
###
# start gene g86
Scaffold_6	AUGUSTUS	gene	393163	394392	0.98	-	.	g86
Scaffold_6	AUGUSTUS	transcript	393163	394392	0.98	-	.	g86.t1
Scaffold_6	AUGUSTUS	stop_codon	393163	393165	.	-	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_6	AUGUSTUS	CDS	393163	394392	0.98	-	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_6	AUGUSTUS	start_codon	394390	394392	.	-	0	transcript_id "g86.t1"; gene_id "g86";
# protein sequence = [MVGSSMFVFDANPHAVHKITSGEEALVCMLFANFDTTWGHPALQDRLRRAGQQPSSQLILNGMTLFGAIWTASRLPEY
# QSYKVVWHAMRAHLENEGVLAAVVSRFNAYVVRKGDSAHLDRVSKSKPQRNTYPKIPPRMESTMLTDLEDVGCQTSGDRPSNLSPENPRSFNRVLSTF
# SIHDFPPSPVHTSSSPKPLFSHLPIPQMGPSEWAACYEDKEIYNPTTHSFSDLQPHPFPSLCSSPALAQSQTHICQESGHGIATVPNATSSLYRTHGI
# EYQQDHLQQPEQHLHLYPPSLASPSFFPETYPETQQPLPEFGASMPSILTSHYPHKHEAQVNSNLTTGRTYWQMTNVPPPYLPYQHNQSPTTFSSNST
# VSQDTAFVTLQNNHWRGYADGKFADEYASDAYKLQHE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g86
###
# start gene g87
Scaffold_6	AUGUSTUS	gene	397530	398627	0.75	+	.	g87
Scaffold_6	AUGUSTUS	transcript	397530	398627	0.75	+	.	g87.t1
Scaffold_6	AUGUSTUS	start_codon	397530	397532	.	+	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_6	AUGUSTUS	CDS	397530	398627	0.75	+	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_6	AUGUSTUS	stop_codon	398625	398627	.	+	0	transcript_id "g87.t1"; gene_id "g87";
# protein sequence = [MAPFPSQLVNTANISSYFSSFPVRSCELDALPTIQQALNDTIYGCTAPGSKERKKAEYRHTNPAGNLFGLSFALCEAD
# RLGYVGKLIEFLCIVDGEYLGMTRVCKEVFSPALVIDVMEDLPFGEACIEHAILRQALYESYDDDQYGGRAVGKMKSYLRELRMELASLNDPCTPLLL
# KTLDTSLRDRDSDDAEFQTLAEYIPYRKTNFDYEYVPFLQFTMITGLSWKSCSFVCQLVRWAMNISPKVQENLIVRSYEHTVGVIVGLTNDYFSWEME
# RQQPTDRIRNAVPVLMKEHSISEVQAKSMLKEIIIGEESRARELKSEVMNQTEESEQMKRYVTEMELFAAGYSFWCATCPRYHRLQEEYLI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g87
###
# start gene g88
Scaffold_6	AUGUSTUS	gene	404789	405559	0.98	-	.	g88
Scaffold_6	AUGUSTUS	transcript	404789	405559	0.98	-	.	g88.t1
Scaffold_6	AUGUSTUS	stop_codon	404789	404791	.	-	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_6	AUGUSTUS	CDS	404789	405559	0.98	-	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_6	AUGUSTUS	start_codon	405557	405559	.	-	0	transcript_id "g88.t1"; gene_id "g88";
# protein sequence = [MNPPGRPPPLDGPIQYRNSLANFHQRQLGGGGAGSPSDPGSTFGGGPVPGGPGPNNRISKHGPGLPMPPPSPGMNKDG
# SAKDMNMKIEGSPRGGLPPSSAGMTPTASGPANGPSSTPVPPGRPPSSQNPTPNSGPHPGMPSLPPPNMDPSPGSMLGNTPMSGMSGPMSGMPNGIGP
# GGMGSGMVGINSSINAMNGAGSDIPFFGSDFMNDIEVGGLDTFDPNLFRDPGGDLNFERDFGQWFNPNDQGLDDSLDPMK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g88
###
# start gene g89
Scaffold_6	AUGUSTUS	gene	408508	410419	0.19	-	.	g89
Scaffold_6	AUGUSTUS	transcript	408508	410419	0.19	-	.	g89.t1
Scaffold_6	AUGUSTUS	stop_codon	408508	408510	.	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_6	AUGUSTUS	CDS	408508	408757	0.34	-	1	transcript_id "g89.t1"; gene_id "g89";
Scaffold_6	AUGUSTUS	CDS	408891	410419	0.52	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_6	AUGUSTUS	start_codon	410417	410419	.	-	0	transcript_id "g89.t1"; gene_id "g89";
# protein sequence = [MPITRLPAAGFILADRKDDDVEAETYAKFGWKLRKRDEYKTLLRTNYDSSSRVYTSSIFVDYPGGAKSENLSAGGKAS
# RSNVSLSPTRQFPLEKQVTPRASRVELNTLPESSSSDSSLHTIQGVISTSASSPLSAPITPTKFLPSSTPPSFSNIASLSSLSSMTHLSTNGTFNSLN
# NINNVNLTQAMPGQRERTASVSNSGFRGRSSSAFTLKGEVRHTTDLLVGEVVIDSKLYPEGYIITLKSKTLKITGKEGKGVKEGERRDESKSPPRAND
# SSITKSSANLNATPINLDSLFSSSTSYSTGVATKASISSPSSPSIPPASNSNLNSDSELLEHQLPLSYTLHTIPLSPLHSSGSGMGTGTSSDSHYTYD
# YESESPTRHLLKLMLPTAQYCVSTIQDPLTGETQVAPPKPSWLLEMEEGGAVVYVEVKPVQKDADGVGMVKGKVWVVDGRNGVNDSKVGHDTKNKVWN
# AKRNIWEVAVVGEKESLTTLGREELLDDRVSKMSILLRSVATNESEALPDDLKTPVGIADSLLDAKTADVYGQMIVADGMDRQSLGDSTEVSSSRTES
# GTSDGVVPGHGKLTTFLATCCGLY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g89
###
# start gene g90
Scaffold_6	AUGUSTUS	gene	410530	411405	0.51	-	.	g90
Scaffold_6	AUGUSTUS	transcript	410530	411405	0.51	-	.	g90.t1
Scaffold_6	AUGUSTUS	stop_codon	410530	410532	.	-	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_6	AUGUSTUS	CDS	410530	411405	0.51	-	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_6	AUGUSTUS	start_codon	411403	411405	.	-	0	transcript_id "g90.t1"; gene_id "g90";
# protein sequence = [MGVIRRRRAEWDADVLDSPTSENVLNTDGASSTLPKVSSPLARFFTYAVDQATATTQQTIAAISPMAAGANDALLSSS
# KLPMQYVLDALSWTQNYHCSTTPQAGWAPVNDKGLSVRRKLVSDISPVIPIHKGEKVIEGISAEELVAVITEPDCRKKWDDRFDSESVFESYGSGCKT
# SFMVSKGGFPFRDRGFYIAFVVARAQGSPLGSMRNTDTGTPGSGSGDASGRTGCRNAIYCVSTSFSPDSVSQFSAAMYNQYGLPIGRVYIDAWILETL
# DLIRKRITLSRRRSVHD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g90
###
# start gene g91
Scaffold_6	AUGUSTUS	gene	411440	413360	0.6	-	.	g91
Scaffold_6	AUGUSTUS	transcript	411440	413360	0.6	-	.	g91.t1
Scaffold_6	AUGUSTUS	stop_codon	411440	411442	.	-	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_6	AUGUSTUS	CDS	411440	412238	1	-	1	transcript_id "g91.t1"; gene_id "g91";
Scaffold_6	AUGUSTUS	CDS	412292	412529	0.94	-	2	transcript_id "g91.t1"; gene_id "g91";
Scaffold_6	AUGUSTUS	CDS	412685	413360	0.61	-	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_6	AUGUSTUS	start_codon	413358	413360	.	-	0	transcript_id "g91.t1"; gene_id "g91";
# protein sequence = [MIIGLLKTVTKRATRIPKLVGYGNGITIEKIRFQIDREALTIEYSVIPEDDSHTDQSRGFEDLLVLRDQRRLTRAIEC
# VLPSVEGWDVQLTTKASSEEVEKLPWAAHATRSTSYNSSSDSPLDLVVLRLTHAPLIDDHSVLKVKVVIEISGPSSGLRLNGVPQSIKEPEEQRDPSS
# YAAAQSIMLDVGSAADVSLPSSSSVHGSSATSFASSSSAPPLIRVATERTTEARGVTITQLDSIDPTLVVYRAEAAFVGVGLWDLYSAVVSPGARNFW
# DKQHEDATLLEDVNDLTELWHIKTKPAWPVNGRDSVVLKTVYKSPTAIHVFSFSADDSHLFPNIPSVDPNVIRTQVDLQGWAIEALSPNTTLLTLLEQ
# SDPKGWTNKTSIPIQMINALAGIGEFAIKFGGPPIVTRLAGAKANDLRYDHERFNFRLEYEPHASRRMVGGSPTDNSAATSTSTTSDENSSTPTSPVI
# ECEIRCDMDTWGHSLDIVVDPPPQSISCLRRHKLSDEGGGLWLTITHDAVFVDDERLQVIVRRGPGKEKGLVMVNGAKTSVDIEELPEHEIKNFGTEE
# TH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g91
###
# start gene g92
Scaffold_6	AUGUSTUS	gene	419280	419486	0.28	+	.	g92
Scaffold_6	AUGUSTUS	transcript	419280	419486	0.28	+	.	g92.t1
Scaffold_6	AUGUSTUS	start_codon	419280	419282	.	+	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_6	AUGUSTUS	CDS	419280	419486	0.28	+	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_6	AUGUSTUS	stop_codon	419484	419486	.	+	0	transcript_id "g92.t1"; gene_id "g92";
# protein sequence = [MAATPMLEFADTETDVFPAETAISNDAFEDGEVERNSADARSGMEVNQLIDQGKSNHPHREIAKTFGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g92
###
# start gene g93
Scaffold_6	AUGUSTUS	gene	420936	422087	0.16	-	.	g93
Scaffold_6	AUGUSTUS	transcript	420936	422087	0.16	-	.	g93.t1
Scaffold_6	AUGUSTUS	stop_codon	420936	420938	.	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_6	AUGUSTUS	CDS	420936	421160	0.87	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_6	AUGUSTUS	CDS	421292	421426	0.97	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_6	AUGUSTUS	CDS	421521	421695	0.2	-	1	transcript_id "g93.t1"; gene_id "g93";
Scaffold_6	AUGUSTUS	CDS	421824	421980	0.84	-	2	transcript_id "g93.t1"; gene_id "g93";
Scaffold_6	AUGUSTUS	CDS	422081	422087	0.92	-	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_6	AUGUSTUS	start_codon	422085	422087	.	-	0	transcript_id "g93.t1"; gene_id "g93";
# protein sequence = [MKYKSVAFRKRLNRRLRAISDAKVPTTSIYALSETMASRLAVGNLRAAGGTRNVLRSMSSSNPPPPSERASEIINKLP
# SSPNLITKTGTALLGTGLAAAAISQELYVVNEETIALREPYANWAESQVQKIKGVLDTARAEHTQAVKDRIDSVGQMKDVKVVMASELKSVLDSWVRY
# EQQQKESEQADLTKSVIDKVLANLKDEKTQRDLLLSAVAEVERKSDLHSVSYVLVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g93
###
# start gene g94
Scaffold_6	AUGUSTUS	gene	430940	431512	0.35	+	.	g94
Scaffold_6	AUGUSTUS	transcript	430940	431512	0.35	+	.	g94.t1
Scaffold_6	AUGUSTUS	start_codon	430940	430942	.	+	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_6	AUGUSTUS	CDS	430940	431512	0.35	+	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_6	AUGUSTUS	stop_codon	431510	431512	.	+	0	transcript_id "g94.t1"; gene_id "g94";
# protein sequence = [MNVLDTVSSSTHSHEQEMLMNGVFGGMNTNIGSVPSMLGGMNNSQMINVGGMNGSSASSDSLLSMESGMANMNGHPLN
# MSLSNASLSPPDNPKRFSTRARSDSAPLYHQQHLSASPSSSSVSPQGWGGVGRPRSGSGLGVLGNPPHGQYGGSHLQRGLTIPSISMPRTGLNGVGGM
# GVQTVPSNVQGQSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g94
###
# start gene g95
Scaffold_6	AUGUSTUS	gene	439664	440554	0.68	+	.	g95
Scaffold_6	AUGUSTUS	transcript	439664	440554	0.68	+	.	g95.t1
Scaffold_6	AUGUSTUS	start_codon	439664	439666	.	+	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_6	AUGUSTUS	CDS	439664	439877	0.68	+	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_6	AUGUSTUS	CDS	439935	440554	1	+	2	transcript_id "g95.t1"; gene_id "g95";
Scaffold_6	AUGUSTUS	stop_codon	440552	440554	.	+	0	transcript_id "g95.t1"; gene_id "g95";
# protein sequence = [MVSSFSLALLLVSAASTLLVRADVVPDTPATGTAGSTCSITWTGDSSSSSNWSDMAIEFMTGDNFNMVFLTTVATGLD
# GTKSGSYSWTCPEVNPYSAIYFYQFISPVESGNPVWTTRFAIASSSGETTTPPNSTQPDGEAIPWGTGALVDASSVSAVPSFASGVTSGSVPATSATA
# SASVSSSSSIAAASSVSTSATSAASASKSASKSAGVVTVSGNTSGAAGAKTTATSVSTTGADEAASTPSSANAGLVLAVDARVWTATFGVISSAVAVA
# LFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g95
###
# start gene g96
Scaffold_6	AUGUSTUS	gene	441035	442617	0.22	-	.	g96
Scaffold_6	AUGUSTUS	transcript	441035	442617	0.22	-	.	g96.t1
Scaffold_6	AUGUSTUS	stop_codon	441035	441037	.	-	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_6	AUGUSTUS	CDS	441035	441526	0.97	-	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_6	AUGUSTUS	CDS	442380	442486	0.25	-	2	transcript_id "g96.t1"; gene_id "g96";
Scaffold_6	AUGUSTUS	CDS	442590	442617	0.25	-	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_6	AUGUSTUS	start_codon	442615	442617	.	-	0	transcript_id "g96.t1"; gene_id "g96";
# protein sequence = [MISEFPITGLVALSLALSASAAIFPKDTVVKMLDPKGFRKAMKANSSELILGINKLDSLSKFFESVIDGTADLKIVNE
# EAASEEFVPDEAELEIERKQEAQRIALAHGGFANFIDFEDALKKGHNPHGSQGYPGMLGDLPQKKKKPTGSESIAAEPAVETGDAKEQAAFAASEPAP
# AATPEPLEVPVEEQASEQASEPEPAPAPKDEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g96
###
# start gene g97
Scaffold_6	AUGUSTUS	gene	445933	446343	0.75	+	.	g97
Scaffold_6	AUGUSTUS	transcript	445933	446343	0.75	+	.	g97.t1
Scaffold_6	AUGUSTUS	start_codon	445933	445935	.	+	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_6	AUGUSTUS	CDS	445933	446343	0.75	+	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_6	AUGUSTUS	stop_codon	446341	446343	.	+	0	transcript_id "g97.t1"; gene_id "g97";
# protein sequence = [MSALTDILPVETLHEVVSSLDSPSDILSFGISSKALADIAIPHHLKFRVFRVRISRSAAIWRFFAQADLTAGEVRELD
# ILPENISDVCHGDYGPDRWMAEPLVPPKELFEGGQAQHFKGRPSFEQTRREKCSLLML]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g97
###
# start gene g98
Scaffold_6	AUGUSTUS	gene	448104	448469	0.83	+	.	g98
Scaffold_6	AUGUSTUS	transcript	448104	448469	0.83	+	.	g98.t1
Scaffold_6	AUGUSTUS	start_codon	448104	448106	.	+	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_6	AUGUSTUS	CDS	448104	448469	0.83	+	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_6	AUGUSTUS	stop_codon	448467	448469	.	+	0	transcript_id "g98.t1"; gene_id "g98";
# protein sequence = [MPATLIQPSTVPGKLLYFTPPKDGSRPITRINEDANYDSRFNWVQAEHTVPIENIRGKEDSYTLNSAGFQYYQHKSKH
# TAFSNDEDIEREYYPESVELIKQLTGASKVVLFDHSALTLLLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g98
###
# start gene g99
Scaffold_6	AUGUSTUS	gene	449271	450999	0.18	+	.	g99
Scaffold_6	AUGUSTUS	transcript	449271	450999	0.18	+	.	g99.t1
Scaffold_6	AUGUSTUS	start_codon	449271	449273	.	+	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_6	AUGUSTUS	CDS	449271	449505	0.34	+	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_6	AUGUSTUS	CDS	449829	449976	0.37	+	2	transcript_id "g99.t1"; gene_id "g99";
Scaffold_6	AUGUSTUS	CDS	450054	450260	0.4	+	1	transcript_id "g99.t1"; gene_id "g99";
Scaffold_6	AUGUSTUS	CDS	450357	450999	0.49	+	1	transcript_id "g99.t1"; gene_id "g99";
Scaffold_6	AUGUSTUS	stop_codon	450997	450999	.	+	0	transcript_id "g99.t1"; gene_id "g99";
# protein sequence = [MRIPSYERLETDDPSETSTIVSSVHSNHSVAKPATYYGQGPFEAPSSDSEEEDELLERKGPSTPGIAEAGNFNAPYTP
# TGDGVFSESTQDGFIKLVDLKTNTTSKLVKKDDIKDVSLNLIALAVLSPIQRGSPEGAHEFPMPPPAIKEVMSQQWRWSSFGNYYIHDIEAKVTRPMI
# PPANPPTTAYATWSPTGNSLAPSTAPIRVTTSGNASLFHGVPDWVYEEEIFSSDHALWWSPDAQKVAFLRFDETAVDEFSFPIYNPTENNSAVIPYTS
# EVTMKYPKPGYNNPLVSVHVFDLGRYLDSDSVVVNGFPAANATLELDWPGRHPISNSIIMEVAWVDDTQLLLKEVNRNADSGSVVFFDLSSSDDKARS
# RGTVVRKLGKEGEEGDDGWIDNVGIIQACSRTVQSLER]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g99
###
# start gene g100
Scaffold_6	AUGUSTUS	gene	453210	453752	0.59	+	.	g100
Scaffold_6	AUGUSTUS	transcript	453210	453752	0.59	+	.	g100.t1
Scaffold_6	AUGUSTUS	start_codon	453210	453212	.	+	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_6	AUGUSTUS	CDS	453210	453752	0.59	+	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_6	AUGUSTUS	stop_codon	453750	453752	.	+	0	transcript_id "g100.t1"; gene_id "g100";
# protein sequence = [MPSPFLVQRPTTSSLSKTASKNKNLRPKGLWKARVTDSAPRLLHGTANSEATHDSDSDNELEDLDELEIRSSTSSTKR
# RRLSSSESSGSDSAAELYYWDYSRQCTPPPKRESSWTRRTRIMDTSSLALKGTQTTSKSTCDYEDWEDLKDLFSKAVEQYEGLLIIRCEVLVFINSDL
# PYRQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g100
###
# start gene g101
Scaffold_6	AUGUSTUS	gene	454488	455099	0.67	+	.	g101
Scaffold_6	AUGUSTUS	transcript	454488	455099	0.67	+	.	g101.t1
Scaffold_6	AUGUSTUS	start_codon	454488	454490	.	+	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_6	AUGUSTUS	CDS	454488	455099	0.67	+	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_6	AUGUSTUS	stop_codon	455097	455099	.	+	0	transcript_id "g101.t1"; gene_id "g101";
# protein sequence = [MDQFSRGIFHMPHPSHAVPPSGKPLSSGAAPALDSFSRAKELFTIGSEALLVAEKLENPSERKYWASWSDSVFNQMKM
# EADVDAWRGPINRARGQCCLIVGTAQAEEFEEALENGDESVLRSEDADEAREALMDAISFLEKAKSAATSTDMDQDDDELQHFLEEALLTLANLTLDE
# KKREDLYLRAQKESGGAIDLSDEMDES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g101
###
# start gene g102
Scaffold_6	AUGUSTUS	gene	460087	462576	0.69	+	.	g102
Scaffold_6	AUGUSTUS	transcript	460087	462576	0.69	+	.	g102.t1
Scaffold_6	AUGUSTUS	start_codon	460087	460089	.	+	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_6	AUGUSTUS	CDS	460087	462576	0.69	+	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_6	AUGUSTUS	stop_codon	462574	462576	.	+	0	transcript_id "g102.t1"; gene_id "g102";
# protein sequence = [MYSHHRYPSQPHHLPSNHTSRRGSPIPAHNTGVSAPDRERDRERQRYVPPPPPPSAPMASSSRRYNTSSVPPPSASMG
# NFSSREKELRDFDRERETRERERERDFREREREQQQQRNRERDGGYRIIGSGMSLGPGPASGPEPPPPSQPHSRGDPREREMFHYRERERVERERERD
# RMDRIDRERDRELYNRDRERDRDRERDRERDRERERERMNMSLAMNERERERDLLRERERERTRLAVIGDMASSSSTSAPPPPGLPILMDVDGQMYGN
# DPFMPVRMADHHGHGYPSFPNHDPRAMGQMGPVGQLGPMAPNGPMGMPPNMNMSMAAGGSVTMGMGMEPVVGLGPTSNTAMVPIPDGLEEPPEREVKS
# RVKIDLGTYVWPKTPPFPFSFAESKWQAFPDRSNKENEVDQKGETKGSGGGVYKMVVDGEVISKRDEDKREPTIVTNGGNSAANTSSTTALNVTDLPN
# ADKHILDSETLVTIVIPNAFIPLEKPKPGSRNKYRVWGGGLPPRNGSNELFGGTRHGRERESNPEYEQMRAGYQEKVAANPSHTSNSIPSSHKKRPPR
# RRRIYTDDSDIFVCALHAGWISWSSAKKAREEGKDLKVRLRIIRCLGVREDVGASVRNEAPFQVTGNAFPGPGRNANDPNGPWVQGQRSAPPTMNGFS
# ASSSSGTGTDSSLSAAAGFIGGRRGREEVVVRFIGGMGEKYFGGDIKRTKAKSEPAQAQVKTMEKELEKLKEKEKQVEEEKEEGELKEEGELDQDPLP
# EPDVANSVPLIVEEEEEEEEVPDGGPEDDGRSLLSASWGIGHDGSGIEVIDVEFVPVSSFTFGFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g102
###
# start gene g103
Scaffold_6	AUGUSTUS	gene	462680	463582	1	+	.	g103
Scaffold_6	AUGUSTUS	transcript	462680	463582	1	+	.	g103.t1
Scaffold_6	AUGUSTUS	start_codon	462680	462682	.	+	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_6	AUGUSTUS	CDS	462680	463582	1	+	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_6	AUGUSTUS	stop_codon	463580	463582	.	+	0	transcript_id "g103.t1"; gene_id "g103";
# protein sequence = [MFARDDAKTKKKVPYITTSLAGRKRPRGAFESSHPIHMPRWGFGSASRPHPNAVALDTILEEDSAAFAGRTMSFEESS
# KERKISEQRTLVFGKGAEIWYVDSVNTSHFNTHRDPFSYRFKYSPDSLRAVFTPNDDDLVERPMKRKRLDTNEPPSSKPHPPLLIKWDDSDRCCILRP
# EPADVTSLYALFVTQQSVANDYLHYHLPDSIPSIPPSSSSDVLMKDIHTKPESSQLTAISASSVSPVRELIADDWMVEPYCVHTKEEHVWLLQSEVLE
# FIASGIMINKTRTLPVTKWKFILESD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g103
###
# start gene g104
Scaffold_6	AUGUSTUS	gene	464599	465129	0.99	+	.	g104
Scaffold_6	AUGUSTUS	transcript	464599	465129	0.99	+	.	g104.t1
Scaffold_6	AUGUSTUS	start_codon	464599	464601	.	+	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_6	AUGUSTUS	CDS	464599	465129	0.99	+	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_6	AUGUSTUS	stop_codon	465127	465129	.	+	0	transcript_id "g104.t1"; gene_id "g104";
# protein sequence = [MATQQPLARFSGDPDDSVQPATFLQDFEVRMTELMTLRVDLAGRIKPYLEHDSRVWEWYMEDLTATDRTGAWEAFKAK
# FHARFPSQKKEKKSAKSYLTSLEGEHITHEMIMKTSEDTNQPYHQWWADQLLRLAKGAEVEKTKQSIGTVWKHLPYALKKVIDEEHDNWGSLPLPSKQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g104
###
# start gene g105
Scaffold_6	AUGUSTUS	gene	466293	467138	0.45	-	.	g105
Scaffold_6	AUGUSTUS	transcript	466293	467138	0.45	-	.	g105.t1
Scaffold_6	AUGUSTUS	stop_codon	466293	466295	.	-	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_6	AUGUSTUS	CDS	466293	467138	0.45	-	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_6	AUGUSTUS	start_codon	467136	467138	.	-	0	transcript_id "g105.t1"; gene_id "g105";
# protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY
# LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR
# LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK
# HPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g105
###
# start gene g106
Scaffold_6	AUGUSTUS	gene	467903	469999	0.98	-	.	g106
Scaffold_6	AUGUSTUS	transcript	467903	469999	0.98	-	.	g106.t1
Scaffold_6	AUGUSTUS	stop_codon	467903	467905	.	-	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_6	AUGUSTUS	CDS	467903	469999	0.98	-	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_6	AUGUSTUS	start_codon	469997	469999	.	-	0	transcript_id "g106.t1"; gene_id "g106";
# protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN
# EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA
# SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD
# IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE
# VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ
# QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII
# TDTPTSNSGAQHKTLPVDKPDGPSIYHGLIFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g106
###
# start gene g107
Scaffold_6	AUGUSTUS	gene	470050	471678	0.96	-	.	g107
Scaffold_6	AUGUSTUS	transcript	470050	471678	0.96	-	.	g107.t1
Scaffold_6	AUGUSTUS	stop_codon	470050	470052	.	-	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_6	AUGUSTUS	CDS	470050	471678	0.96	-	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_6	AUGUSTUS	start_codon	471676	471678	.	-	0	transcript_id "g107.t1"; gene_id "g107";
# protein sequence = [MCLLIITYDYDTQYISVIIWDQFASAPLSRSASLPGLVTPLPAPLVTPPLPLRDIRSRSITALTQPTDKVVLAGSVDT
# TSSPVPPDSETPAASIDCSTLPHALDPRDQAHAHNNNDTWRDCQSQPCPNALSNSIREPLTVSNITFLPIPQPRLPTPIMSTPVPPAPNTSAEDLMAQ
# LIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFL
# KEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDP
# TMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQ
# PRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g107
###
# start gene g108
Scaffold_6	AUGUSTUS	gene	472232	472789	0.56	+	.	g108
Scaffold_6	AUGUSTUS	transcript	472232	472789	0.56	+	.	g108.t1
Scaffold_6	AUGUSTUS	start_codon	472232	472234	.	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_6	AUGUSTUS	CDS	472232	472789	0.56	+	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_6	AUGUSTUS	stop_codon	472787	472789	.	+	0	transcript_id "g108.t1"; gene_id "g108";
# protein sequence = [MLEGSRQCGGGGGRWDFEVFDSRGSWKFLFGKPLLEQFLAVHDYGKDAIRLQGKRGKWREVFNKGLGVALPAGPADRL
# EESSQQEILSSSTDEYAVLEESEGPLSGVTVKALTPLSRKVEDLNHVQQEQVTNSPPQPVPQSEPKRQHQKPQVEDIPDGDTKQPRVPSAEQSSTLDS
# VFPIASEEW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g108
###
# start gene g109
Scaffold_6	AUGUSTUS	gene	476238	477176	0.17	+	.	g109
Scaffold_6	AUGUSTUS	transcript	476238	477176	0.17	+	.	g109.t1
Scaffold_6	AUGUSTUS	start_codon	476238	476240	.	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_6	AUGUSTUS	CDS	476238	476706	0.35	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_6	AUGUSTUS	CDS	476857	477176	0.26	+	2	transcript_id "g109.t1"; gene_id "g109";
Scaffold_6	AUGUSTUS	stop_codon	477174	477176	.	+	0	transcript_id "g109.t1"; gene_id "g109";
# protein sequence = [MSKGKGGYKTIGLYLDTYLQRVWAFKFKVAGSGATTSASLHSLFNGYLLLETFMTDNGTHFANKEVEALCAKWGTKQH
# FTPAYSPWVNGLVEVLTNSAPCSEASVCTKLGEDSEEFTAMTWDILPDKWPEFLEEAVRIINNRILPSVKFSPNELLLVFDRQVLKKEGKEVVYRKGD
# LVQVYWSDHDYTFKTIKKIIPKWSRPYRVVEQSINSYTLETVDGQLIEGKQFNAQRLREFKPRLGTKLAIAQQEVIHRREEAGEDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g109
###
# start gene g110
Scaffold_6	AUGUSTUS	gene	489909	490559	0.96	-	.	g110
Scaffold_6	AUGUSTUS	transcript	489909	490559	0.96	-	.	g110.t1
Scaffold_6	AUGUSTUS	stop_codon	489909	489911	.	-	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_6	AUGUSTUS	CDS	489909	490559	0.96	-	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_6	AUGUSTUS	start_codon	490557	490559	.	-	0	transcript_id "g110.t1"; gene_id "g110";
# protein sequence = [MLLDPFSVKCTKEVFEALHSHQKLLGELAIAPEDFSAETVPCLSWKPDPKIQINPTVYNGGLLDTDLAAIHNWIFVKL
# PQPAEMEHLDMLHYTTAHARTLLLAYQHREEFLNNAPDNLADVDQYIVHQAWNRLVAWTGLSVDGKSKRSKGADVNYEAVSLLDKIMFDESSRAGVAG
# NHQWGLDVGPHEMGWNPQFTGPNVTVGKRREGNDDEEVLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g110
###
# start gene g111
Scaffold_6	AUGUSTUS	gene	490928	492166	0.68	-	.	g111
Scaffold_6	AUGUSTUS	transcript	490928	492166	0.68	-	.	g111.t1
Scaffold_6	AUGUSTUS	stop_codon	490928	490930	.	-	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_6	AUGUSTUS	CDS	490928	492166	0.68	-	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_6	AUGUSTUS	start_codon	492164	492166	.	-	0	transcript_id "g111.t1"; gene_id "g111";
# protein sequence = [MEHCRVQMQRKGLGWSPLASQWDQHQGSIQKWFSSLTQVQPLSDVYSTSGCWRRVYEDGALVKVCSGQSQQSQYIIDI
# PVILIIQPDVSAGKHWDYPLRLLPGSLAEARKGIVYDLVGRIFQSHNHFMAHTSVPTTSRGMSVFAYDSLKHQGYSQRLHGKASNLIAGISPPCPLGF
# QTHAAVYKLKGGLAGQNIFRTRQKSAIRNILNISLDSDPPTLHSPNWIECSVDDRSHWKTREYQLSQPNLPNSIMENASLPPPEDILPEGADFQYGDP
# TELPFIPSPTSTSMVLDPTVNPCTPEPQAPALFIPDSPISSIASSSPLPSSPHYIHCRCGVEANGYRESIQQDSIQCSICSKYTYTACLTMRFYDKSA
# EEFLCHECDVQQEYDNFSQFRHTLPYLRKQKLNTVKNRLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g111
###
# start gene g112
Scaffold_6	AUGUSTUS	gene	492541	493314	0.56	-	.	g112
Scaffold_6	AUGUSTUS	transcript	492541	493314	0.56	-	.	g112.t1
Scaffold_6	AUGUSTUS	stop_codon	492541	492543	.	-	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_6	AUGUSTUS	CDS	492541	492842	0.91	-	2	transcript_id "g112.t1"; gene_id "g112";
Scaffold_6	AUGUSTUS	CDS	492966	493094	0.94	-	2	transcript_id "g112.t1"; gene_id "g112";
Scaffold_6	AUGUSTUS	CDS	493149	493314	0.58	-	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_6	AUGUSTUS	start_codon	493312	493314	.	-	0	transcript_id "g112.t1"; gene_id "g112";
# protein sequence = [MAADLAAKLPATTNAEEAMHATIYSAVGINHPLLKGLDGLLAVEKLFCIESQNALLHVKSHYGKSGCELRKELYQQHG
# TTHPSRKHPWGAAKERRRGRPSSTISPPSHVIPSSDDSDNEPAKTANELHKAQQKIQLMSPTKLNARPSQPDFGPIKSTTTSELPSAKWDRNSCWLDS
# SMEVLFVLWHFTILLKSLKIWF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g112
###
# start gene g113
Scaffold_6	AUGUSTUS	gene	508359	509525	0.9	+	.	g113
Scaffold_6	AUGUSTUS	transcript	508359	509525	0.9	+	.	g113.t1
Scaffold_6	AUGUSTUS	start_codon	508359	508361	.	+	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_6	AUGUSTUS	CDS	508359	509525	0.9	+	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_6	AUGUSTUS	stop_codon	509523	509525	.	+	0	transcript_id "g113.t1"; gene_id "g113";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g113
###
# start gene g114
Scaffold_6	AUGUSTUS	gene	509576	513291	0.43	+	.	g114
Scaffold_6	AUGUSTUS	transcript	509576	513291	0.43	+	.	g114.t1
Scaffold_6	AUGUSTUS	start_codon	509576	509578	.	+	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_6	AUGUSTUS	CDS	509576	510928	0.44	+	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_6	AUGUSTUS	CDS	511015	513291	0.59	+	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_6	AUGUSTUS	stop_codon	513289	513291	.	+	0	transcript_id "g114.t1"; gene_id "g114";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAHDLYLRPEKCEFEQQQIEY
# LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPT
# RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYL
# SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDN
# GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLIT
# QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQE
# VEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRK
# AHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEE
# ILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g114
###
# start gene g115
Scaffold_6	AUGUSTUS	gene	516126	517088	0.94	+	.	g115
Scaffold_6	AUGUSTUS	transcript	516126	517088	0.94	+	.	g115.t1
Scaffold_6	AUGUSTUS	start_codon	516126	516128	.	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_6	AUGUSTUS	CDS	516126	517088	0.94	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_6	AUGUSTUS	stop_codon	517086	517088	.	+	0	transcript_id "g115.t1"; gene_id "g115";
# protein sequence = [MVKEYPDEGYYEVVLPPLSQLEGDLNKAREDLRRVATLAHRLHCSDPATVLHHHHRYIGAIIEAVVAFLRRGLESEDP
# DIATHNLHLALDYMQAARGVHGDLYIRSISSIQWFFNNAVDEDEGLYRLVLEHSRFDNDSPFLTAAQHAGFAPPPDNSLEPPLHRRMLALSTALPHSD
# GVGRWDDLVPALPSVDQLTVDWEQLMLRYIHHITDVPLSGTDTQVPMSSVEPGTESLAEVTVEQLPEAPPLFLPEQESPTSPSPPPTSPTLPPPFASL
# ANLTIDLTGDDDDLYETEESRMARVSMSREVVDSVAVQSVVKEEPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g115
###
# start gene g116
Scaffold_6	AUGUSTUS	gene	517363	519261	0.43	-	.	g116
Scaffold_6	AUGUSTUS	transcript	517363	519261	0.43	-	.	g116.t1
Scaffold_6	AUGUSTUS	stop_codon	517363	517365	.	-	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_6	AUGUSTUS	CDS	517363	519261	0.43	-	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_6	AUGUSTUS	start_codon	519259	519261	.	-	0	transcript_id "g116.t1"; gene_id "g116";
# protein sequence = [MISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGR
# LGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEEFSWEDGLIKRGGRIYVPDVGTL
# RREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILV
# VVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQ
# DDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNM
# ENVRTRRPMKKLDHKWTGPYTILSKVGSRAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGRPEEVEYL
# VKWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEDREGRRE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g116
###
# start gene g117
Scaffold_6	AUGUSTUS	gene	520710	521606	0.54	-	.	g117
Scaffold_6	AUGUSTUS	transcript	520710	521606	0.54	-	.	g117.t1
Scaffold_6	AUGUSTUS	stop_codon	520710	520712	.	-	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_6	AUGUSTUS	CDS	520710	521606	0.54	-	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_6	AUGUSTUS	start_codon	521604	521606	.	-	0	transcript_id "g117.t1"; gene_id "g117";
# protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE
# LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG
# PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL
# PTLDIESLNIPKIPSRSGLTPKVQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g117
###
# start gene g118
Scaffold_6	AUGUSTUS	gene	525476	526105	0.98	-	.	g118
Scaffold_6	AUGUSTUS	transcript	525476	526105	0.98	-	.	g118.t1
Scaffold_6	AUGUSTUS	stop_codon	525476	525478	.	-	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_6	AUGUSTUS	CDS	525476	526105	0.98	-	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_6	AUGUSTUS	start_codon	526103	526105	.	-	0	transcript_id "g118.t1"; gene_id "g118";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g118
###
# start gene g119
Scaffold_6	AUGUSTUS	gene	541620	541904	0.49	+	.	g119
Scaffold_6	AUGUSTUS	transcript	541620	541904	0.49	+	.	g119.t1
Scaffold_6	AUGUSTUS	start_codon	541620	541622	.	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_6	AUGUSTUS	CDS	541620	541904	0.49	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_6	AUGUSTUS	stop_codon	541902	541904	.	+	0	transcript_id "g119.t1"; gene_id "g119";
# protein sequence = [MVSKAAKSKAKHDLLKGDISKYIDSLQVIIPKLTDWYNITGYEYERHFGLESEADTQFHSLVQEYQELNKQLAEKIIQ
# DGGILSDAVDISPLKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g119
###
# start gene g120
Scaffold_6	AUGUSTUS	gene	542905	543162	0.52	+	.	g120
Scaffold_6	AUGUSTUS	transcript	542905	543162	0.52	+	.	g120.t1
Scaffold_6	AUGUSTUS	start_codon	542905	542907	.	+	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_6	AUGUSTUS	CDS	542905	543162	0.52	+	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_6	AUGUSTUS	stop_codon	543160	543162	.	+	0	transcript_id "g120.t1"; gene_id "g120";
# protein sequence = [MTVSIQGIIIRAYSHCCDHKIHIDWDARKQDMELNFDNDDSPTLQALNKSQPQVYSDSAYNDSEYNDGVHTICSSISA
# FLTICTQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g120
###
# start gene g121
Scaffold_6	AUGUSTUS	gene	549560	550144	0.56	+	.	g121
Scaffold_6	AUGUSTUS	transcript	549560	550144	0.56	+	.	g121.t1
Scaffold_6	AUGUSTUS	start_codon	549560	549562	.	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_6	AUGUSTUS	CDS	549560	550144	0.56	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_6	AUGUSTUS	stop_codon	550142	550144	.	+	0	transcript_id "g121.t1"; gene_id "g121";
# protein sequence = [MSSTPVDLSDHTATTNCSALQHALDPRNQHHIHHIGDSWYDCDSQPCPHALSNSVQNPITKEDTTFLPIPHPRLPTPT
# MSTPTLPAPSTSAEDLMTQLIRQVANLATAMEEHSSSKSSMNNPKVFKGKDGSEAHCFMAQFQNWASEQPDLAKSQVKLIKSALGFFIESAGDWATPH
# LLHFSAENPLSEEIGICS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g121
###
# start gene g122
Scaffold_6	AUGUSTUS	gene	552553	554237	0.34	+	.	g122
Scaffold_6	AUGUSTUS	transcript	552553	554237	0.34	+	.	g122.t1
Scaffold_6	AUGUSTUS	start_codon	552553	552555	.	+	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_6	AUGUSTUS	CDS	552553	552808	0.96	+	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_6	AUGUSTUS	CDS	552880	553241	0.51	+	2	transcript_id "g122.t1"; gene_id "g122";
Scaffold_6	AUGUSTUS	CDS	553533	554237	0.87	+	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_6	AUGUSTUS	stop_codon	554235	554237	.	+	0	transcript_id "g122.t1"; gene_id "g122";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPR
# SPISPDIPNEQRAMLELLSGFKGSIETLGTDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLP
# EPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRP
# AFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g122
###
# start gene g123
Scaffold_6	AUGUSTUS	gene	555050	558181	0.24	+	.	g123
Scaffold_6	AUGUSTUS	transcript	555050	558181	0.24	+	.	g123.t1
Scaffold_6	AUGUSTUS	start_codon	555050	555052	.	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_6	AUGUSTUS	CDS	555050	555431	0.6	+	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_6	AUGUSTUS	CDS	555485	555964	0.28	+	2	transcript_id "g123.t1"; gene_id "g123";
Scaffold_6	AUGUSTUS	CDS	557088	558181	0.95	+	2	transcript_id "g123.t1"; gene_id "g123";
Scaffold_6	AUGUSTUS	stop_codon	558179	558181	.	+	0	transcript_id "g123.t1"; gene_id "g123";
# protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP
# LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFHLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMP
# FGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEW
# PVPRKVKDIQSFLAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTER
# VNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADR
# KRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNV
# AEILDSKLDRRYKRCPLRYTFGGPVTKVPTMNSPGLLLMNYMLTNLYRRSTPDTLTNLDLDHKKSFYSISLFRRAPPKSTLCV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g123
###
# start gene g124
Scaffold_6	AUGUSTUS	gene	561468	561935	0.19	+	.	g124
Scaffold_6	AUGUSTUS	transcript	561468	561935	0.19	+	.	g124.t1
Scaffold_6	AUGUSTUS	start_codon	561468	561470	.	+	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_6	AUGUSTUS	CDS	561468	561935	0.19	+	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_6	AUGUSTUS	stop_codon	561933	561935	.	+	0	transcript_id "g124.t1"; gene_id "g124";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g124
###
# start gene g125
Scaffold_6	AUGUSTUS	gene	562037	563531	0.13	+	.	g125
Scaffold_6	AUGUSTUS	transcript	562037	563531	0.13	+	.	g125.t1
Scaffold_6	AUGUSTUS	start_codon	562037	562039	.	+	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_6	AUGUSTUS	CDS	562037	562602	0.42	+	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_6	AUGUSTUS	CDS	562722	562972	0.34	+	1	transcript_id "g125.t1"; gene_id "g125";
Scaffold_6	AUGUSTUS	CDS	563194	563531	0.62	+	2	transcript_id "g125.t1"; gene_id "g125";
Scaffold_6	AUGUSTUS	stop_codon	563529	563531	.	+	0	transcript_id "g125.t1"; gene_id "g125";
# protein sequence = [MSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKV
# EDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGVDIMTPVNSSNGKMAKENAKGMINSIPPSGPSNQSNRLERNAT
# PRSSNGTQWACFLMPRDDPNIPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVHVFNQDMR
# FEAPKSIDRPLKKSSVTIEDVDESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPNQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEE
# DIAKKIFDAKWI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g125
###
# start gene g126
Scaffold_6	AUGUSTUS	gene	564785	565616	0.62	+	.	g126
Scaffold_6	AUGUSTUS	transcript	564785	565616	0.62	+	.	g126.t1
Scaffold_6	AUGUSTUS	start_codon	564785	564787	.	+	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_6	AUGUSTUS	CDS	564785	564807	0.62	+	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_6	AUGUSTUS	CDS	564863	565616	0.73	+	1	transcript_id "g126.t1"; gene_id "g126";
Scaffold_6	AUGUSTUS	stop_codon	565614	565616	.	+	0	transcript_id "g126.t1"; gene_id "g126";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQPDLLNEPPTNKLEERIKLNQQDRSPINLIDETNKEVVNEAIGVEEPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR
# IERHIHGDPLLELPELLKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGPLKMNSFHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g126
###
# start gene g127
Scaffold_6	AUGUSTUS	gene	566335	568075	0.53	+	.	g127
Scaffold_6	AUGUSTUS	transcript	566335	568075	0.53	+	.	g127.t1
Scaffold_6	AUGUSTUS	start_codon	566335	566337	.	+	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_6	AUGUSTUS	CDS	566335	567266	0.58	+	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_6	AUGUSTUS	CDS	567435	567563	0.84	+	1	transcript_id "g127.t1"; gene_id "g127";
Scaffold_6	AUGUSTUS	CDS	567682	568075	0.9	+	1	transcript_id "g127.t1"; gene_id "g127";
Scaffold_6	AUGUSTUS	stop_codon	568073	568075	.	+	0	transcript_id "g127.t1"; gene_id "g127";
# protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLLIKKFQVDDQGRLYHRNTDQPDQPQLVVDKEKRMHMLNSAHDLQMKLLKAPPTLMHTPSLF
# QKVHVNTMIMSIPSKGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQVSRS
# GRGGVTNGAGKRSD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g127
###
# start gene g128
Scaffold_6	AUGUSTUS	gene	570808	572241	0.54	-	.	g128
Scaffold_6	AUGUSTUS	transcript	570808	572241	0.54	-	.	g128.t1
Scaffold_6	AUGUSTUS	stop_codon	570808	570810	.	-	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_6	AUGUSTUS	CDS	570808	572241	0.54	-	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_6	AUGUSTUS	start_codon	572239	572241	.	-	0	transcript_id "g128.t1"; gene_id "g128";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM
# VREVLTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g128
###
# start gene g129
Scaffold_6	AUGUSTUS	gene	572292	573458	0.94	-	.	g129
Scaffold_6	AUGUSTUS	transcript	572292	573458	0.94	-	.	g129.t1
Scaffold_6	AUGUSTUS	stop_codon	572292	572294	.	-	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_6	AUGUSTUS	CDS	572292	573458	0.94	-	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_6	AUGUSTUS	start_codon	573456	573458	.	-	0	transcript_id "g129.t1"; gene_id "g129";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g129
###
# start gene g130
Scaffold_6	AUGUSTUS	gene	574250	575026	0.77	+	.	g130
Scaffold_6	AUGUSTUS	transcript	574250	575026	0.77	+	.	g130.t1
Scaffold_6	AUGUSTUS	start_codon	574250	574252	.	+	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_6	AUGUSTUS	CDS	574250	575026	0.77	+	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_6	AUGUSTUS	stop_codon	575024	575026	.	+	0	transcript_id "g130.t1"; gene_id "g130";
# protein sequence = [MERLKERIWTYARPLIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRIL
# TRDELIGYRAQALSKHNSFIEKVRRRVDANKIAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDG
# TVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g130
###
# start gene g131
Scaffold_6	AUGUSTUS	gene	575287	575502	1	-	.	g131
Scaffold_6	AUGUSTUS	transcript	575287	575502	1	-	.	g131.t1
Scaffold_6	AUGUSTUS	stop_codon	575287	575289	.	-	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_6	AUGUSTUS	CDS	575287	575502	1	-	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_6	AUGUSTUS	start_codon	575500	575502	.	-	0	transcript_id "g131.t1"; gene_id "g131";
# protein sequence = [MTKSRQDSGSDSSASDASFATAQSIPTTGSEDTIITPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g131
###
# start gene g132
Scaffold_6	AUGUSTUS	gene	576009	577309	0.2	-	.	g132
Scaffold_6	AUGUSTUS	transcript	576009	577309	0.2	-	.	g132.t1
Scaffold_6	AUGUSTUS	stop_codon	576009	576011	.	-	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_6	AUGUSTUS	CDS	576009	576280	0.85	-	2	transcript_id "g132.t1"; gene_id "g132";
Scaffold_6	AUGUSTUS	CDS	576362	576497	0.75	-	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_6	AUGUSTUS	CDS	577142	577309	0.45	-	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_6	AUGUSTUS	start_codon	577307	577309	.	-	0	transcript_id "g132.t1"; gene_id "g132";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNSPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS
# AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS
# VATRQEAGGGRSRYA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g132
###
# start gene g133
Scaffold_6	AUGUSTUS	gene	579591	580293	0.43	-	.	g133
Scaffold_6	AUGUSTUS	transcript	579591	580293	0.43	-	.	g133.t1
Scaffold_6	AUGUSTUS	stop_codon	579591	579593	.	-	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_6	AUGUSTUS	CDS	579591	580027	1	-	2	transcript_id "g133.t1"; gene_id "g133";
Scaffold_6	AUGUSTUS	CDS	580086	580293	0.43	-	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_6	AUGUSTUS	start_codon	580291	580293	.	-	0	transcript_id "g133.t1"; gene_id "g133";
# protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS
# KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE
# AEDEDIAPPPKRLKTTSSISGRIFILHFSSHFINLIRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g133
###
# start gene g134
Scaffold_6	AUGUSTUS	gene	586164	587330	0.92	+	.	g134
Scaffold_6	AUGUSTUS	transcript	586164	587330	0.92	+	.	g134.t1
Scaffold_6	AUGUSTUS	start_codon	586164	586166	.	+	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_6	AUGUSTUS	CDS	586164	587330	0.92	+	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_6	AUGUSTUS	stop_codon	587328	587330	.	+	0	transcript_id "g134.t1"; gene_id "g134";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g134
###
# start gene g135
Scaffold_6	AUGUSTUS	gene	588037	590273	0.93	+	.	g135
Scaffold_6	AUGUSTUS	transcript	588037	590273	0.93	+	.	g135.t1
Scaffold_6	AUGUSTUS	start_codon	588037	588039	.	+	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_6	AUGUSTUS	CDS	588037	588081	0.93	+	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_6	AUGUSTUS	CDS	588204	590273	0.93	+	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_6	AUGUSTUS	stop_codon	590271	590273	.	+	0	transcript_id "g135.t1"; gene_id "g135";
# protein sequence = [MGKSRNSRGTDGGSLNPPPNDYLPTNLGTMIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS
# PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL
# MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF
# LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ
# PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN
# RQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPG
# LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHLFLAPAPSQPKA
# LPIFTTERSSVSMVFLFTLNPTADPSLQLNSCDPFSLG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g135
###
# start gene g136
Scaffold_6	AUGUSTUS	gene	591572	592168	0.85	-	.	g136
Scaffold_6	AUGUSTUS	transcript	591572	592168	0.85	-	.	g136.t1
Scaffold_6	AUGUSTUS	stop_codon	591572	591574	.	-	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_6	AUGUSTUS	CDS	591572	592017	0.93	-	2	transcript_id "g136.t1"; gene_id "g136";
Scaffold_6	AUGUSTUS	CDS	592126	592168	0.88	-	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_6	AUGUSTUS	start_codon	592166	592168	.	-	0	transcript_id "g136.t1"; gene_id "g136";
# protein sequence = [MEEEQQFEYSTLYTTIARRTGKQPQCCATSQSPRDPPPHFDLDAGDHDDQDPPVDPDDPGADNDNDNLDDDSGSLPRG
# EPGDPSGPGGPGGPGSPGSPGGPGGPRSPISPDIPNKQCAMLNLLSGFKGSIETLGSVLAACQVHASGLHSATQYVTKRQRRSD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g136
###
# start gene g137
Scaffold_6	AUGUSTUS	gene	612017	612964	0.29	+	.	g137
Scaffold_6	AUGUSTUS	transcript	612017	612964	0.29	+	.	g137.t1
Scaffold_6	AUGUSTUS	start_codon	612017	612019	.	+	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_6	AUGUSTUS	CDS	612017	612964	0.29	+	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_6	AUGUSTUS	stop_codon	612962	612964	.	+	0	transcript_id "g137.t1"; gene_id "g137";
# protein sequence = [MRETHSDIEEEQYEVEYPTLPPQLKQNPNQYYYHFQEQQLLPPSYNNHQTIYPPGLVHPAASRGPAYTPSMGQVLNVP
# MYHDPQLSPQYPIHQITQLAPAHIPMPLSRTQALTSLEASLPASSNASSKVSTPVPVRAQISNAMANPKCCSICARRPPSLTRLAILTPCAHALCPAC
# LTSALNIVGEKDMECAGCRAKVADFKLVSITADEGVAEKVEDNSSSPSKAQEPKQLTHDNLLYNGELNENQTFDISDLDETDFFSDENLRASTPPPKV
# KGMGRVFESGTVSGVEQAATKYHDPVVLRIDNVPWVSHHVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g137
###
# start gene g138
Scaffold_6	AUGUSTUS	gene	613749	614252	0.16	+	.	g138
Scaffold_6	AUGUSTUS	transcript	613749	614252	0.16	+	.	g138.t1
Scaffold_6	AUGUSTUS	start_codon	613749	613751	.	+	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_6	AUGUSTUS	CDS	613749	613755	0.16	+	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_6	AUGUSTUS	CDS	613858	614252	0.25	+	2	transcript_id "g138.t1"; gene_id "g138";
Scaffold_6	AUGUSTUS	stop_codon	614250	614252	.	+	0	transcript_id "g138.t1"; gene_id "g138";
# protein sequence = [MELFTAQQKSQLAKFSNKEEPARPLSACGSDSDAHSSVRAPDHADPTDADVEDEDGENDPQGDASLSEESHPSSDEVR
# TPSSTTAANSSSSSSPEIDSIASAQDHMRDDIAREFGVEAQLVEALIQRLSMTQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g138
###
# start gene g139
Scaffold_6	AUGUSTUS	gene	615381	616023	0.57	+	.	g139
Scaffold_6	AUGUSTUS	transcript	615381	616023	0.57	+	.	g139.t1
Scaffold_6	AUGUSTUS	start_codon	615381	615383	.	+	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_6	AUGUSTUS	CDS	615381	615605	0.6	+	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_6	AUGUSTUS	CDS	615670	616023	0.95	+	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_6	AUGUSTUS	stop_codon	616021	616023	.	+	0	transcript_id "g139.t1"; gene_id "g139";
# protein sequence = [MATTTVPSRSSYRTTLPSSKAMVTFTSFGIYNFDAGSSEIIGTNDPTNREPTHARPKEPQSRQSTLTAAHIQDTQDSK
# QHCSNPPAPASQLAKKILARPPSLNGPPGPPIPMKFVVLAPIATEADAEDTSDDSVSDAEVSTSTASLSSSTCRTSGDDNSEMDEPTLRPLTVPPWHM
# KSRRPNVCATAATSLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g139
###
# start gene g140
Scaffold_6	AUGUSTUS	gene	616364	617221	0.63	-	.	g140
Scaffold_6	AUGUSTUS	transcript	616364	617221	0.63	-	.	g140.t1
Scaffold_6	AUGUSTUS	stop_codon	616364	616366	.	-	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_6	AUGUSTUS	CDS	616364	617221	0.63	-	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_6	AUGUSTUS	start_codon	617219	617221	.	-	0	transcript_id "g140.t1"; gene_id "g140";
# protein sequence = [MTTPTPARIPPIHVPMTPKHLPKNPSSASIYSPYPATTASAPVASSHLPGPFSIARNVVATNGFRGLWLGHTGTVLRE
# TGGTAVWFAVKEWVARVLKDRRAKADPSVLPAENNPSTLLPWESAFSGAISGAVCVAALYPADTVKSAMQTEEELREMRTYQKRASSAAREWSTSSSS
# LPPISSSPSSASSSPTFPSATASSSGAAPKPSSIIPTSAIRQTISNSKALAGAARVSIESMSFLETFLKIYRTHGAKGLYSGCGMSMARAVPSSGIVF
# VVYDGLTAWFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g140
###
# start gene g141
Scaffold_6	AUGUSTUS	gene	645879	647092	0.18	+	.	g141
Scaffold_6	AUGUSTUS	transcript	645879	647092	0.18	+	.	g141.t1
Scaffold_6	AUGUSTUS	start_codon	645879	645881	.	+	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_6	AUGUSTUS	CDS	645879	646410	0.26	+	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_6	AUGUSTUS	CDS	646554	647092	0.65	+	2	transcript_id "g141.t1"; gene_id "g141";
Scaffold_6	AUGUSTUS	stop_codon	647090	647092	.	+	0	transcript_id "g141.t1"; gene_id "g141";
# protein sequence = [MSTLPFQASMKASHKDFCTRYSDDEDTSYKIRRSATKLLAALIGTRPEMLSTIYKDVSPVLISRFGDREETVKLEVWS
# TYGLLLSQTAVYGGLSQSKEDVTRGKRKRDTETMDVEGGPYSLLKSQVPALSKALLNQLKSQKTSSGTLQAGFGLLYSLLNVLPGSLSSQVASITSTS
# RPGERHPRVASEAFRVFSALLQAVKPVKNADWTEPLYDQAVARLTTHDTDAEVRGCAEECIGDLWICATDVVRSKNGKEWESICRQTGKVDGAVKVII
# KVAKEVNVGDAWVNGCMDWILGLLKKSGRPGKSDIFLALEVLIRRFVALPSSRIIADFGRQLYHWCTFRSSVGSHQPDQTIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g141
###
# start gene g142
Scaffold_6	AUGUSTUS	gene	653876	654850	1	+	.	g142
Scaffold_6	AUGUSTUS	transcript	653876	654850	1	+	.	g142.t1
Scaffold_6	AUGUSTUS	start_codon	653876	653878	.	+	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_6	AUGUSTUS	CDS	653876	654850	1	+	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_6	AUGUSTUS	stop_codon	654848	654850	.	+	0	transcript_id "g142.t1"; gene_id "g142";
# protein sequence = [MSAVQDSSSDTAQTDGDGPEGSDKPPHEDISNKKNNQPISTTPAVTILTEPHGIPLPPPEAGTYEKQPGYTVEVLKKL
# VEASSNSKLSMQAPAQIVAAPSVTAASQPTPAIVTIPITTTKPNANTLHIKQTSMTSNAGTFDTASPTSSPTVSEYDWNTSAPSTRTNSRPPSRAPSM
# SSGVAGSKLQMSKSSAVMTPAASAANGVQRSVSTNSAITNTHATPEPASPAVGSRPKPSSIHSTDGEKHRFTLKDLLANGPKLARKSSQRSTGSRSSR
# KSDEVKAMEVGTRVEVGQSLLQEIALPACRRNTVSVRKSLSERELPPLYD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g142
###
# start gene g143
Scaffold_6	AUGUSTUS	gene	657150	658097	0.84	-	.	g143
Scaffold_6	AUGUSTUS	transcript	657150	658097	0.84	-	.	g143.t1
Scaffold_6	AUGUSTUS	stop_codon	657150	657152	.	-	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_6	AUGUSTUS	CDS	657150	658097	0.84	-	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_6	AUGUSTUS	start_codon	658095	658097	.	-	0	transcript_id "g143.t1"; gene_id "g143";
# protein sequence = [MSTSESTFVVRPLNLLPAEINGIPEEVEAQKELIRKKILSVPNRELVKDKETWKLVVEMGSDLSINAFAVNFKLGNVV
# NEDIVEANYLNKRIFDALSITDANTDKKPPLILTSTVLAQKSYGECLLKFKDRLGLKGSQDLYTLVNVVMSPWPTASGLTAEIAQSLQETIVKEREVS
# VYRNTLTEDYHAFVMQGTDKLYFVHLPMFNMENHRHQLIITGVISAEMRTVYTEEREKNPDTVYLLVNDTPTTLGKILAAKEFDARIEPFDSKGQQPY
# VPYVKNVYSFITHGFPSTGPSSKAKSQISRSLFRRSSIASS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g143
###
# start gene g144
Scaffold_6	AUGUSTUS	gene	666852	667895	0.72	+	.	g144
Scaffold_6	AUGUSTUS	transcript	666852	667895	0.72	+	.	g144.t1
Scaffold_6	AUGUSTUS	start_codon	666852	666854	.	+	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_6	AUGUSTUS	CDS	666852	667895	0.72	+	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_6	AUGUSTUS	stop_codon	667893	667895	.	+	0	transcript_id "g144.t1"; gene_id "g144";
# protein sequence = [MQGPDESEIVERETIELYDIALLLNYERASSEPRFRNSKLREVATHEFDFRSVMIKTPLWTAHKGPKDGFIFQRIKRA
# IPGSDEEPDLPSNILSPQVMSSLARDITQLAPSRLETIYWQARGHDGCFKSVAILQYFLDLYAINPLLRIRLANGREYVTSSSPTSLSIVEYDLLVVK
# HLTLAVVLPDNQTYITGSSDQPRFRHAVVSFESHPYNGDNEIILDMASMQFGETGRGPGRKGKSTFVLESVGDYKKRLLTVAGGFEKAKVSSRITPDP
# NQANEAWMWKVAKKAKERWEKRGEHHWCGHCGRPLATGPALKRCSRCRQAYYCDEEHQKMAWSSHHKSWCRPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g144
###
# start gene g145
Scaffold_6	AUGUSTUS	gene	668940	669783	0.34	-	.	g145
Scaffold_6	AUGUSTUS	transcript	668940	669783	0.34	-	.	g145.t1
Scaffold_6	AUGUSTUS	stop_codon	668940	668942	.	-	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_6	AUGUSTUS	CDS	668940	669397	0.73	-	2	transcript_id "g145.t1"; gene_id "g145";
Scaffold_6	AUGUSTUS	CDS	669510	669783	0.49	-	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_6	AUGUSTUS	start_codon	669781	669783	.	-	0	transcript_id "g145.t1"; gene_id "g145";
# protein sequence = [MSSYKIFFWTYLGLNTPLILVEILGAAAMTTFAQKTTWEDAYNDNSVGGLLGAGLAGPMGGFGSFLLVLLALSIVANN
# IPNMYSLALTFQVWSVVYIVLAIVGASHFEEWLDTLLVILSYWLAIFSTILIEEHLIFRKGKWSNYVPDDFNNWRKLPLGVASFLALGCGVAGAVLGM
# AQVWYVGVIGRMIGDPEFGGDIGETPLVYISGREFLMIMIAGFELAFAFTAVTYPPLRYLEKRWWGY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g145
###
# start gene g146
Scaffold_6	AUGUSTUS	gene	679002	679898	0.98	+	.	g146
Scaffold_6	AUGUSTUS	transcript	679002	679898	0.98	+	.	g146.t1
Scaffold_6	AUGUSTUS	start_codon	679002	679004	.	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_6	AUGUSTUS	CDS	679002	679898	0.98	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_6	AUGUSTUS	stop_codon	679896	679898	.	+	0	transcript_id "g146.t1"; gene_id "g146";
# protein sequence = [MKSNQSPLAEDHSASPQKSFMNRMSSYESLQRSPIVNKLTQQERLSLFWESLDKDVNADPPKPARVLGIPVSSSESQI
# QEPLSQVSRLRRQRSSIITQTNNRLSQLMATHNKLRKLRRPKSTPAFTHPDVIMKSGTKIDEYELPNGIKQIGSGIGFTYTVPAAAKSKSSICTPTSV
# PRRSHSIMPSIGVGIGLGLRNFGGGILRTRLRREGHVDADLGHQSQDHHTQFYNPQNTGMNSVHEDVTAEVDAEQQDVFRYGSTWSLLPSEACKCTTL
# SPCLDQISPVTATDSTVYSPMSNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g146
###
# start gene g147
Scaffold_6	AUGUSTUS	gene	687723	688772	0.89	-	.	g147
Scaffold_6	AUGUSTUS	transcript	687723	688772	0.89	-	.	g147.t1
Scaffold_6	AUGUSTUS	stop_codon	687723	687725	.	-	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_6	AUGUSTUS	CDS	687723	688772	0.89	-	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_6	AUGUSTUS	start_codon	688770	688772	.	-	0	transcript_id "g147.t1"; gene_id "g147";
# protein sequence = [MHTPGDVNRPTANFKNDLGREETTSEAPRASVSELPTEPQQPESKEEVHRAASLAPSRHSSSALSSVHSTIVVVPPHC
# IFKCGRRFILFVFIPPPSSIHVQPQADVDAAAGQKVDQNEQEHPQGLLVQEEENDALKTEGPATQLLGVAIGDILEQEEETGPIISSSSKSPTEASAV
# VSTTKEISIYSAAAIATSSTATASHSMPSIVTQDVVDEGSNANLQSADQGSENSVDIDVGNNKLGDLESVDEDDTSIMDPPIGHAIEVVVHTEKFTIT
# DTNTSAANPAMISVDQPQEPRQELETSIPNEFTEVNASGGECAPSFFFNIFLLTYCGRKRALLERFPTTSFSSTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g147
###
# start gene g148
Scaffold_6	AUGUSTUS	gene	689341	690081	0.78	-	.	g148
Scaffold_6	AUGUSTUS	transcript	689341	690081	0.78	-	.	g148.t1
Scaffold_6	AUGUSTUS	stop_codon	689341	689343	.	-	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_6	AUGUSTUS	CDS	689341	690081	0.78	-	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_6	AUGUSTUS	start_codon	690079	690081	.	-	0	transcript_id "g148.t1"; gene_id "g148";
# protein sequence = [MTRASNSKVENVIGHDEDDHMDSISAGPRRGKRRATSPKSSSGLGSQRTSARTRTLTAKAAAVAAGTKRGRGRPSKNI
# AAPSTQDDLSDADAEGDEDEYVEHAEDEEEPIVERRGRGRPRKGTQIHILDEDEDEYVEEVEEESSAERRTRGRSRKAQKNQMQFADRGENEGVEEPA
# KRGRGRPRKDQGASASAPVLRTVATSRKSRSPAPISPHASHGPMLLDPYWTLPCEEDELSHCSPSKAHLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g148
###
# start gene g149
Scaffold_6	AUGUSTUS	gene	694551	695237	0.96	-	.	g149
Scaffold_6	AUGUSTUS	transcript	694551	695237	0.96	-	.	g149.t1
Scaffold_6	AUGUSTUS	stop_codon	694551	694553	.	-	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_6	AUGUSTUS	CDS	694551	695237	0.96	-	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_6	AUGUSTUS	start_codon	695235	695237	.	-	0	transcript_id "g149.t1"; gene_id "g149";
# protein sequence = [MFSRKYPHDLITTTYFKGNTHGIFFDLEFEISCFNPRWGNFNEVMIEPTKTTLGDVIHSLKAVCRKIIDMNFAMTRIE
# TPISITNKTESMLKELLEEAVAGAMADLSCLAMNFEENGIVDTEVAQMLLHLDNAKSYLEDIEDIFAQAVVGLEKALNANNRQRSWDVRNDARRVLID
# ARIVCRNVRGLWKFVHKEMESGLCGDLKEMSRQFWDVRQTLLDTLINTCREQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g149
###
# start gene g150
Scaffold_6	AUGUSTUS	gene	696196	696803	0.08	-	.	g150
Scaffold_6	AUGUSTUS	transcript	696196	696803	0.08	-	.	g150.t1
Scaffold_6	AUGUSTUS	stop_codon	696196	696198	.	-	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_6	AUGUSTUS	CDS	696196	696692	0.51	-	2	transcript_id "g150.t1"; gene_id "g150";
Scaffold_6	AUGUSTUS	CDS	696782	696803	0.08	-	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_6	AUGUSTUS	start_codon	696801	696803	.	-	0	transcript_id "g150.t1"; gene_id "g150";
# protein sequence = [MLYIPVLCSSLTLLPTADGHTPKWTSPYWEAVASKSLQNEDEPQMVHSTKGIERDDPLPLNSTVIFQQNTSSDAGVND
# ASIDSPIQDEDENEFNMGIPDLIPSSLNSNPFYGFGIIDDDTTALLDVKQQEYNNLWLGVPTKGIGGGKSANGPHWDGHSATLPSSMDWAMYSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g150
###
# start gene g151
Scaffold_6	AUGUSTUS	gene	703209	704125	0.27	-	.	g151
Scaffold_6	AUGUSTUS	transcript	703209	704125	0.27	-	.	g151.t1
Scaffold_6	AUGUSTUS	stop_codon	703209	703211	.	-	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_6	AUGUSTUS	CDS	703209	703366	0.9	-	2	transcript_id "g151.t1"; gene_id "g151";
Scaffold_6	AUGUSTUS	CDS	703546	704125	0.28	-	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_6	AUGUSTUS	start_codon	704123	704125	.	-	0	transcript_id "g151.t1"; gene_id "g151";
# protein sequence = [MYQNPGMSYAPPTNGYTQWASPNGYQVPSSQPQPQPSYVPPPEINNTPTQQSQTQWYAQQPTSPQIQQVQQISSASYP
# QTSYQASSPTPVPYVPQAPPSQQYTSSTPVQQYSTLPQQQQQQQPLPLQYAPTPTPPVQSSSYFAPTSPTPVPHTPQASLQQQYSSPTPVQQYSALPQ
# QQTTNNMPHLLQYPPNLPPATHPSVTSLAQFPVAPTSAPQAFPLYGPTPSLPSGVAQTEERKEALLIDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g151
###
# start gene g152
Scaffold_6	AUGUSTUS	gene	704239	704862	0.9	-	.	g152
Scaffold_6	AUGUSTUS	transcript	704239	704862	0.9	-	.	g152.t1
Scaffold_6	AUGUSTUS	stop_codon	704239	704241	.	-	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_6	AUGUSTUS	CDS	704239	704862	0.9	-	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_6	AUGUSTUS	start_codon	704860	704862	.	-	0	transcript_id "g152.t1"; gene_id "g152";
# protein sequence = [MHSGRHSRARDLADAELQRAIQLSLQEVGVANGHARPGYVPSQPTYQYSEPPIVDRTTHPTITSEEEEDPDLKAAIEA
# SLREANAPRPSAPIVVETPRSEYPVYDGPGYSQSYPPGVVPPHPVLPNIPNYDLEPLETDAILTFSQTVEQVQAQGGRDMSRYPAVNELYDKANSLRP
# KLAMSVDDTGRKERELFSYFHICVRIIIFFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g152
###
# start gene g153
Scaffold_6	AUGUSTUS	gene	708861	711668	0.73	+	.	g153
Scaffold_6	AUGUSTUS	transcript	708861	711668	0.73	+	.	g153.t1
Scaffold_6	AUGUSTUS	start_codon	708861	708863	.	+	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_6	AUGUSTUS	CDS	708861	711668	0.73	+	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_6	AUGUSTUS	stop_codon	711666	711668	.	+	0	transcript_id "g153.t1"; gene_id "g153";
# protein sequence = [MGIVQDTLCGIRKFTLRDSFLDWNQVQNILLWVPEWDGSVPIPAILKPKPLWTGKQILSLVIPRGINIHRSPDPKSSN
# PVFDDGMLIENGEIIFGIVEKKTVGASQGGLVHVVFREKGPEVTRQLFTGLQTVVNYWLFHNGFSIGIGDTIADKNTMSYITETIASRKANVSKIIED
# ATHDRLKPAPGMTIRESFESLVERELNLARDTSGQHAQKSLKEDNNVKQMVVAGSKGSFINISQMSVCVGQQSVEGRRIPFGFRHRTLPHFTKDDFSP
# ESRGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALEDVMVCYDGTVRNSLGDLIQFVYGEDGMDGAFIEKQNIDTFSLNDRE
# FEHNYRVDVTDPAGGFLPGVLQVGIDDSSLELQNKLDEEYDQLLSDRRLLREFIFPQHATSFNQYLPVNLSRIVQNAAQIFHIDRRKPSDLDPAFIID
# SVKTLCDRLVVVRGDGPLSHEAQANATLLFRMHLRATFGCRRVLERFHLNKEAFEWVLGEVEAKFNQSVANPGEMCGTLAAQSIGEPATQMTLNTFHY
# AGVSSKNVTLGVPRLKEIINVATNIKTPSLSVYLEPALRFDPNLAKNVQQELAYTSLRTVTAAVEIWYDPDPSSTIIEEDEVFVESFFAIPDEEVESK
# LHLQSPWLLRLELDRAKMLDRKLTMAYVASRIAESFKTDLFVIWSEDNAEKLVIRCRVLGGADKDEDGTETLEEDIFLRQLENTMLNSVSLRGVQGIN
# RVFLTRHDLVETKDDGSIVAEKDKQWVLETDGVNLKTVMCIDGVDFTRTYSNSCVEVFNVLGIEAARAAILKELRGVIEFDGSYVNYRHLALLCDLMT
# HRGSLMAITRHGINRADTGALMRCSFEETVEILMEAAAVGERMIAMVLLRMSCLDKWHLWALVHSMWHSILTC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g153
###
# start gene g154
Scaffold_6	AUGUSTUS	gene	711707	712279	0.62	+	.	g154
Scaffold_6	AUGUSTUS	transcript	711707	712279	0.62	+	.	g154.t1
Scaffold_6	AUGUSTUS	start_codon	711707	711709	.	+	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_6	AUGUSTUS	CDS	711707	712279	0.62	+	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_6	AUGUSTUS	stop_codon	712277	712279	.	+	0	transcript_id "g154.t1"; gene_id "g154";
# protein sequence = [MLAAQVDGGMTPGQVAMTPYDTNSPMWDNHLFKGSDQAAFSPLAVNSNEESGNFNYLPWGQSPRGAGGMSPGGPGYSP
# SSPNAYSPNSPAFAPTSPFGGGATSPMVYGGTSPYYDPGRGVTSPTYSPTSPAFNPTSPAFSPTSPRYSPTSPSFSPTSPRYSPQSPSFSPTSPRYSP
# TSPSFSPASPRCKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g154
###
# start gene g155
Scaffold_6	AUGUSTUS	gene	723413	724658	0.42	+	.	g155
Scaffold_6	AUGUSTUS	transcript	723413	724658	0.42	+	.	g155.t1
Scaffold_6	AUGUSTUS	start_codon	723413	723415	.	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_6	AUGUSTUS	CDS	723413	724078	0.51	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_6	AUGUSTUS	CDS	724152	724658	0.78	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_6	AUGUSTUS	stop_codon	724656	724658	.	+	0	transcript_id "g155.t1"; gene_id "g155";
# protein sequence = [MERKELRILVGTNLVRLSQLDGVDLDMYQQLILPSILEQVVNCKDVIAQEYLMEVVIQVFTDEFHLFSLGPFLSATAQ
# LHPKVNIKAIVIALIDRLAAYAAREAESEDPEETKRQEEAAARRLAERVRIQKAKARESTLSLTSTTDAPDASAWESTASFTATVESETPTVVENHGV
# EETSSDVTHEVKGKDKEGSPSRKFRGVPENVQLFEVFWKQVVELIKDITALFVSLTNLSLSCYPDRLEYVDQILAYAAEKIKEFNDNPDLHAQQTSAN
# LAALLVAPINSYQSVLTLLAIPNYAPLLSRQLFSTRRSIAHSIISSVLKNETIVETPEDVDGVLELCHVLIKDQSDSASNPANSTGTAVRRQGPPHFI
# EREEMAGTRLGGKDGTFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g155
###
# start gene g156
Scaffold_6	AUGUSTUS	gene	724893	725453	0.78	+	.	g156
Scaffold_6	AUGUSTUS	transcript	724893	725453	0.78	+	.	g156.t1
Scaffold_6	AUGUSTUS	start_codon	724893	724895	.	+	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_6	AUGUSTUS	CDS	724893	725453	0.78	+	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_6	AUGUSTUS	stop_codon	725451	725453	.	+	0	transcript_id "g156.t1"; gene_id "g156";
# protein sequence = [MPILPLGNDWQTKVSTILKFVRQLSSILANQVEAPSIALRLFLLAAQISDECGFEDLTYDFYVQAFSVYEDSISESRA
# QLQAITLIIGTLHGAKVFGVDNYDTLITKAALHGAKLLKKSHQATAVGLASHLWWQEAPPPTDSEESQPTAKEPKDDDSENSVKAVSLLGCREAVNVR
# LISVSVSTPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g156
###
# start gene g157
Scaffold_6	AUGUSTUS	gene	728195	728938	1	+	.	g157
Scaffold_6	AUGUSTUS	transcript	728195	728938	1	+	.	g157.t1
Scaffold_6	AUGUSTUS	start_codon	728195	728197	.	+	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_6	AUGUSTUS	CDS	728195	728938	1	+	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_6	AUGUSTUS	stop_codon	728936	728938	.	+	0	transcript_id "g157.t1"; gene_id "g157";
# protein sequence = [MEYDSSLAESAYKLAERWDSSRSVEISKLAFQANDLDAFSSTQKGMPPKLWTDCIRKADKVTGVVFLERLQSYKPLPS
# SHIEHLASLYKVSSTHNAEIRLRFYQFSLVDPSSPAAQKYAAEAADWVIGGGSGMVVGRMKFCRDVFRAVFKVNKDLAVNAFQKEKNSFHPIARKLIE
# KVNRVLASLSRFELAVTMSLHRTSNFQADIRWLFIGKHALENVVIVYIRQIMSLVYYRGHIGIMRRRATVY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g157
###
# start gene g158
Scaffold_6	AUGUSTUS	gene	738023	739442	0.26	+	.	g158
Scaffold_6	AUGUSTUS	transcript	738023	739442	0.26	+	.	g158.t1
Scaffold_6	AUGUSTUS	start_codon	738023	738025	.	+	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_6	AUGUSTUS	CDS	738023	738693	0.27	+	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_6	AUGUSTUS	CDS	738860	739442	0.64	+	1	transcript_id "g158.t1"; gene_id "g158";
Scaffold_6	AUGUSTUS	stop_codon	739440	739442	.	+	0	transcript_id "g158.t1"; gene_id "g158";
# protein sequence = [MKLFKDRLPDSLPRPFDIPRAPHDSFSSSPQILLYKSLAWSTALNPRRLENDWIPAWEHTVQRLLDPLSRSGHTFIPA
# GQRYLWYQDDVEEVKQEAKMRNKQLTREKQIEAEEEEHEEEMSGATGSVEEDIDEAYNPLAEVSFESHHTQAATRSVGRLVTLHEGIPEITVLETSFT
# QLKYPEHTTDDDASDAGSEVVTKEVEMWDLDELTDSEEVEEYDPQGFRLVRHRFDTQMAWASFLDGLSAAHELAIEDLSVYAIILFKRYADVQEFLAI
# AGAGPFWRWAIIHRQDIPWKDPGQNPRNRWIHQQEAARFASLFTNDYFELGTTRSDDELQKLIEVFFEPKESKFADDRAEEAKIRFEKVTKWREAHIQ
# GGDWYWLPRTERKVKRKEYDQELRERQERISKKAGKNTDEIVHVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g158
###
# start gene g159
Scaffold_6	AUGUSTUS	gene	739877	741445	0.98	-	.	g159
Scaffold_6	AUGUSTUS	transcript	739877	741445	0.98	-	.	g159.t1
Scaffold_6	AUGUSTUS	stop_codon	739877	739879	.	-	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_6	AUGUSTUS	CDS	739877	741445	0.98	-	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_6	AUGUSTUS	start_codon	741443	741445	.	-	0	transcript_id "g159.t1"; gene_id "g159";
# protein sequence = [MSSAYHPQSDGATERANRTVTQMLRQCVSSTQKDWVSKLPAIEFAINCARSESTGFAPFLLNNGRMPRAMVWNSDLSN
# EYPSVKVFARLRRLAIMAAHDSILEARVKQTRAANRKRRYDPFQQDDLVYVSTKNLTFEKGLARKLIPKYIGPYRIMKDFGNHSFAVALPTDFTRRGV
# HPVFHSSLLRIHVPNDDRRFPGRLDTQLQESPNALPQWRIEKIVSHFGQKQHAIFQVQWSTGDYTWMSFAEISAMPCLNEYFELMGVQSIEQLPTGTG
# TAPEQVKIEFGIASISFSEELESENFVSESYKFSTDGFSSQSSPFPSLLQNCPLTLPNMNSAGDDQQTIQRISNSVFSISADRLGDDDIHISAQHVRL
# FCLYDREIRVRKQEMNWHPAGYNNFAGVYNETHPGPERFALFDPDYEGAGATPILNLDTASPLLSSFGVEPHECFSHEDLTPPGYVTLAVAEHERLLD
# ISTRFSASMVNGRKRAEDRKLRKKNAMAAEEERKKGGFHYVDTKHLSGGLHR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g159
###
# start gene g160
Scaffold_6	AUGUSTUS	gene	743510	746619	0.42	-	.	g160
Scaffold_6	AUGUSTUS	transcript	743510	746619	0.42	-	.	g160.t1
Scaffold_6	AUGUSTUS	stop_codon	743510	743512	.	-	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_6	AUGUSTUS	CDS	743510	745570	0.76	-	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_6	AUGUSTUS	CDS	745630	746619	0.42	-	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_6	AUGUSTUS	start_codon	746617	746619	.	-	0	transcript_id "g160.t1"; gene_id "g160";
# protein sequence = [MQFPLRDENSEMLAQLAEITEPVHELTLNMMAFGSFTNELSVVLGSDYLSESEIITDSPIIGDEPPLIPPYHSVDEDS
# SLLLRTDSDLLEFFEDGVGDGMPALEPVSDSESDDDDDDVLQQQSDTELESEDEGQVESDSETLVSNYNTSIRDDRHTWIDGNLGLWNAPETFLVQRP
# LVNETRDVLFTVNESGQNEFSYADVAKDIFGYPNTTWSDFFLHKTIDHGWWPASIDNWMCLAMSFLLNHDAPYPADELWWGAEDSYRFHVNELDDNTY
# GIEDDNSDYGELTISRTLVMDPSFQLSAWYAQQRAERLGHLFDHEHWRHRSKPIGDSIPCDNRSIPVFEISKKSTPDGVVYQFKDKEARIWSKPLPIS
# ILRNTRFNLVGWWKKHLTKYLCEQEQRFEKARISHERKVAQANKRRIWNHQKQGEILALAIEEQLELAQPFPGDSELLEQRFSRFSTWTTLDGRIGVL
# DHIRQIKIHIQMNNAANPHFRPGELWNQVCARISGLPAFEDMDYQHLGNILSIKARNSLARHIPFIPEVMNPGYSSRDNYSVYRDPENPSQYVIVDDG
# RNFKTQVSAMLLMTPQFNLPAWYNKRLEKARNDLMRRLRGPVEFEFLPRLFGEPENDFDHQLDRYVDQSDNYLHLLFGNLEWEERNGLVHVTSLANAY
# IEPKTYPGLQRNAGVVKDIGRIVPRPIVIVVQIDGRPVRALVDSGSLGDFMSTHLSDQLRVSKKYHKNPLSLHLAIQGSRSKIHCGTTVNLKYATIDA
# NHYFDIANISNYDLILGTPWIFQYKVRIGLNPSTVEVGCDQPQPIAGDNVSEVISQAMSIAEETLETIREQLREYARPICKTAAETPLPPLRRINHTI
# PLIDENKIYPWRPSRCPEAFRPQWDQKRNDYVSSGRWVVTNSRNTVPMMLILKSGKQKDSLRVVFDLRARNANTYKMASPLPNIDGILRRVARCPYRS
# IIDGKDAYEQIRIIPEHVSRSTVTTPDGNMDSKVIQQGDCNGGATFQTVMNDIFRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g160
###
# start gene g161
Scaffold_6	AUGUSTUS	gene	746796	748553	0.68	-	.	g161
Scaffold_6	AUGUSTUS	transcript	746796	748553	0.68	-	.	g161.t1
Scaffold_6	AUGUSTUS	stop_codon	746796	746798	.	-	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_6	AUGUSTUS	CDS	746796	748553	0.68	-	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_6	AUGUSTUS	start_codon	748551	748553	.	-	0	transcript_id "g161.t1"; gene_id "g161";
# protein sequence = [MPENEKNDDGGGPWTLVQPRRSRSLDNLKQIKVQKDLFLYTKLSKEQEAAVRAAENQLTATQLEQIRKRDMIVQQQQP
# KSPGTGTLSYVAKGKFTDHNEEISDDELNTEKQKAALNKWNVIRNEQSKSGESQIEHTSDQESHRGRKKINGSKRARERKAKKARFDAQSSDETSSSE
# EQTSSKLEKSKSSKEKLDETSKPMSTRYAKKLKDMVKGRTPTPSHSGNQFSIQPVDQLPPNSLLAKVLNQNKIVSKSKGVKHTELSSDSNDSSSAEES
# TTSESDSTDLSEDSSSSESTDSSKSSYRKHKRSHHSIKNKSKKYNKKKKSYQLKRIIKPVPPVRYDGSEDSEKFERFGLESAQFCKEGQVPKDEQVFL
# VSHYLEGKAHTFFVQKVAKNHSKWSLSEFLEGLFNFCFSANFRSQQRDKLRRCHQNGRTVSEYVYELENLMNHVGVLGKREKVIKLWDGFSQGYRYEL
# RRAKLSKEVHSWKRIVCEAEAIEMADFENDLGSRFKPRKPEIAVQIMTISINEIRMAVFDNGIITVQLTKILGTVLVPPKLPHRIPQNQSQWSTQDVR
# DMRTPLTIIHINVEMKI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g161
###
# start gene g162
Scaffold_6	AUGUSTUS	gene	749549	750766	1	+	.	g162
Scaffold_6	AUGUSTUS	transcript	749549	750766	1	+	.	g162.t1
Scaffold_6	AUGUSTUS	start_codon	749549	749551	.	+	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_6	AUGUSTUS	CDS	749549	750766	1	+	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_6	AUGUSTUS	stop_codon	750764	750766	.	+	0	transcript_id "g162.t1"; gene_id "g162";
# protein sequence = [MSFGNSPNIPRLPDEKQLVSEESWRPYKREILFAVQSKGLTGYIDGTIPKPNAYPGPIYLSTLPPTPLFSPTPCLEEW
# EARDRLVAGAITSNITDPVGLGVDETKRAHEIWQALIKRFEKRDKQRIHLADTNLRNEKFDPPEVTMEDHERKMRNLLKKVHDLGGTATDAQFRWIVI
# SSMPQEWRQDVRSVPGTSSADAFAYLHTLWYEKEEEWREEERDTKHVKALMAAHSHTSAMTNRTNLPPAGSKAAVICHNCSKPGHIARKCWAKGGGME
# GQWPKQNSSSNTKTNANATMAKPDNADVSSPMATYVMSAKTNYEPSRSESVQKTKLTADLANRQDNPILGDMGQREAREWDVDSNLTSYTPIPKGDCT
# VCHGNTHLYSTPVPTIRTFIDSLSIAGCKNLIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g162
###
# start gene g163
Scaffold_6	AUGUSTUS	gene	753576	755231	0.14	+	.	g163
Scaffold_6	AUGUSTUS	transcript	753576	755231	0.14	+	.	g163.t1
Scaffold_6	AUGUSTUS	start_codon	753576	753578	.	+	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_6	AUGUSTUS	CDS	753576	753877	0.41	+	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_6	AUGUSTUS	CDS	754469	755231	0.96	+	1	transcript_id "g163.t1"; gene_id "g163";
Scaffold_6	AUGUSTUS	stop_codon	755229	755231	.	+	0	transcript_id "g163.t1"; gene_id "g163";
# protein sequence = [MGGAGTDGAKGKSSDIQFTQKSTATDSAKDSAAQDKPSSYDEVHSSHPLRDAAIPHTVLIANASKAVVGTVGSILVAH
# KGQTTGVGFPGGTTPPVLLMQMSANEHQKTKTSSRCISKDVESLKPISSRFAKKIKDIAKGHETMPNSTTYHSRHLSTQPVDQLPQDSLLTRMIKTKK
# RSKKSIKNHKSSSDSDADSESLDSESCSESLDSESCSESTSSNSSLSSSSSELDSSDESVQHRKQHRHRSRSHSQKRGGRKSKKRTYNRIIKPVSPSI
# WNGEADAEVFQRIVLEGYEFCKEGKIPKNEWVFLISHYLSGKAYQFFALKVAKNHSKWSLQEFYEGLFNYCFPVNHREQM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g163
###
# start gene g164
Scaffold_6	AUGUSTUS	gene	755980	756363	0.49	+	.	g164
Scaffold_6	AUGUSTUS	transcript	755980	756363	0.49	+	.	g164.t1
Scaffold_6	AUGUSTUS	start_codon	755980	755982	.	+	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_6	AUGUSTUS	CDS	755980	756363	0.49	+	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_6	AUGUSTUS	stop_codon	756361	756363	.	+	0	transcript_id "g164.t1"; gene_id "g164";
# protein sequence = [MHFTSFVDDVSEDSAFEYMSENNNSLTPISNADLVLEDGLLPLPSNLSCSEIPDDDHDSLPDLESMSDSDVEADNIPD
# LQDVSDSEYDDDDMFDSLSTFKTDLLESDLSPRNHSRLIISSTATYHAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g164
###
# start gene g165
Scaffold_6	AUGUSTUS	gene	758047	758376	0.43	-	.	g165
Scaffold_6	AUGUSTUS	transcript	758047	758376	0.43	-	.	g165.t1
Scaffold_6	AUGUSTUS	stop_codon	758047	758049	.	-	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_6	AUGUSTUS	CDS	758047	758376	0.43	-	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_6	AUGUSTUS	start_codon	758374	758376	.	-	0	transcript_id "g165.t1"; gene_id "g165";
# protein sequence = [MSDTSANHPPAVVKPKRGCKPKNKPRTEEENNALAKLMNDWEAMKGMNVSQNELASLSPNLVSQAARDVENARLNAEL
# VALHAYRSTVLSETRIGQQTISPMPVEGTSC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g165
###
# start gene g166
Scaffold_6	AUGUSTUS	gene	759839	761164	0.69	+	.	g166
Scaffold_6	AUGUSTUS	transcript	759839	761164	0.69	+	.	g166.t1
Scaffold_6	AUGUSTUS	start_codon	759839	759841	.	+	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_6	AUGUSTUS	CDS	759839	760261	0.69	+	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_6	AUGUSTUS	CDS	760337	761164	0.69	+	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_6	AUGUSTUS	stop_codon	761162	761164	.	+	0	transcript_id "g166.t1"; gene_id "g166";
# protein sequence = [MSDTEPENQHNSDPETHMADDIVSMPLRSKSERVAKNLNKSGIDGGQSSLQIEDVSNFSALDIHDQCTHMEKLIPANW
# IPPEDSETDQEDRDGADDIPFPLEDKNLFDDDLEEDNFWDFRKFDWEQYREYRNDSWLPALQQQLQKTSFQSMTSPFAALSHISFSHILQMEISENFL
# THSPWRLLYHLLTKSVPVLHSSPALSLKSTTAVSILVSVIPDHMNLAKHVHSVMNHVINSNKKAQKRFIYIPVIPRLKAFAMNPEVAKNMQYLNNFTN
# GSSEVRTTKDVFDGEDYKFLRKQNVVVGSCTYTYHRDIALGLSTDGFGPFKRRKHTCWPLILFNYNLPPEIQFHMENILAVGVIPGPKKPKDADSFMW
# PLVREMLQLALGITTFDVLLKKIFTLRAYLILVFGDIPAVTMIM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g166
###
# start gene g167
Scaffold_6	AUGUSTUS	gene	772545	773603	0.74	-	.	g167
Scaffold_6	AUGUSTUS	transcript	772545	773603	0.74	-	.	g167.t1
Scaffold_6	AUGUSTUS	stop_codon	772545	772547	.	-	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_6	AUGUSTUS	CDS	772545	773603	0.74	-	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_6	AUGUSTUS	start_codon	773601	773603	.	-	0	transcript_id "g167.t1"; gene_id "g167";
# protein sequence = [MWSTSGRSWNDYGQHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFI
# DNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYD
# KELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERV
# LIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRIARNEEESLVWEDGLIKRGGRIYVPDVGTYEGRSYSRTTTIN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g167
###
# start gene g168
Scaffold_6	AUGUSTUS	gene	774955	775434	0.52	-	.	g168
Scaffold_6	AUGUSTUS	transcript	774955	775434	0.52	-	.	g168.t1
Scaffold_6	AUGUSTUS	stop_codon	774955	774957	.	-	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_6	AUGUSTUS	CDS	774955	775434	0.52	-	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_6	AUGUSTUS	start_codon	775432	775434	.	-	0	transcript_id "g168.t1"; gene_id "g168";
# protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE
# LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPEVPQQTPKLPLELQGRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g168
###
# start gene g169
Scaffold_6	AUGUSTUS	gene	780969	781313	0.51	+	.	g169
Scaffold_6	AUGUSTUS	transcript	780969	781313	0.51	+	.	g169.t1
Scaffold_6	AUGUSTUS	start_codon	780969	780971	.	+	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_6	AUGUSTUS	CDS	780969	781313	0.51	+	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_6	AUGUSTUS	stop_codon	781311	781313	.	+	0	transcript_id "g169.t1"; gene_id "g169";
# protein sequence = [MIKTLWSAPHDPGANNNHDDLDDDSGSLLHGEPGGPGGPCSPISPDIPNKQHAMLELPSGFKGSIETLGTILAALGRP
# SDSSESKSKVKEPEVFDGSDPPKAQDVLRQSCPGLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g169
###
# start gene g170
Scaffold_6	AUGUSTUS	gene	781495	782112	0.61	+	.	g170
Scaffold_6	AUGUSTUS	transcript	781495	782112	0.61	+	.	g170.t1
Scaffold_6	AUGUSTUS	start_codon	781495	781497	.	+	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_6	AUGUSTUS	CDS	781495	782112	0.61	+	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_6	AUGUSTUS	stop_codon	782110	782112	.	+	0	transcript_id "g170.t1"; gene_id "g170";
# protein sequence = [MQGEAKDSLSNLKTSGNNNIRFNTLAASTRTGILPALKWAYGRGLAEHIKDEMAHLPEPATLADYRQEVLHIDNRYLK
# HEETRKHEAGKPFIARKPKKGSSDFKAGSTNQQNNSQPSGSLAPFMPKPKPFSGGKPNNSGKPQNSLNSGQSGGQLPMFNHLRADGKVLPSERERRMK
# NNLCLFCGGKHQIADCNKQKGPRIEELCC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g170
###
# start gene g171
Scaffold_6	AUGUSTUS	gene	784530	784913	1	+	.	g171
Scaffold_6	AUGUSTUS	transcript	784530	784913	1	+	.	g171.t1
Scaffold_6	AUGUSTUS	start_codon	784530	784532	.	+	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_6	AUGUSTUS	CDS	784530	784913	1	+	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_6	AUGUSTUS	stop_codon	784911	784913	.	+	0	transcript_id "g171.t1"; gene_id "g171";
# protein sequence = [MVEATESIFEHGGITSDEAKVELALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQ
# FNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLALILPK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g171
###
# start gene g172
Scaffold_6	AUGUSTUS	gene	787569	788339	0.96	+	.	g172
Scaffold_6	AUGUSTUS	transcript	787569	788339	0.96	+	.	g172.t1
Scaffold_6	AUGUSTUS	start_codon	787569	787571	.	+	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_6	AUGUSTUS	CDS	787569	788339	0.96	+	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_6	AUGUSTUS	stop_codon	788337	788339	.	+	0	transcript_id "g172.t1"; gene_id "g172";
# protein sequence = [MLDEQDAADADQQELQEFLALQQGEAVVAAKRKRDRSPMPMAGPSIKRVQQDASKKRSRRRSPEEEVVQEAPLRVRLV
# VPPGRSVAASTSTPLPPRASPSLMEVSGGDLPVQGHSNLVRLAAVAEAQSGSVQRPVVPPSIKDAGPDLLSSNMPPASRPTLVPRALAAHPYRAENQC
# LAARVRLLESQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSRHEVLEHETEYQRVLDQFVALDGALPGTPGQVST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g172
###
# start gene g173
Scaffold_6	AUGUSTUS	gene	795528	796448	0.8	-	.	g173
Scaffold_6	AUGUSTUS	transcript	795528	796448	0.8	-	.	g173.t1
Scaffold_6	AUGUSTUS	stop_codon	795528	795530	.	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_6	AUGUSTUS	CDS	795528	796448	0.8	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_6	AUGUSTUS	start_codon	796446	796448	.	-	0	transcript_id "g173.t1"; gene_id "g173";
# protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGASWIWDSSC
# QEAFENLKTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVV
# TDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASII
# MDIEALHQAIILALPADPSSVAGLELAKRSFQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g173
###
# start gene g174
Scaffold_6	AUGUSTUS	gene	798359	799830	0.33	-	.	g174
Scaffold_6	AUGUSTUS	transcript	798359	799830	0.33	-	.	g174.t1
Scaffold_6	AUGUSTUS	stop_codon	798359	798361	.	-	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_6	AUGUSTUS	CDS	798359	799705	0.47	-	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_6	AUGUSTUS	CDS	799819	799830	0.35	-	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_6	AUGUSTUS	start_codon	799828	799830	.	-	0	transcript_id "g174.t1"; gene_id "g174";
# protein sequence = [MILTPNHLPHSPTLSLQSVNHVAVIAVSVQLQSLLRRLFLKPWKRKQQFXYSTLYTGDGQPVQVLTPRRGQPPVVAPA
# RGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNNDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGP
# GGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNY
# TLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAE
# RIKDEMARLPEPATLANYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSSNQHNNSQPSGSSAPFHAEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g174
###
# start gene g175
Scaffold_6	AUGUSTUS	gene	801292	802632	0.72	-	.	g175
Scaffold_6	AUGUSTUS	transcript	801292	802632	0.72	-	.	g175.t1
Scaffold_6	AUGUSTUS	stop_codon	801292	801294	.	-	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_6	AUGUSTUS	CDS	801292	802632	0.72	-	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_6	AUGUSTUS	start_codon	802630	802632	.	-	0	transcript_id "g175.t1"; gene_id "g175";
# protein sequence = [MGWSTTEVEYTYQQTTTYALRYSVNAMTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVRRSRRHPRA
# VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIK
# SDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDA
# GAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEI
# PTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g175
###
# start gene g176
Scaffold_6	AUGUSTUS	gene	802870	806139	0.09	-	.	g176
Scaffold_6	AUGUSTUS	transcript	802870	806139	0.09	-	.	g176.t1
Scaffold_6	AUGUSTUS	stop_codon	802870	802872	.	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_6	AUGUSTUS	CDS	802870	804752	0.15	-	2	transcript_id "g176.t1"; gene_id "g176";
Scaffold_6	AUGUSTUS	CDS	805488	806139	0.28	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_6	AUGUSTUS	start_codon	806137	806139	.	-	0	transcript_id "g176.t1"; gene_id "g176";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP
# FGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI
# SVDVYLHDPTMTGRNSGYPPMHTAHTTSADPHAMDIDATHTTGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVK
# PPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTY
# SQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSP
# VFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALM
# NAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFL
# GFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTNTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQP
# AERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRRKHPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g176
###
# start gene g177
Scaffold_6	AUGUSTUS	gene	807209	809014	0.35	-	.	g177
Scaffold_6	AUGUSTUS	transcript	807209	809014	0.35	-	.	g177.t1
Scaffold_6	AUGUSTUS	stop_codon	807209	807211	.	-	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_6	AUGUSTUS	CDS	807209	808569	0.38	-	2	transcript_id "g177.t1"; gene_id "g177";
Scaffold_6	AUGUSTUS	CDS	808711	809014	0.42	-	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_6	AUGUSTUS	start_codon	809012	809014	.	-	0	transcript_id "g177.t1"; gene_id "g177";
# protein sequence = [MYLVTRKLNKWRKNWDGIVLNPILQNMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNKIV
# QMEKNKYSNEGAGSVHENFKIQCSPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEE
# VEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQL
# IAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLXHISPTKEGSPTEEILRASGSNDPERVQQPKDPENGNPGLEQGGVVKELDEEVSKRQ
# ETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSYSSPAGAPVLFAKKKDGTLRL
# CVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSRFNSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g177
###
# start gene g178
Scaffold_6	AUGUSTUS	gene	809838	811746	0.33	-	.	g178
Scaffold_6	AUGUSTUS	transcript	809838	811746	0.33	-	.	g178.t1
Scaffold_6	AUGUSTUS	stop_codon	809838	809840	.	-	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_6	AUGUSTUS	CDS	809838	810730	0.58	-	2	transcript_id "g178.t1"; gene_id "g178";
Scaffold_6	AUGUSTUS	CDS	811731	811746	0.5	-	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_6	AUGUSTUS	start_codon	811744	811746	.	-	0	transcript_id "g178.t1"; gene_id "g178";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDLEEDRIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g178
###
# start gene g179
Scaffold_6	AUGUSTUS	gene	812457	813308	0.89	-	.	g179
Scaffold_6	AUGUSTUS	transcript	812457	813308	0.89	-	.	g179.t1
Scaffold_6	AUGUSTUS	stop_codon	812457	812459	.	-	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_6	AUGUSTUS	CDS	812457	813308	0.89	-	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_6	AUGUSTUS	start_codon	813306	813308	.	-	0	transcript_id "g179.t1"; gene_id "g179";
# protein sequence = [MCTQKIQRHPQAVTQPLDVPLGLWEEVGVDLITQLPNSQGYNAVLVCTDLYGKQIHALPCTSSITAEGVADIYYREIF
# RLHGLPHFKSDHGPQFAAKLMRSLLARLGIKLDLTSGYRPQSNGQTERANQEVKKYIQLYVGRQQDDWAEHLPMAEFIINLRTYSALGMSPFELTYGY
# FPLFNIPVGQCSRIPAVDDRIQILREARQDAGAALHLGKKQQKEGYKQGKWKAHQLKVGNFVWLSAEDINLQLSSEKLGDWQLGPYRILEKIGPLDYH
# LDLPISLDR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g179
###
# start gene g180
Scaffold_6	AUGUSTUS	gene	816854	817300	0.23	-	.	g180
Scaffold_6	AUGUSTUS	transcript	816854	817300	0.23	-	.	g180.t1
Scaffold_6	AUGUSTUS	stop_codon	816854	816856	.	-	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_6	AUGUSTUS	CDS	816854	817300	0.23	-	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_6	AUGUSTUS	start_codon	817298	817300	.	-	0	transcript_id "g180.t1"; gene_id "g180";
# protein sequence = [MFLKEFSQQFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDQTEMSDIDLRECFFTALLPEIQQHLITINIAQ
# GIAPTLKEAIKWAILVDVYLHDPTMTGQNTGHTPAHTAHITPADPHAMDIDATHTSPGNSREAFLAHMRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g180
###
# start gene g181
Scaffold_6	AUGUSTUS	gene	818332	818715	0.25	-	.	g181
Scaffold_6	AUGUSTUS	transcript	818332	818715	0.25	-	.	g181.t1
Scaffold_6	AUGUSTUS	stop_codon	818332	818334	.	-	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_6	AUGUSTUS	CDS	818332	818715	0.25	-	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_6	AUGUSTUS	start_codon	818713	818715	.	-	0	transcript_id "g181.t1"; gene_id "g181";
# protein sequence = [MSTPAPPAPPTSAEDLMTQLIRQVANLATAMEEYSSSKSSMNKPKVFKGKDGTEAYRFMAQCHALATTRPVPVTTTRC
# HTSYPPPVVLRTSPKYHQTPPQVFLTPLPKRPSPRHAYESPLADNPFKY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g181
###
# start gene g182
Scaffold_6	AUGUSTUS	gene	823421	826739	0.12	+	.	g182
Scaffold_6	AUGUSTUS	transcript	823421	826739	0.12	+	.	g182.t1
Scaffold_6	AUGUSTUS	start_codon	823421	823423	.	+	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_6	AUGUSTUS	CDS	823421	823955	0.31	+	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_6	AUGUSTUS	CDS	824769	825095	0.41	+	2	transcript_id "g182.t1"; gene_id "g182";
Scaffold_6	AUGUSTUS	CDS	825937	826739	0.99	+	2	transcript_id "g182.t1"; gene_id "g182";
Scaffold_6	AUGUSTUS	stop_codon	826737	826739	.	+	0	transcript_id "g182.t1"; gene_id "g182";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPG
# DPTFWLFGAVHAEPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETP
# EATIEVVEEDRKTKVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLA
# TGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMP
# FGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEFFGGYGNIGFTPTPRSANSIWILLSIWVIFFLPTD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g182
###
# start gene g183
Scaffold_6	AUGUSTUS	gene	842808	844287	0.77	+	.	g183
Scaffold_6	AUGUSTUS	transcript	842808	844287	0.77	+	.	g183.t1
Scaffold_6	AUGUSTUS	start_codon	842808	842810	.	+	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_6	AUGUSTUS	CDS	842808	842838	0.77	+	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_6	AUGUSTUS	CDS	843446	844287	0.88	+	2	transcript_id "g183.t1"; gene_id "g183";
Scaffold_6	AUGUSTUS	stop_codon	844285	844287	.	+	0	transcript_id "g183.t1"; gene_id "g183";
# protein sequence = [MGSTSQASWEKIIRIQIADSQEEDIINPSDSEDDGDFEIIAEGIASTVSKTLASVDNGEPQLVVVKTSTIIKKWAKEP
# HDIIKECRILERLSHPNVRSIFLLVDCYEHFESKVIPIFDSLLDRSQNTMNIWMPYVPYSLSGLLDSARFVPTPQLEDFSTPHSQAQHSKFLHLARSL
# MIQIIYGVTYLHAQSIAHRDLKPANVLLTATGRVILIDFGIARDGSKDYYEESLRNGDLWPEAKDSMYSRSPLGWFIFILLIDLTEPEITVPTAPQNS
# SLERALTMRTRSTYGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g183
###
# start gene g184
Scaffold_6	AUGUSTUS	gene	847068	848231	1	+	.	g184
Scaffold_6	AUGUSTUS	transcript	847068	848231	1	+	.	g184.t1
Scaffold_6	AUGUSTUS	start_codon	847068	847070	.	+	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_6	AUGUSTUS	CDS	847068	848231	1	+	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_6	AUGUSTUS	stop_codon	848229	848231	.	+	0	transcript_id "g184.t1"; gene_id "g184";
# protein sequence = [MFLDESNSPRPSSAPSGPSGDSSLPNGTNPPGGPAGVRSPPSAASLSSNDPSRNRTSNVSCPVRPSPVIPWPFRPFPY
# HENAPPPPLPPPAPSFVVPTVPSPVHYVPSVPPNALPNPQLPLWPTPAVPSFLLRPAMPVPGSAVMWEPGTFPMSPLGGSVPLRVHPHILYNPMSPSL
# PVLQWDIVLRAEQARVLTGQALIKRPSLNDEAVVPAPTQSFGLNAGPRNGQADRKIDKIWIESDTPILAWWMQRWGPIIIEKSNITVRDVLDAVHTYL
# SIPLTNGDYKKAVEVQTPTDGVNHGNGMRLRNARRLRASNGCELRSVALRGRALEDGWSAQLMGADPGESSIYRRSDLLGTYRRFLGLRPIVFSDGSW
# KLLLGLGPGPVPKFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g184
###
# start gene g185
Scaffold_6	AUGUSTUS	gene	854256	854600	0.8	+	.	g185
Scaffold_6	AUGUSTUS	transcript	854256	854600	0.8	+	.	g185.t1
Scaffold_6	AUGUSTUS	start_codon	854256	854258	.	+	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_6	AUGUSTUS	CDS	854256	854600	0.8	+	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_6	AUGUSTUS	stop_codon	854598	854600	.	+	0	transcript_id "g185.t1"; gene_id "g185";
# protein sequence = [MKQNFSFLDGCVLQPDPGEDPCLEFWEDDSRLNAYSFGGAVEAIISQSTDSSEPDIMTYWEPAYFPGFVRGNVDSQYN
# DWQDGESLTWTYPEGFPEEFIDNKNAVTAVHLKVIW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g185
###
# start gene g186
Scaffold_6	AUGUSTUS	gene	856780	857135	0.4	+	.	g186
Scaffold_6	AUGUSTUS	transcript	856780	857135	0.4	+	.	g186.t1
Scaffold_6	AUGUSTUS	start_codon	856780	856782	.	+	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_6	AUGUSTUS	CDS	856780	856790	0.4	+	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_6	AUGUSTUS	CDS	856844	857135	0.78	+	1	transcript_id "g186.t1"; gene_id "g186";
Scaffold_6	AUGUSTUS	stop_codon	857133	857135	.	+	0	transcript_id "g186.t1"; gene_id "g186";
# protein sequence = [MADALFKISFELSQKHWGYQGLKNYRIATLDFLYNRKSQPRSALSRIRCPVKLVYGTDDVAYPQEYNEKFFRELEDAG
# VDVSLLVVPGAPHFVSVAHANQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g186
###
# start gene g187
Scaffold_6	AUGUSTUS	gene	870286	870894	0.44	+	.	g187
Scaffold_6	AUGUSTUS	transcript	870286	870894	0.44	+	.	g187.t1
Scaffold_6	AUGUSTUS	start_codon	870286	870288	.	+	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_6	AUGUSTUS	CDS	870286	870894	0.44	+	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_6	AUGUSTUS	stop_codon	870892	870894	.	+	0	transcript_id "g187.t1"; gene_id "g187";
# protein sequence = [MGNYAAALDYFETALTAPSTHNSPPAGLQLEALKKLRLVQCIALGGPQALPKYTSPVLMRIFKASPYQNLINAFPGSP
# HPKDRGEGSSSGNHRLRLLVNKDRELYLSECNLGLVDLLVAEAPKWIIKRLTETYVTLGLAEIGKYIGIDDEQQVRALVLNMVSLPFIVFCSPIVKPS
# YRLSRKLFLPQSPTLELSPSTMRLAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g187
###
# start gene g188
Scaffold_6	AUGUSTUS	gene	873443	874403	0.42	-	.	g188
Scaffold_6	AUGUSTUS	transcript	873443	874403	0.42	-	.	g188.t1
Scaffold_6	AUGUSTUS	stop_codon	873443	873445	.	-	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_6	AUGUSTUS	CDS	873443	874225	0.88	-	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_6	AUGUSTUS	CDS	874395	874403	0.42	-	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_6	AUGUSTUS	start_codon	874401	874403	.	-	0	transcript_id "g188.t1"; gene_id "g188";
# protein sequence = [MREAEVPPSPTYKSNSSNPFDPFLDDSKVRSKFTQTASIPTLATHPSGKLARRRQPNLPFNSTKSNTPSKAIPVPRSF
# NSVGANLSRSEPSASNVRPRRGNPFPAGDPFPICDDLTDTEDDTDDSTPPVTPTRARAAPRFNLGLGDGPRTAPITASSSGFPFSVSSTPSPVGRKTV
# RTHHRVPSEGIFAMSSDEESITHRAANGPDIDLKALLRLAAKRLPLSDESEQEREAAAAAAAAYFASSNFQNSPSPEELPPPSFAFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g188
###
# start gene g189
Scaffold_6	AUGUSTUS	gene	879534	885387	0.4	-	.	g189
Scaffold_6	AUGUSTUS	transcript	879534	885387	0.4	-	.	g189.t1
Scaffold_6	AUGUSTUS	stop_codon	879534	879536	.	-	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_6	AUGUSTUS	CDS	879534	880384	0.52	-	2	transcript_id "g189.t1"; gene_id "g189";
Scaffold_6	AUGUSTUS	CDS	881733	885387	0.43	-	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_6	AUGUSTUS	start_codon	885385	885387	.	-	0	transcript_id "g189.t1"; gene_id "g189";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM
# VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT
# DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF
# DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE
# AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK
# KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS
# LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI
# LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK
# GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSWTTQDFSNSVVTVPGGNAPLGLEENRTNLHLPDDI
# WGGGGGSGETQGVEDFSGPFAPREGNLGYRSTGPSDVEPSYNNQYGWGQRGNYRESYENYGADNRGGGYRRNYHEGNLGMQGGGYEGNLGNQGRDYGG
# SYGGSYGGFYGEGYKGPDSGYGGYNRGLYQNFERNYPGGRRYDHFSQSRSLQEFIKDNRGIKGLEVAESARTGFQEATHLGTAQASEVAQRGVSSITE
# KLREPTAEGRSFYSYVRYGGLIALLDSEKARKSLVGKTEPTLSPLLTQFLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g189
###
# start gene g190
Scaffold_6	AUGUSTUS	gene	886040	886603	0.89	-	.	g190
Scaffold_6	AUGUSTUS	transcript	886040	886603	0.89	-	.	g190.t1
Scaffold_6	AUGUSTUS	stop_codon	886040	886042	.	-	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_6	AUGUSTUS	CDS	886040	886603	0.89	-	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_6	AUGUSTUS	start_codon	886601	886603	.	-	0	transcript_id "g190.t1"; gene_id "g190";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDSEIGLKCLILTCGNVSSLH
# YSQRSDNTSSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g190
###
# start gene g191
Scaffold_6	AUGUSTUS	gene	887603	887971	0.99	-	.	g191
Scaffold_6	AUGUSTUS	transcript	887603	887971	0.99	-	.	g191.t1
Scaffold_6	AUGUSTUS	stop_codon	887603	887605	.	-	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_6	AUGUSTUS	CDS	887603	887971	0.99	-	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_6	AUGUSTUS	start_codon	887969	887971	.	-	0	transcript_id "g191.t1"; gene_id "g191";
# protein sequence = [MQEILNDYGKSGENPYFKHFLSGVQGLYSLDGSSHQPKTYPATAPSSPPSMRLDIGDDSDNDSDSDMGSEAYRGNDRD
# MDEPWEENTETTSTNEGKDQNTEILYLDQGILFYLFEFCFDELL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g191
###
# start gene g192
Scaffold_6	AUGUSTUS	gene	890535	891851	0.99	-	.	g192
Scaffold_6	AUGUSTUS	transcript	890535	891851	0.99	-	.	g192.t1
Scaffold_6	AUGUSTUS	stop_codon	890535	890537	.	-	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_6	AUGUSTUS	CDS	890535	891851	0.99	-	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_6	AUGUSTUS	start_codon	891849	891851	.	-	0	transcript_id "g192.t1"; gene_id "g192";
# protein sequence = [MEGSNSDTQKPSESLTCLPSPQPASPPPSLPSQPPSETPDQSPSQTPFETPHGTPRESPLEMHFETHFETHFETLLET
# PLETPLETPLETPLETPLETPLESCFEMPRESCFGTPLETPRESRFKTPLKMPCESPLETPHESPLEMPRESPLEMPRESRFEMPLETRFEALLESRF
# EMPRESRFEMPRQSHFETPLETPRQSRFESRFESPHESPSETHFESPDKTPYQAPPKTPLETPYKPHSLQLLSPLPPCQLAPSTPSSASTLSQSLPGS
# PLKDQPPPSNRDSQPLKRKRTKKNPGRTPGGGFEDPGPVACPRKSVRTKKRRRTDTYDYEDNTRSRFATGNVAAEPSKDVSVDLTTQLARISFGTQTT
# VGHVDYSSWVSGLKAIMEGTLDNVKDLAVSSLLNIARRCDLASKVDRTARFVRMLNELYFAAKVNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g192
###
# start gene g193
Scaffold_6	AUGUSTUS	gene	898401	899417	0.91	+	.	g193
Scaffold_6	AUGUSTUS	transcript	898401	899417	0.91	+	.	g193.t1
Scaffold_6	AUGUSTUS	start_codon	898401	898403	.	+	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_6	AUGUSTUS	CDS	898401	899417	0.91	+	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_6	AUGUSTUS	stop_codon	899415	899417	.	+	0	transcript_id "g193.t1"; gene_id "g193";
# protein sequence = [MSPFTEAIYKDFGDAKCHPPRLTIATLNAIDSIQARNIFPQDLPAYQKASVMARTNGVVSPFWRDWPLAEPCEFLTPE
# PLHHWHKMFWDHDIKWAIQAVGATSIDFRFSIHQPTVGYRSFKEGISTLKQVTGRTQRDIQRYLIPLISGAVTSRFVTALRALMDFRYAGQATRFNQA
# SASRVQAALDEFHKNKDIIQDLKARVNPKGVPIVHWEIPKLEFMQSVEPSIRASGPIMQWTADTTEHTHITLVKDPARSGNNHDFEVQICRHLDRQAR
# VRRFDLMTAMVDARVDFRLGDIEGDEDRGEEGLDEEEATTRIILRATSSSPQSCIEEAFWIVSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g193
###
# start gene g194
Scaffold_6	AUGUSTUS	gene	903527	903850	0.57	+	.	g194
Scaffold_6	AUGUSTUS	transcript	903527	903850	0.57	+	.	g194.t1
Scaffold_6	AUGUSTUS	start_codon	903527	903529	.	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_6	AUGUSTUS	CDS	903527	903850	0.57	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_6	AUGUSTUS	stop_codon	903848	903850	.	+	0	transcript_id "g194.t1"; gene_id "g194";
# protein sequence = [MLYQDEMIVYYSDQRDPDFGQKLVHQTSADLLTWEAAVNDVAYDVFDDRPGMTTVALLPNGSYIMTYEFFGAPEASFA
# VYYRISDDPTAFDSAPGQVTSRNRWNDTY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g194
###
# start gene g195
Scaffold_6	AUGUSTUS	gene	908484	909095	0.97	+	.	g195
Scaffold_6	AUGUSTUS	transcript	908484	909095	0.97	+	.	g195.t1
Scaffold_6	AUGUSTUS	start_codon	908484	908486	.	+	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_6	AUGUSTUS	CDS	908484	909095	0.97	+	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_6	AUGUSTUS	stop_codon	909093	909095	.	+	0	transcript_id "g195.t1"; gene_id "g195";
# protein sequence = [MDLQRITKASPSLPCPPKNTTDAHCRSRCRSVGSEFISQLLSIPTESSPFRLVSLSSSSRTVYFEPTNAITSIEKWKT
# ILSESNEKPDYESLTAKLSSSISPSTKVAIVDNTSSDEIASLYPKWLKAGINVITPNKKAYSGDLRLYEEILSASKESGARFLNESTVGAGLPVISTL
# KELVATGDKVSSNLIRFCALLDERKYI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g195
###
# start gene g196
Scaffold_6	AUGUSTUS	gene	910296	910661	0.88	-	.	g196
Scaffold_6	AUGUSTUS	transcript	910296	910661	0.88	-	.	g196.t1
Scaffold_6	AUGUSTUS	stop_codon	910296	910298	.	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_6	AUGUSTUS	CDS	910296	910661	0.88	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_6	AUGUSTUS	start_codon	910659	910661	.	-	0	transcript_id "g196.t1"; gene_id "g196";
# protein sequence = [MSGKGGKSGKTGGKASGDGSSKSQSRSAKAGLQFPVGRVHRLLKKGNYAQRVGAGAPGEFDLKSLRLQILISSSFFSV
# YLAAVLEYLAAEILELAGNAARDNKKQRIVPRHLQLAIRNDEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g196
###
# start gene g197
Scaffold_6	AUGUSTUS	gene	910996	911259	0.76	+	.	g197
Scaffold_6	AUGUSTUS	transcript	910996	911259	0.76	+	.	g197.t1
Scaffold_6	AUGUSTUS	start_codon	910996	910998	.	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_6	AUGUSTUS	CDS	910996	911259	0.76	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_6	AUGUSTUS	stop_codon	911257	911259	.	+	0	transcript_id "g197.t1"; gene_id "g197";
# protein sequence = [MAPKPASTAGKAPASTAGKAPAKTEGSKAAKKTSAKSSAGAADGEKKKRKKARKETYSSYIYKGSFSLLTGCEFIAHS
# ASSSETSAP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g197
###
# start gene g198
Scaffold_6	AUGUSTUS	gene	914130	915522	0.18	+	.	g198
Scaffold_6	AUGUSTUS	transcript	914130	915522	0.18	+	.	g198.t1
Scaffold_6	AUGUSTUS	start_codon	914130	914132	.	+	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_6	AUGUSTUS	CDS	914130	914820	0.19	+	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_6	AUGUSTUS	CDS	914898	915034	0.23	+	2	transcript_id "g198.t1"; gene_id "g198";
Scaffold_6	AUGUSTUS	CDS	915118	915522	0.35	+	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_6	AUGUSTUS	stop_codon	915520	915522	.	+	0	transcript_id "g198.t1"; gene_id "g198";
# protein sequence = [MIQASPSESDADLIQELHVRVDEISSSLDSSDAILVKTLIALLSHLHRLSILVNPSSPKPITSFWNAADSDESLNLFD
# ALKRQLSDFQLERSTSQQDVVPRGSKPVLTVEAALLWSKIDQELDTVVSMCKERTEYLSYDPPDYEYDTLPVYDHDSRSSMEDFDQPKLRAEVSSSSV
# IPGGQMSEKRKLDLEAVTMAIDRLYLVAPQLHNQRVELKSTKLAQMEKARRQVLKLINKASGRTLKDQSVILDGGMQARLEKVRQRDMAKVRLMRLIF
# YPDASLQIKIKDPDAMLSLPEFIREAVPVDSLKIQNPKALLTLPEFIKEVPPPHIISSRSTSALPTPAPAGGAFARLKSRSKNRDRSMSAPPLAWLRS
# SSSKSNLQESQSKSNEDASAPQREYLKYLVSSGNSHDK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g198
###
# start gene g199
Scaffold_6	AUGUSTUS	gene	922856	923185	0.39	+	.	g199
Scaffold_6	AUGUSTUS	transcript	922856	923185	0.39	+	.	g199.t1
Scaffold_6	AUGUSTUS	start_codon	922856	922858	.	+	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_6	AUGUSTUS	CDS	922856	923185	0.39	+	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_6	AUGUSTUS	stop_codon	923183	923185	.	+	0	transcript_id "g199.t1"; gene_id "g199";
# protein sequence = [MLGADYNAKDKKYEASEVVVKILYGPVDGKILGEVKALKDVGYFISSGLLPPYRKPAILMNKIDGAQIKSTEVWKKAN
# QSRREELLNQMKLLVKNEIVTWADEKRLLHV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g199
###
# start gene g200
Scaffold_6	AUGUSTUS	gene	925858	927089	0.33	+	.	g200
Scaffold_6	AUGUSTUS	transcript	925858	927089	0.33	+	.	g200.t1
Scaffold_6	AUGUSTUS	start_codon	925858	925860	.	+	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_6	AUGUSTUS	CDS	925858	925875	0.36	+	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_6	AUGUSTUS	CDS	926385	927089	0.39	+	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_6	AUGUSTUS	stop_codon	927087	927089	.	+	0	transcript_id "g200.t1"; gene_id "g200";
# protein sequence = [MESVVLDLFPTYIQTSKGFSSHDATVMTIIGNCGAIAGGGIAGYVSQHIGRRLTIIIFVLLVACFIPLWIIPSSFSGL
# AAGAFCIQFGVQGAWGVIPIQLAEMSPPAFRATFPGVAYQLGNMVSSASAQIESTGGDHLKTTIAVPVSSDYPDGRKTVPDYAKVQGILIGCVAAFVL
# VVTLFGPEKHGRQFEKHRAAFEEGGGDDDAEIGDVAPTPRDAEASGEKDSVDVKTHDHHEIEKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g200
###
# start gene g201
Scaffold_6	AUGUSTUS	gene	928774	929348	0.35	+	.	g201
Scaffold_6	AUGUSTUS	transcript	928774	929348	0.35	+	.	g201.t1
Scaffold_6	AUGUSTUS	start_codon	928774	928776	.	+	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_6	AUGUSTUS	CDS	928774	928886	0.35	+	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_6	AUGUSTUS	CDS	928949	929348	1	+	1	transcript_id "g201.t1"; gene_id "g201";
Scaffold_6	AUGUSTUS	stop_codon	929346	929348	.	+	0	transcript_id "g201.t1"; gene_id "g201";
# protein sequence = [MSTAHRPTWDPAQARDVKGGSRQVSVRDMPSHTKLKFRQIGQTSTSEVDKRDLRAELLAAEQEARNKKRKAEGLPLEV
# EDTPAPVADDETNKRRKLLQDAIELDKDDDEEEEEENEKETERKKGQDDNEDDNRCVPRRRILRFVNDQNHSDDDESDEEDDTAALLRELEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g201
###
# start gene g202
Scaffold_6	AUGUSTUS	gene	936009	936344	0.79	+	.	g202
Scaffold_6	AUGUSTUS	transcript	936009	936344	0.79	+	.	g202.t1
Scaffold_6	AUGUSTUS	start_codon	936009	936011	.	+	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_6	AUGUSTUS	CDS	936009	936344	0.79	+	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_6	AUGUSTUS	stop_codon	936342	936344	.	+	0	transcript_id "g202.t1"; gene_id "g202";
# protein sequence = [MSSSKATEVETKFSEKGPGKRPRAPSPLSQEEKQAKRAKAVARATAKRLKKQRGHIPEVCSPEDVRWTDIVSLLGQDV
# VDKAAEDGSEFNSPFLFKSEVELEVKAISSNGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g202
###
# start gene g203
Scaffold_6	AUGUSTUS	gene	938564	939442	0.9	+	.	g203
Scaffold_6	AUGUSTUS	transcript	938564	939442	0.9	+	.	g203.t1
Scaffold_6	AUGUSTUS	start_codon	938564	938566	.	+	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_6	AUGUSTUS	CDS	938564	939442	0.9	+	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_6	AUGUSTUS	stop_codon	939440	939442	.	+	0	transcript_id "g203.t1"; gene_id "g203";
# protein sequence = [MILEPWTKQQMNIVLLGETGVGKTELVNLIANVCAGATLENFDEKIELSNEAGHNGGSQTIQPHLYSITCVNGHKVNI
# LDTPGLAGDRGIHKDTEQMAAIVHAITENFDAIDAIVILACGHVPRLGLSTHYTMNALSNMLPKSLSDNVAFIFTMVSSTLMLSFDTNWLPQELRTTH
# TCSIDNSSKLWFKYQKRLREEPSLEEDLREEMNEISHRFERATKTLSQFFQYLDKRKVQPTQPVLELYNISVDIETRISNTIARASQAEDKRMRLQKL
# QVEFENQVSYFQDLLCKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g203
###
# start gene g204
Scaffold_6	AUGUSTUS	gene	939770	940129	0.86	+	.	g204
Scaffold_6	AUGUSTUS	transcript	939770	940129	0.86	+	.	g204.t1
Scaffold_6	AUGUSTUS	start_codon	939770	939772	.	+	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_6	AUGUSTUS	CDS	939770	940129	0.86	+	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_6	AUGUSTUS	stop_codon	940127	940129	.	+	0	transcript_id "g204.t1"; gene_id "g204";
# protein sequence = [MIDNESKWRYESAKTELQKIDIITEMIKKEMAQLEQEITDSMSGVTDTCEKYNKHSLSGNFMPYVFSAIGLLKLREQH
# EMNMGAGVEEMDRISKGIDYLEKKRKVLEQAVKGVNIHPST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g204
###
# start gene g205
Scaffold_6	AUGUSTUS	gene	943234	943742	0.85	+	.	g205
Scaffold_6	AUGUSTUS	transcript	943234	943742	0.85	+	.	g205.t1
Scaffold_6	AUGUSTUS	start_codon	943234	943236	.	+	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_6	AUGUSTUS	CDS	943234	943453	0.86	+	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_6	AUGUSTUS	CDS	943504	943742	0.89	+	2	transcript_id "g205.t1"; gene_id "g205";
Scaffold_6	AUGUSTUS	stop_codon	943740	943742	.	+	0	transcript_id "g205.t1"; gene_id "g205";
# protein sequence = [MLNLETAEILPILPLNQDFDAPNLPVEPFIIPTGEGDFLVVSWTGQSSMGIFLTGSGDPVRGTLTWTQHPTSICLDLP
# HATAILPDGTIEIHNIDSQNLVQVIPPPPNDGPVDRTRLVSSLLGYIVPSDQYLTKMSKVPVKLDRRPASELES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g205
###
# start gene g206
Scaffold_6	AUGUSTUS	gene	944164	945122	0.58	-	.	g206
Scaffold_6	AUGUSTUS	transcript	944164	945122	0.58	-	.	g206.t1
Scaffold_6	AUGUSTUS	stop_codon	944164	944166	.	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_6	AUGUSTUS	CDS	944164	944689	0.8	-	1	transcript_id "g206.t1"; gene_id "g206";
Scaffold_6	AUGUSTUS	CDS	944752	945122	0.72	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_6	AUGUSTUS	start_codon	945120	945122	.	-	0	transcript_id "g206.t1"; gene_id "g206";
# protein sequence = [MSSHRFPYTDTLKILQKWGPGCHFLGHGLDSDIDQLEKILEEESKLDPSKPPILALFTEFPSNPLLRSADLPRLRALA
# DQYDFLIVIDETIGNFINVEVLPFADIVVSSLTKVFSGSSNVMGGSLVLNPKGRHYTILRCHLDSNYEDTYFDQDAIFMERNSRDFQRRIKVIDINTE
# AICDFLYSRSQAAGVPNAVIKDVAYPKYTTPAHYAARRIKANAQTDAEQGGYGGLFSVTFTSSSASHAFFDALPCYKGPSLGTNFTLACPFTILAHYN
# ELDWAAQYGVDADLIRVSVWAGGY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g206
###
# start gene g207
Scaffold_6	AUGUSTUS	gene	947769	948611	0.81	-	.	g207
Scaffold_6	AUGUSTUS	transcript	947769	948611	0.81	-	.	g207.t1
Scaffold_6	AUGUSTUS	stop_codon	947769	947771	.	-	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_6	AUGUSTUS	CDS	947769	948611	0.81	-	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_6	AUGUSTUS	start_codon	948609	948611	.	-	0	transcript_id "g207.t1"; gene_id "g207";
# protein sequence = [MNGLSLGETRSSLDSERSNPASPIHVNGNGSAQAEPDESPDSIERLQRELQRTREEKEALATQYRNLLAKLTQMRTTL
# GNKLKQDAVCTFVSSVSPQLIICLVQEELDRREQLVQQLTAQNDDLNSTLETLKEELISASEESARTAAELDNMRNRAFQETTHESLLRERELRETQT
# ELEQCRLERDEWERVALQERAFSEDARSAAESITRDLELEKERRARELVELALQRERGDNLQSVLQDFQAGTSSSHFERINHLSVTLKQRNTSCGKLS
# KTMKRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g207
###
# start gene g208
Scaffold_6	AUGUSTUS	gene	949764	951242	0.88	+	.	g208
Scaffold_6	AUGUSTUS	transcript	949764	951242	0.88	+	.	g208.t1
Scaffold_6	AUGUSTUS	start_codon	949764	949766	.	+	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_6	AUGUSTUS	CDS	949764	951242	0.88	+	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_6	AUGUSTUS	stop_codon	951240	951242	.	+	0	transcript_id "g208.t1"; gene_id "g208";
# protein sequence = [MVKSLFGIDDFAFLSEDHFLLVEPNGLFDVYSFSDSISDPANPILRACYELPMLSPAYSFWYISLSSNPSPRFPGPTG
# EEKTYYCSPADRLHACCIYVHQSALPDRDTVYPFVFFFHPDTLLNPPSPRKPSSGNAEIDIYSTWQGPNAIEASSLSTLEYNSPVLSDLVSSSASSAP
# SSPQSGSSASSVSLDDTSHNLLNFSTPRAIHAGSSSMLFDASPSTSGRATPSSTQSRLPIPWEAWGPQNTRWFLEHLSKDWQRSIYGLRTADCVVDRA
# ALEGLLHRDGSRDLSGNSENRHGDSDSDNEGNGGDESDEDEDAFIFDEAVGDIESQLGCTSTLPKFLRVRDFNPYSISKALEEEEEIPGTQDPPLPRT
# PCSPSYDVQEIGGCSPDMIRDRGGYRRVVNGPTKVNVRGVFRENIVSCLPYVEVISKDTFNVNEIMMDDCRLLLIKVRLPVLFWAGVADLVLDIEERQ
# RTKIENHQCFDHVDLWHGGIKH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g208
###
# start gene g209
Scaffold_6	AUGUSTUS	gene	955748	956143	0.55	+	.	g209
Scaffold_6	AUGUSTUS	transcript	955748	956143	0.55	+	.	g209.t1
Scaffold_6	AUGUSTUS	start_codon	955748	955750	.	+	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_6	AUGUSTUS	CDS	955748	956143	0.55	+	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_6	AUGUSTUS	stop_codon	956141	956143	.	+	0	transcript_id "g209.t1"; gene_id "g209";
# protein sequence = [MLHVGVGNGGGEMAAASNAETEYIVPRLDRPHSMELDSNTQQEQCNEGTVAFHMVHVGMGDGGGEIHYTNKNARMTQG
# EDTRTLAPASISETEYIRLGDLDSPHAKDGKSAVLFWALQWKYTKVETVSGGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g209
###
# start gene g210
Scaffold_6	AUGUSTUS	gene	958194	958811	0.95	-	.	g210
Scaffold_6	AUGUSTUS	transcript	958194	958811	0.95	-	.	g210.t1
Scaffold_6	AUGUSTUS	stop_codon	958194	958196	.	-	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_6	AUGUSTUS	CDS	958194	958811	0.95	-	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_6	AUGUSTUS	start_codon	958809	958811	.	-	0	transcript_id "g210.t1"; gene_id "g210";
# protein sequence = [MIIEPWAKREINIVLLGEIATGKTALVNLIANMCAGSTLEDLEEKIELSNEAGNNGGSQTIQPHLYSITCVNGQKVNI
# LDTPGLADGRGMAKDIEHMKAIVDAIKKNFHTLDGIVIVESGYSYHLSPPLYSTLDNLSHLFPDSIANNIAFVFTVVGPPPEKPHFVTTSLREELQKA
# PQWSINNPLALWFKYQKKLAEGWSDEEHP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g210
###
# start gene g211
Scaffold_6	AUGUSTUS	gene	959714	960407	0.46	-	.	g211
Scaffold_6	AUGUSTUS	transcript	959714	960407	0.46	-	.	g211.t1
Scaffold_6	AUGUSTUS	stop_codon	959714	959716	.	-	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_6	AUGUSTUS	CDS	959714	959932	1	-	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_6	AUGUSTUS	CDS	960031	960127	0.69	-	1	transcript_id "g211.t1"; gene_id "g211";
Scaffold_6	AUGUSTUS	CDS	960238	960276	0.65	-	1	transcript_id "g211.t1"; gene_id "g211";
Scaffold_6	AUGUSTUS	CDS	960388	960407	0.81	-	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_6	AUGUSTUS	start_codon	960405	960407	.	-	0	transcript_id "g211.t1"; gene_id "g211";
# protein sequence = [METFSTCGPRTWVTDYLITAGDIALLSNRDLSTPQSSAQWSLHKLWSTGHEGDQVLVTGGEDGKICVWPGLSQGGLGG
# RGVVVEDESAMDVDSDLGNKRSRSRDMDWDAEDVDPNGKNGKRLKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g211
###
# start gene g212
Scaffold_6	AUGUSTUS	gene	964784	964984	0.3	+	.	g212
Scaffold_6	AUGUSTUS	transcript	964784	964984	0.3	+	.	g212.t1
Scaffold_6	AUGUSTUS	start_codon	964784	964786	.	+	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_6	AUGUSTUS	CDS	964784	964984	0.3	+	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_6	AUGUSTUS	stop_codon	964982	964984	.	+	0	transcript_id "g212.t1"; gene_id "g212";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGLHLTRLK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g212
###
# start gene g213
Scaffold_6	AUGUSTUS	gene	965089	965574	0.71	+	.	g213
Scaffold_6	AUGUSTUS	transcript	965089	965574	0.71	+	.	g213.t1
Scaffold_6	AUGUSTUS	start_codon	965089	965091	.	+	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_6	AUGUSTUS	CDS	965089	965574	0.71	+	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_6	AUGUSTUS	stop_codon	965572	965574	.	+	0	transcript_id "g213.t1"; gene_id "g213";
# protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLE
# TVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g213
###
# start gene g214
Scaffold_6	AUGUSTUS	gene	966034	966303	0.22	+	.	g214
Scaffold_6	AUGUSTUS	transcript	966034	966303	0.22	+	.	g214.t1
Scaffold_6	AUGUSTUS	start_codon	966034	966036	.	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_6	AUGUSTUS	CDS	966034	966303	0.22	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_6	AUGUSTUS	stop_codon	966301	966303	.	+	0	transcript_id "g214.t1"; gene_id "g214";
# protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR
# VFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g214
###
# start gene g215
Scaffold_6	AUGUSTUS	gene	966891	968925	0.06	+	.	g215
Scaffold_6	AUGUSTUS	transcript	966891	968925	0.06	+	.	g215.t1
Scaffold_6	AUGUSTUS	start_codon	966891	966893	.	+	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_6	AUGUSTUS	CDS	966891	967487	0.08	+	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_6	AUGUSTUS	CDS	967822	968925	0.41	+	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_6	AUGUSTUS	stop_codon	968923	968925	.	+	0	transcript_id "g215.t1"; gene_id "g215";
# protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIV
# ESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLN
# QTLGLARNIPFKFGEVTVYLQLHQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLN
# NDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTE
# SFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDK
# KVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGPLKMNSFHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g215
###
# start gene g216
Scaffold_6	AUGUSTUS	gene	969273	970754	0.63	+	.	g216
Scaffold_6	AUGUSTUS	transcript	969273	970754	0.63	+	.	g216.t1
Scaffold_6	AUGUSTUS	start_codon	969273	969275	.	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_6	AUGUSTUS	CDS	969273	970754	0.63	+	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_6	AUGUSTUS	stop_codon	970752	970754	.	+	0	transcript_id "g216.t1"; gene_id "g216";
# protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF
# VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN
# VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV
# YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP
# YQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGK
# YLSNPSDESWVKCQKMNGLNLLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g216
###
# start gene g217
Scaffold_6	AUGUSTUS	gene	971000	972112	0.44	+	.	g217
Scaffold_6	AUGUSTUS	transcript	971000	972112	0.44	+	.	g217.t1
Scaffold_6	AUGUSTUS	start_codon	971000	971002	.	+	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_6	AUGUSTUS	CDS	971000	972112	0.44	+	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_6	AUGUSTUS	stop_codon	972110	972112	.	+	0	transcript_id "g217.t1"; gene_id "g217";
# protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE
# VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI
# VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR
# RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g217
###
# start gene g218
Scaffold_6	AUGUSTUS	gene	972372	973046	0.77	-	.	g218
Scaffold_6	AUGUSTUS	transcript	972372	973046	0.77	-	.	g218.t1
Scaffold_6	AUGUSTUS	stop_codon	972372	972374	.	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_6	AUGUSTUS	CDS	972372	972611	1	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_6	AUGUSTUS	CDS	972879	973046	0.77	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_6	AUGUSTUS	start_codon	973044	973046	.	-	0	transcript_id "g218.t1"; gene_id "g218";
# protein sequence = [MFCIHDSFHVVESSQHSLSHTGSNKGSNKEEKSAVNDVLLVSARFIATLTVMFLLTVIADEACSILKSRQDSGSDSSA
# SDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g218
###
# start gene g219
Scaffold_6	AUGUSTUS	gene	974893	975237	0.53	-	.	g219
Scaffold_6	AUGUSTUS	transcript	974893	975237	0.53	-	.	g219.t1
Scaffold_6	AUGUSTUS	stop_codon	974893	974895	.	-	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_6	AUGUSTUS	CDS	974893	975237	0.53	-	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_6	AUGUSTUS	start_codon	975235	975237	.	-	0	transcript_id "g219.t1"; gene_id "g219";
# protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS
# SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g219
###
# start gene g220
Scaffold_6	AUGUSTUS	gene	976149	976851	0.35	-	.	g220
Scaffold_6	AUGUSTUS	transcript	976149	976851	0.35	-	.	g220.t1
Scaffold_6	AUGUSTUS	stop_codon	976149	976151	.	-	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_6	AUGUSTUS	CDS	976149	976585	0.78	-	2	transcript_id "g220.t1"; gene_id "g220";
Scaffold_6	AUGUSTUS	CDS	976644	976851	0.48	-	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_6	AUGUSTUS	start_codon	976849	976851	.	-	0	transcript_id "g220.t1"; gene_id "g220";
# protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS
# KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE
# DEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g220
###
# start gene g221
Scaffold_6	AUGUSTUS	gene	979712	980500	0.83	-	.	g221
Scaffold_6	AUGUSTUS	transcript	979712	980500	0.83	-	.	g221.t1
Scaffold_6	AUGUSTUS	stop_codon	979712	979714	.	-	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_6	AUGUSTUS	CDS	979712	980500	0.83	-	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_6	AUGUSTUS	start_codon	980498	980500	.	-	0	transcript_id "g221.t1"; gene_id "g221";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQIGRQNNRISPRAKLNLSSPPWASSQKVLEIGQLPICYTSVQRIPL
# SEETGYVLEGISQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRNASSPPYFRRSDNTLSFETSPKRIAPTLKEAIKRAIS
# VDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARNARTMFLVVELKAMLSRIAHTRRLPADTVDAGDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g221
###
# start gene g222
Scaffold_6	AUGUSTUS	gene	982184	982651	0.93	+	.	g222
Scaffold_6	AUGUSTUS	transcript	982184	982651	0.93	+	.	g222.t1
Scaffold_6	AUGUSTUS	start_codon	982184	982186	.	+	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_6	AUGUSTUS	CDS	982184	982651	0.93	+	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_6	AUGUSTUS	stop_codon	982649	982651	.	+	0	transcript_id "g222.t1"; gene_id "g222";
# protein sequence = [MSPESSNINHAVEANRDDSSSSATSTPFSVTSLLPSVSPEPEHQLNAEHEAELQPSLYHSYESIIADAQHFHRISSDV
# YGPQSSVFNALAGTPPHPASARGPNVEAIANAMWDRFIALANGDHSLEESTESQGVTLHNFTMEGLHSNLVLMSIIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g222
###
# start gene g223
Scaffold_6	AUGUSTUS	gene	986707	987626	0.43	+	.	g223
Scaffold_6	AUGUSTUS	transcript	986707	987626	0.43	+	.	g223.t1
Scaffold_6	AUGUSTUS	start_codon	986707	986709	.	+	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_6	AUGUSTUS	CDS	986707	986709	0.78	+	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_6	AUGUSTUS	CDS	986863	987228	0.7	+	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_6	AUGUSTUS	CDS	987288	987626	0.47	+	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_6	AUGUSTUS	stop_codon	987624	987626	.	+	0	transcript_id "g223.t1"; gene_id "g223";
# protein sequence = [MDLTRKRKSEASLNTKKGKKGRLSNIEPPAGWSGIDDLPTQLLTSMSAPVPRSNLMSSLSSTASLQTPGSSSSRVSLH
# TSVSMSPQIQRDRKLLERNELLERENQELKMSLRISKELEKDSHMASSMIESTYQEESGDSALSIDEDDTRRPQLQSPPPTPSILSNLSNEFMNRDMH
# HDEPLLPLTESESSSRDARVEEAGDDIIAMHGDKKPSIQVKSEPQTTAATPTHIQNISI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g223
###
# start gene g224
Scaffold_6	AUGUSTUS	gene	987956	988594	0.58	+	.	g224
Scaffold_6	AUGUSTUS	transcript	987956	988594	0.58	+	.	g224.t1
Scaffold_6	AUGUSTUS	start_codon	987956	987958	.	+	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_6	AUGUSTUS	CDS	987956	988594	0.58	+	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_6	AUGUSTUS	stop_codon	988592	988594	.	+	0	transcript_id "g224.t1"; gene_id "g224";
# protein sequence = [MRSSVNPILRGASSIPSQDDDDEIFEISPDQFRAAVKAGKKKAREDGTIADSSNVQPHTQNKVQIPVVKAEPANEFIA
# KSGKLMNDLVQSPEASLDDAPAAAMDVSGERSDDGCETLVIDPDAAADSEDFDFDLAYPENDHQSLPPSRDADIKMEDVDAEFVQETPDVNMGNAEME
# RDAPNDEEEENQEEGEEEQDLIANLGLTRMCLDSSV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g224
###
# start gene g225
Scaffold_6	AUGUSTUS	gene	989056	989952	0.78	-	.	g225
Scaffold_6	AUGUSTUS	transcript	989056	989952	0.78	-	.	g225.t1
Scaffold_6	AUGUSTUS	stop_codon	989056	989058	.	-	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_6	AUGUSTUS	CDS	989056	989952	0.78	-	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_6	AUGUSTUS	start_codon	989950	989952	.	-	0	transcript_id "g225.t1"; gene_id "g225";
# protein sequence = [MSYYKAPTIQHPYALSEPFYSRNSSPTTSAYSSQPSSPFFRNATADSSPIGYPQRPSMVPSRRFDPGQISRSNDAVGY
# GVRPQSLNSQLTRSASAQSAPPSMASSQIHAPLDLLPNPFQDPVSRTTTPSTISSGTRVPAGSPNVSLSFGSRGFPLPPSYNITSWSQHTNEYLKSYT
# SNQVQTPPSTPRSLMPGLPVEAKRSLPPVVVPQRPLSFGSIAASLHSTGLPSPPTAAARLLPHPRLEAHLELGLSKQILDQSRGVALKPVGTTPTSAK
# TFRSQLLPTDIPEWLASEHSKNYA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g225
###
# start gene g226
Scaffold_6	AUGUSTUS	gene	994220	997818	0.48	+	.	g226
Scaffold_6	AUGUSTUS	transcript	994220	997818	0.48	+	.	g226.t1
Scaffold_6	AUGUSTUS	start_codon	994220	994222	.	+	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_6	AUGUSTUS	CDS	994220	996425	0.57	+	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_6	AUGUSTUS	CDS	997304	997818	0.6	+	2	transcript_id "g226.t1"; gene_id "g226";
Scaffold_6	AUGUSTUS	stop_codon	997816	997818	.	+	0	transcript_id "g226.t1"; gene_id "g226";
# protein sequence = [MRSQNVLRRSRGLFRTKSPLSLYSSSIPPRLPRKSAAKRFLPPHEKRLVSTDNQTLGASASAPPPETPSEEPSDISDA
# SSTSLPDDLDKLKGKRRIVSSSSTSKERETVEIPEGLHILWNPDELPSEPLNPGSVPPPEILEEVLHNLLATLHPHTQHRAAYPPPLAQSEEPTLALY
# CPIEGGDYIIDSTVVELARRTGSEVLVLDAVQLAAGEWGYFGPGTSLLHELNLHLTNLQAASSLKLPRNPLHFASSGPSSNKSSSMSSYSEDFDEDEP
# EFSPPRQMMFTVMTPLRRGSSTTVIKSKRAAPPSKVKVFFDSLVNLPSNSTGPVSRPRIIYIRDFPTLASTASAWYPYLRDAVSQRRKGPMTRSSSPV
# PNPITIVFGMSPPLFPPPDRPMHPTGSGVLSLLMNRSASPMFPTSNPKPDKVDWSESPVAEQAREKRLQQRLKSWERGENVAMDEHDKYTEDPSDSAG
# RRRSDVIVLEGSIPSQSGFSMPVPSGSSGTVEDAEGPSFYRTSVLVPSVRSVSDERDYRVLRRREINELTMRMAIGQVGGKLSEESVSFKGGFSTTAN
# AQSTGETNKTELVPEPSSTDSHLQEINSSSSSPETLEQEPIPKRMWDDPKMWEAWGGQLESWSTVKDIAHRVIGGVVASREATKRPTLEHTNVSWSDV
# HYAWGAVHGALDYRKSWLKDSVPVARKLEDEPETEERAKLGYDQVIESVKNDPEIDPHEQRLLSSIVDADLCVSAALDAVKEDIKLPWQVSSSSDSLD
# SPATHDQVNTDSKAIEGEGTLEESKGEQVETSPPLEEMPQPSDVKSPHSNSSTHLRTLARRHFDKALKEITPSSSESLGSLADLRKWNEEFGEGRKDR
# KRKSVWGRGRFGFTDKEAHSLEEGRVVPSSPTIAVPSSDTSSSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g226
###
# start gene g227
Scaffold_6	AUGUSTUS	gene	998017	998376	0.92	-	.	g227
Scaffold_6	AUGUSTUS	transcript	998017	998376	0.92	-	.	g227.t1
Scaffold_6	AUGUSTUS	stop_codon	998017	998019	.	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_6	AUGUSTUS	CDS	998017	998376	0.92	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_6	AUGUSTUS	start_codon	998374	998376	.	-	0	transcript_id "g227.t1"; gene_id "g227";
# protein sequence = [MHYHCFKAYRRRKSACPVCSLDWPQNVTDDGLLPVGELAIRDGDDGIRQTRDTVDSDDDEEMENEPSQTETKSRQPQR
# SQAGKKGKSKNDDSEEEADEKDETDEEEAEATPPRRRSTRQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g227
###
# start gene g228
Scaffold_6	AUGUSTUS	gene	1003847	1006789	0.18	-	.	g228
Scaffold_6	AUGUSTUS	transcript	1003847	1006789	0.18	-	.	g228.t1
Scaffold_6	AUGUSTUS	stop_codon	1003847	1003849	.	-	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_6	AUGUSTUS	CDS	1003847	1006008	0.56	-	2	transcript_id "g228.t1"; gene_id "g228";
Scaffold_6	AUGUSTUS	CDS	1006079	1006393	0.47	-	2	transcript_id "g228.t1"; gene_id "g228";
Scaffold_6	AUGUSTUS	CDS	1006477	1006789	0.4	-	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_6	AUGUSTUS	start_codon	1006787	1006789	.	-	0	transcript_id "g228.t1"; gene_id "g228";
# protein sequence = [MEMSALGLSGTQALETSGQSSSYPVRTKVAELVYQEPQDIRATSSRHERTTKHRHAEQSAAGTSAPTGGRTRKASSAS
# QQAAPLVTATPSFGTNPTNSTNPSHGISSMGVVLNEIQDANSINHQNPESSPSLLFQGSQIANQTNEPPSMINSSPHPSIRFTPPTPIKRSPSVLERP
# VVNTNYLSSSNAHAHAPAYHGGTPKAVTRAPEVLQPTRETLQNQMKLSESSRPTVGQIVTSYESRPSPTPELLYSNPGPPTAELKTKSPLQDKAPTPL
# GTPQNLTGVEQSPGAAHDTSHNNSPSFNVALSSNRRGRTVSISASNEAASPMKNASIESSTGPFPPSTLPQTSLDTPSSKRSAQVSFTPITQPTPFVS
# SSPKHNAWTSDSQTLHNSASAHYRDDFRERPVTNQHATQNPISHAPNPILTTNPGFGNSNPWSAISQPKSTALAADELKDHSPHAETIDKSARIGVSK
# AAELSAWPAQTNGIHNSAHSGWNDRNARAVHASPVPNGPGWTLPAQPNTTNFIYPNGPMTNLSQGDRNVVDSSHVPGVVSFPETVGRQNSRSVTQANG
# SIPAPQQESGVKSPAVTNPQTSANLYLNPVDPIERPGSTAPFRHPKLAELMSDVTSPARRAPEPVIQPLGAEFLPAGHPPSVEKQDDWMLPPPSKFKD
# KPSPAADGFSKVYPSSPFNKDIHNDEYGLGNFRKYPDSSVTEIVAPSASKPTSSTMAYALFSNADAAKESGKNSNVTAHIRVSSQPESFATPSRPPST
# RPTQTWSSGPPIQSTTYQTNVPTSSRNRGRSKLPEPEAFLDPVQSRTAASSSHPSDQAYRRPASNVPSEESILKTPSSLAPSMLKPTASRTSIPASTI
# SQQDSRKKGLFGMFKSKSIFHSSNCGESVRSMESSDGIRRCPEEHCSDSCGRGKASGGEGVALEIVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g228
###
# start gene g229
Scaffold_6	AUGUSTUS	gene	1007699	1008736	0.27	-	.	g229
Scaffold_6	AUGUSTUS	transcript	1007699	1008736	0.27	-	.	g229.t1
Scaffold_6	AUGUSTUS	stop_codon	1007699	1007701	.	-	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_6	AUGUSTUS	CDS	1007699	1008736	0.27	-	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_6	AUGUSTUS	start_codon	1008734	1008736	.	-	0	transcript_id "g229.t1"; gene_id "g229";
# protein sequence = [MTISFPAPVNSTAPLLQSQRVGQAYPKSTVPGPSPSAINASYASHTATRSANLAKTYTSSTFNGIYPTASTSASVATA
# VVRPEMAKASSSYSKRDREPSDRHGDRTRDRSERERVRDRDYDRAKEKERTRDRSERDKGTVKERDLTKDRDRERERDIERTRKRERDRERDRDRDRD
# RDRDRDRDRIKPPAEPIPTAERGVRERDRQRDTDSIFRASVRDKDRTKYRERELPRTDDRTLAYDSGREKLVSKDADKYRESSRRHLDRDTERRPDVE
# RSSRHRMTERERDPARSFVNTQKLTSKESSDEAESSDASKNKYSSAYRRTKIKDPIPNISTSVSASFADLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g229
###
# start gene g230
Scaffold_6	AUGUSTUS	gene	1011372	1011959	0.4	+	.	g230
Scaffold_6	AUGUSTUS	transcript	1011372	1011959	0.4	+	.	g230.t1
Scaffold_6	AUGUSTUS	start_codon	1011372	1011374	.	+	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_6	AUGUSTUS	CDS	1011372	1011959	0.4	+	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_6	AUGUSTUS	stop_codon	1011957	1011959	.	+	0	transcript_id "g230.t1"; gene_id "g230";
# protein sequence = [MRNLYESFKDYVAVENMDGENKYQAEGFGLQDAKKGIIFESFPPVLHLQLKRFEYDIQRDAMVKINDRHEFPFEIDLG
# EFLDANADRSKPWKYRLTGVLVHSGDLHGGHYFALIKPDRDTRWLKFDDDRVTPVTDKEVLEENYGGEPLNGLPPTAQRNQVRAMKRFTNAYMLVYIR
# ESAMDEVWLRSLKKTHLPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g230
###
# start gene g231
Scaffold_6	AUGUSTUS	gene	1014660	1015473	0.25	-	.	g231
Scaffold_6	AUGUSTUS	transcript	1014660	1015473	0.25	-	.	g231.t1
Scaffold_6	AUGUSTUS	stop_codon	1014660	1014662	.	-	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_6	AUGUSTUS	CDS	1014660	1015009	0.31	-	2	transcript_id "g231.t1"; gene_id "g231";
Scaffold_6	AUGUSTUS	CDS	1015326	1015473	0.51	-	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_6	AUGUSTUS	start_codon	1015471	1015473	.	-	0	transcript_id "g231.t1"; gene_id "g231";
# protein sequence = [MQEKGDCARSRITQKHDNDVRGSRLKAQRLKIKTKKSKRAGFDVAGVSRHPPTPEVILKSALVRRAIADVLRVMRIRE
# DKPALQNLVQKGSVGDDLLNSLLAAEKEMEAEIIEVMNEANSFVEGWGPIIFPTANEMIANEKMRAIFEQTGDRRTELGVFLYGAVQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g231
###
# start gene g232
Scaffold_6	AUGUSTUS	gene	1017845	1018378	0.95	-	.	g232
Scaffold_6	AUGUSTUS	transcript	1017845	1018378	0.95	-	.	g232.t1
Scaffold_6	AUGUSTUS	stop_codon	1017845	1017847	.	-	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_6	AUGUSTUS	CDS	1017845	1018378	0.95	-	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_6	AUGUSTUS	start_codon	1018376	1018378	.	-	0	transcript_id "g232.t1"; gene_id "g232";
# protein sequence = [MKAAEKSPGGMGGPAPVSLQDSGPVSNMPPRSGPSPMPAANGPMPPRGTPIPGQDPGAQRPMMMPHSNSLPPGGRPGP
# PVGQGYPQNQPPPRGPYPPNQGPPGSGTPGFGPPGPMPPQGYGPGSGPQIQMRGGMPPPGPGYRGPPPPQGGPMPMQGHPRLRNRFLPSREHHDGSDV
# N]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g232
###
# start gene g233
Scaffold_6	AUGUSTUS	gene	1019647	1020084	0.93	+	.	g233
Scaffold_6	AUGUSTUS	transcript	1019647	1020084	0.93	+	.	g233.t1
Scaffold_6	AUGUSTUS	start_codon	1019647	1019649	.	+	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_6	AUGUSTUS	CDS	1019647	1020084	0.93	+	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_6	AUGUSTUS	stop_codon	1020082	1020084	.	+	0	transcript_id "g233.t1"; gene_id "g233";
# protein sequence = [MRAANTGPAEQKELAGQHVKKEQKANALAASAAANPPPPPNTSKPLPNPTISLNNASNHSSQPRSSSPASSQPSTPDR
# RHSGDASLSPPIVVVSPDNSAESSSSHSLLSERHASNLDSQGNATPPRNTYPQPPKSRTQGYHPYRW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g233
###
# start gene g234
Scaffold_6	AUGUSTUS	gene	1021510	1021785	0.72	+	.	g234
Scaffold_6	AUGUSTUS	transcript	1021510	1021785	0.72	+	.	g234.t1
Scaffold_6	AUGUSTUS	start_codon	1021510	1021512	.	+	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_6	AUGUSTUS	CDS	1021510	1021785	0.72	+	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_6	AUGUSTUS	stop_codon	1021783	1021785	.	+	0	transcript_id "g234.t1"; gene_id "g234";
# protein sequence = [MIYSEQQQAVSRFEAWQKMRQKAVENIGGKLPEGFVEIPYPSPPPPPSAEDVDILDLSMELNAASIDDVTGGLDEHGI
# ERVPMADPGLDVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g234
###
# start gene g235
Scaffold_6	AUGUSTUS	gene	1025557	1027049	0.31	-	.	g235
Scaffold_6	AUGUSTUS	transcript	1025557	1027049	0.31	-	.	g235.t1
Scaffold_6	AUGUSTUS	stop_codon	1025557	1025559	.	-	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_6	AUGUSTUS	CDS	1025557	1026129	0.99	-	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_6	AUGUSTUS	CDS	1026393	1026748	0.5	-	2	transcript_id "g235.t1"; gene_id "g235";
Scaffold_6	AUGUSTUS	CDS	1026977	1027049	0.98	-	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_6	AUGUSTUS	start_codon	1027047	1027049	.	-	0	transcript_id "g235.t1"; gene_id "g235";
# protein sequence = [MSSVYNEPTAAAIAYGLDKKVSGEHLSSNPRAVRRLRTACERAKRTLSSAAQTSIEMIPCMRVLTSTLPLHVPVSRNS
# ARPFRSTLDPVEKVLRDSKIDKANVHEIVLVGGSTRIPRIVKLVSDFFNGKEPNKSINPMRLLPTLSGIPPAPRGVPQIEVTFDIDANGILNVSAADK
# STGKSNRIVITNDKGVLRRKRLNAWFRGEKYKAEDEAATARITAKNGLESYSYNLRNSLTDEKLADKFSPEDKAKLTTHVDETIKWLDESQEASKEEY
# EEKQKELEAIANPIMQKLYGAAGGPDAGGFPGAGGFPGGAPGGFPGAGAEEGPSVEEVD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g235
###
# start gene g236
Scaffold_6	AUGUSTUS	gene	1042804	1043578	0.22	+	.	g236
Scaffold_6	AUGUSTUS	transcript	1042804	1043578	0.22	+	.	g236.t1
Scaffold_6	AUGUSTUS	start_codon	1042804	1042806	.	+	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_6	AUGUSTUS	CDS	1042804	1042932	0.39	+	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_6	AUGUSTUS	CDS	1043117	1043436	0.77	+	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_6	AUGUSTUS	CDS	1043548	1043578	0.49	+	1	transcript_id "g236.t1"; gene_id "g236";
Scaffold_6	AUGUSTUS	stop_codon	1043576	1043578	.	+	0	transcript_id "g236.t1"; gene_id "g236";
# protein sequence = [MSSWLLQVPGVKEDISSIMKENDSWNVMHQPLRILLLVTLYPVYVIYFHIPSFSHLDLVGGIPTKFTGEVITVNEKGQ
# DQVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKETLTPGKPHKVIPDEAGMESIEFLDKISLMLPFSGMV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g236
###
# start gene g237
Scaffold_6	AUGUSTUS	gene	1048983	1049483	0.88	-	.	g237
Scaffold_6	AUGUSTUS	transcript	1048983	1049483	0.88	-	.	g237.t1
Scaffold_6	AUGUSTUS	stop_codon	1048983	1048985	.	-	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_6	AUGUSTUS	CDS	1048983	1049483	0.88	-	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_6	AUGUSTUS	start_codon	1049481	1049483	.	-	0	transcript_id "g237.t1"; gene_id "g237";
# protein sequence = [MLTKIDKQLEEYDSRVGSSLQMISQDAQGRIPVQDLQKALAVIKHRPDDEVGQAVIQKLDVDKDGFVELEHVLGLVQE
# EGLGAVSEPFRTYRIPIDSRIGIVLDDDAQSSSGRAAKSKTQSHGRRILCKKTSALMLKAKEHVCIDMSPRKYVRTITIHRGSSRQNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g237
###
# start gene g238
Scaffold_6	AUGUSTUS	gene	1049544	1050342	0.62	-	.	g238
Scaffold_6	AUGUSTUS	transcript	1049544	1050342	0.62	-	.	g238.t1
Scaffold_6	AUGUSTUS	stop_codon	1049544	1049546	.	-	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_6	AUGUSTUS	CDS	1049544	1049747	0.86	-	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_6	AUGUSTUS	CDS	1049803	1049984	0.72	-	2	transcript_id "g238.t1"; gene_id "g238";
Scaffold_6	AUGUSTUS	CDS	1050078	1050342	0.76	-	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_6	AUGUSTUS	start_codon	1050340	1050342	.	-	0	transcript_id "g238.t1"; gene_id "g238";
# protein sequence = [MISLLTQKVSTLFPRPNYKARVNLAAFRTSGVSPARLREELSTWINLHLHNRVSGVLLVLGRAFNFDRKTGEDEDGKT
# NVIKSLESVLKLEVDSDKASYKQKLEVLQQQEELIEDEEEQEQKEEDARRAKREAEEREAQTAQALLPDTELVPESVKAEGDDARMTTEQLKELGEAL
# SVLSTRSSVLKERSDLRALMDENLQAEEVSPILHHSKYIV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g238
###
# start gene g239
Scaffold_6	AUGUSTUS	gene	1051559	1051915	0.67	+	.	g239
Scaffold_6	AUGUSTUS	transcript	1051559	1051915	0.67	+	.	g239.t1
Scaffold_6	AUGUSTUS	start_codon	1051559	1051561	.	+	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_6	AUGUSTUS	CDS	1051559	1051915	0.67	+	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_6	AUGUSTUS	stop_codon	1051913	1051915	.	+	0	transcript_id "g239.t1"; gene_id "g239";
# protein sequence = [MNDSSSQAYKKARRQYLKTTRNRDPNIDKAWTPFRAAEKHFKARFPPPDFAKVLDLATLDASRAPEVAAGIWAGKSDA
# VETRTFVTKSGIKGYDFPSMPGKSLHTYKSAWILYTYPQD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g239
###
# start gene g240
Scaffold_6	AUGUSTUS	gene	1056579	1057804	0.51	+	.	g240
Scaffold_6	AUGUSTUS	transcript	1056579	1057804	0.51	+	.	g240.t1
Scaffold_6	AUGUSTUS	start_codon	1056579	1056581	.	+	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_6	AUGUSTUS	CDS	1056579	1056728	0.81	+	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_6	AUGUSTUS	CDS	1056780	1056910	0.84	+	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_6	AUGUSTUS	CDS	1057153	1057804	0.68	+	1	transcript_id "g240.t1"; gene_id "g240";
Scaffold_6	AUGUSTUS	stop_codon	1057802	1057804	.	+	0	transcript_id "g240.t1"; gene_id "g240";
# protein sequence = [MVEIKRTDPPQPSANEDSKYRLLYTKSKVYVNPTAYARDNIPGFISLVKRDAPNPSYYLAWIPETLLNERGATEWDKF
# VKVEEKADLDDEDNGYGTTLPTLYFHDNESHSFTMPLPKSPQSHTGSSITAYPPPPSLSSPINSSSSWGGEDFIARLKCYAHVLRSNLQPSLFLVDPS
# RSDIETHSTQIFDDDAVDDILAQSSYANSHSPVPAHRKPRPLSSPPPTSSLSPNPYSHRSSVLHRSLGSMSSNAQSSSQARMALLQSFSNITRATRHA
# AQNILSHPLAKPIVPHLPDPVKSLVNVNGDLKGELG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g240
###
# start gene g241
Scaffold_6	AUGUSTUS	gene	1068652	1069725	0.58	-	.	g241
Scaffold_6	AUGUSTUS	transcript	1068652	1069725	0.58	-	.	g241.t1
Scaffold_6	AUGUSTUS	stop_codon	1068652	1068654	.	-	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_6	AUGUSTUS	CDS	1068652	1069725	0.58	-	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_6	AUGUSTUS	start_codon	1069723	1069725	.	-	0	transcript_id "g241.t1"; gene_id "g241";
# protein sequence = [MSTEEVELIEAIIERAGPTATTFLTVFKAYNDILLERGLDPHEVVYYGKLLKLGTLKGSSWKEKWDAIKVQNGYGTAL
# QDFLVPSKVVVASKHPQVRSGIIVNSRPGPSTILSDDLFSSGLRKSQVSDTEDGSVVDEPPFSKVFSSRKDPSPSDLTNNSLGLELDEGIQRPFSIPV
# SSHAPFRRTARPLDHDTVEPITSTPPSHRVVTRGLPTRSKSPIFSETLSMKSESLPLAPRRRNSAINDEDAWKKVAMIQDEREADRFRKDRLIERCFN
# VWRQGFRWIIVRCIFIYPMLVYYASDIRPQTSKSTMPETIYSFENCFNAGINELLSITTCMYELTHLLRDVVNARFSGSGNNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g241
###
# start gene g242
Scaffold_6	AUGUSTUS	gene	1070097	1071821	0.34	-	.	g242
Scaffold_6	AUGUSTUS	transcript	1070097	1071821	0.34	-	.	g242.t1
Scaffold_6	AUGUSTUS	stop_codon	1070097	1070099	.	-	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_6	AUGUSTUS	CDS	1070097	1070967	0.7	-	1	transcript_id "g242.t1"; gene_id "g242";
Scaffold_6	AUGUSTUS	CDS	1071259	1071821	0.37	-	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_6	AUGUSTUS	start_codon	1071819	1071821	.	-	0	transcript_id "g242.t1"; gene_id "g242";
# protein sequence = [MDNNIRHFGMLVAEVAAQRAGRNLDFRDWDGDDSGKLWARNLRALLVVRDADADARALNEEDNLYNVISSGTAQAENS
# EPKKKSAITIKSDEYDSDNSITGYDSTPSSRSNSPTPSELEEIEKDPSLNVGQKKIPRPIYLAQLGAMLRSMGGMAKDNPSEDADRIEVALNHAEELI
# RKKKDYGTELGSLGCSRVGLSTYSNYCLSSDSTSFPSKRLPGPLHRKYLPSSATLPQILSGITRQAIDRGKEATEDKVPEIVRERRFRVQRTKRISEV
# DSSTLTARNSPHKQTTFNEVAADYFVAPLINRFWLFLRDEQTREARTAYHEGRTKYHGAGTGLILNSLVMTHFLRTLTVLVHASENTPEWLGFLAPDS
# LELALTLGTKPISIADSSTEDTGTAEKGTKEASVLASALELVLIVLDGCIQLDGGRSLSLDQATLLMSVSEWASVVFSRLEDGIKLKDGEESKVPILD
# VRLPELS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g242
###
# start gene g243
Scaffold_6	AUGUSTUS	gene	1073446	1074287	0.46	+	.	g243
Scaffold_6	AUGUSTUS	transcript	1073446	1074287	0.46	+	.	g243.t1
Scaffold_6	AUGUSTUS	start_codon	1073446	1073448	.	+	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_6	AUGUSTUS	CDS	1073446	1073940	0.64	+	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_6	AUGUSTUS	CDS	1074003	1074287	0.54	+	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_6	AUGUSTUS	stop_codon	1074285	1074287	.	+	0	transcript_id "g243.t1"; gene_id "g243";
# protein sequence = [MSLLPNRPRARSSSARPQSTTSKEKTKSNLASTPPDVIELTDSSDEDCVTTKKSSRDVTRSGHTLPRTQSTPKPLGAS
# ASAENIPSSSAQRESKTKMFPHFLPSDEENVPPSRNSNLPSIIEDFVVVDLVPLKHLEGDHVEKNQLMEMQAEKNAQLSMLSQVLELGEVLEAVIHAL
# FENPAYPKIDKKGKRKSTEQHHDEGGHKKPRLDEPDYSRLDREYKGGVHYSDLSIVSSVVLSFRAFNDSVVLGASHGRFSGYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g243
###
# start gene g244
Scaffold_6	AUGUSTUS	gene	1078556	1081067	0.16	-	.	g244
Scaffold_6	AUGUSTUS	transcript	1078556	1081067	0.16	-	.	g244.t1
Scaffold_6	AUGUSTUS	stop_codon	1078556	1078558	.	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_6	AUGUSTUS	CDS	1078556	1078784	0.99	-	1	transcript_id "g244.t1"; gene_id "g244";
Scaffold_6	AUGUSTUS	CDS	1079116	1079426	0.8	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_6	AUGUSTUS	CDS	1080819	1081067	0.26	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_6	AUGUSTUS	start_codon	1081065	1081067	.	-	0	transcript_id "g244.t1"; gene_id "g244";
# protein sequence = [MTFSQLISKGRNVSEYFAQVVKNVASQNLEIRKLVYVYVLRYAEQEPDLALLSINTFQKDLNDSNPFIRAMALRVLSG
# IRVPMDVLVKLQIITLAAKLSVLNPAEQTLGLIARYIFSLARYDLNYDVRDRARVLSSLLTGVGSPVLTPDDGITPFEERGGVVLRSEQAKVVLFNGK
# TNVTDDEHAGTEDVGSDNEASSEYDNDDSDEEYEDHIEGEEEDEEDEHDQQEGQSDEGNDEEEGNDDDRNSEENLKNNETGYEAFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g244
###
# start gene g245
Scaffold_6	AUGUSTUS	gene	1083417	1083806	0.38	-	.	g245
Scaffold_6	AUGUSTUS	transcript	1083417	1083806	0.38	-	.	g245.t1
Scaffold_6	AUGUSTUS	stop_codon	1083417	1083419	.	-	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_6	AUGUSTUS	CDS	1083417	1083806	0.38	-	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_6	AUGUSTUS	start_codon	1083804	1083806	.	-	0	transcript_id "g245.t1"; gene_id "g245";
# protein sequence = [MRNEVPDAQHLKSTLRWITAQPDKRRIRSGFRYGNGSIMVSQWAKFEMYEGTDFEDGQKPILVSTPFTSISLVDGLAY
# TLPTEMQGKTGGDKRAIDVNLALSSPIWEILEHDEQLKRFSSSWAGDSAQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g245
###
# start gene g246
Scaffold_6	AUGUSTUS	gene	1089659	1090666	0.16	+	.	g246
Scaffold_6	AUGUSTUS	transcript	1089659	1090666	0.16	+	.	g246.t1
Scaffold_6	AUGUSTUS	start_codon	1089659	1089661	.	+	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_6	AUGUSTUS	CDS	1089659	1089885	0.81	+	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_6	AUGUSTUS	CDS	1089961	1089997	0.32	+	1	transcript_id "g246.t1"; gene_id "g246";
Scaffold_6	AUGUSTUS	CDS	1090355	1090666	0.23	+	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_6	AUGUSTUS	stop_codon	1090664	1090666	.	+	0	transcript_id "g246.t1"; gene_id "g246";
# protein sequence = [MSASVSPTKSNPTSPAKSTGKPASSAAAKPASKASGPKRAVTTKKVSATRKATTSNKPKVAATKSKAISNSAPKPSNA
# SFFTRTRPARNAKPPSKTSGAKAPAKKAAVKKTSAPVSKKVVTKPTTTKLIAKKATAKPAAKKVLAGKPKAISTTKKTATATKRASAKKAATGTTAVS
# KAKVKSNITIGITQC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g246
###
# start gene g247
Scaffold_6	AUGUSTUS	gene	1092862	1094004	0.46	+	.	g247
Scaffold_6	AUGUSTUS	transcript	1092862	1094004	0.46	+	.	g247.t1
Scaffold_6	AUGUSTUS	start_codon	1092862	1092864	.	+	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_6	AUGUSTUS	CDS	1092862	1094004	0.46	+	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_6	AUGUSTUS	stop_codon	1094002	1094004	.	+	0	transcript_id "g247.t1"; gene_id "g247";
# protein sequence = [MEAALAKSPQESPVSYRRSPSVPYSVASIASPPPESDNEEEDSGSDDDNDNGSSTGREIDISMDVDDTSVDEEILPED
# LDDDEAQFSDEWDDDNDEEVSTTWESPGPRSPSAQPPAFRVKEEPRDVQGLLDQWEYDLDLKEPLVKSEDASLPTWDWDWESGYHSYIAPSSSPSNNS
# SASMSPIQSRIKQEDEFDLSLSFSGPAFTNWRQSATLSPTTPFGFTFGDESDVFPISPSAFPISPASPTPDYRTLRPRARTVPSLSLGGFLPGQTPET
# PSRPTDPPITHSLSSLVHSFSLNPLDDCSPLTTFVFDRLSSEPEETESASELSTAKEQPPPCISPNDIRIGLNAPESVVVNTCEPCLPQIVATHVEGM
# FVFSYTKI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g247
###
# start gene g248
Scaffold_6	AUGUSTUS	gene	1096748	1097653	0.91	-	.	g248
Scaffold_6	AUGUSTUS	transcript	1096748	1097653	0.91	-	.	g248.t1
Scaffold_6	AUGUSTUS	stop_codon	1096748	1096750	.	-	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_6	AUGUSTUS	CDS	1096748	1097653	0.91	-	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_6	AUGUSTUS	start_codon	1097651	1097653	.	-	0	transcript_id "g248.t1"; gene_id "g248";
# protein sequence = [MSYNHPKGYILTNAVSHTRFIPFLYTFKYTTIAVFVEISALEENKLDTPLLFGYNKRWRSLCSLSSDGYLLPSSGIGK
# MGFRDKVGALLQQGGCGDVLDGTSEIWMLSMPSYLGFEGINPLTVYLIYSIATPSSVFRSEDERGNRELRLVLFEVHNTFGEGHVYFMRPGIEEDSSF
# KRMYDHQWTFPRAFHVSPFNDRKGWYTVSIKLPQFPDADRGIEGNPKPVISIQLREPNIEADQSEMPGQTKLIATLRATNALPLPSARNLLFTLVSYP
# LELFMSMPRILYQAGILHYRRGMKNLI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g248
###
# start gene g249
Scaffold_6	AUGUSTUS	gene	1098081	1099638	0.56	+	.	g249
Scaffold_6	AUGUSTUS	transcript	1098081	1099638	0.56	+	.	g249.t1
Scaffold_6	AUGUSTUS	start_codon	1098081	1098083	.	+	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_6	AUGUSTUS	CDS	1098081	1098845	0.83	+	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_6	AUGUSTUS	CDS	1098937	1099638	0.58	+	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_6	AUGUSTUS	stop_codon	1099636	1099638	.	+	0	transcript_id "g249.t1"; gene_id "g249";
# protein sequence = [MSLSTSDNNGSYTRVPPSGKTPPPAPSAAFAKRFAIFLFFCQVQSFDFASRARELQAEQTINARYRPPALRAIASGGS
# PPNDASPTVTTPGDGSTLPPTNYPAGFRRARAGTLPSNVQLAAQRFAAASSTLGSTPASTESLLEQSQRPSVTPSANLAPSRPNLRHSNTAVTSSASV
# NRLRSESLTLPAAGLSNNPFSHSLFSSSWLSGNGSGNGYPVLEEMRSMTSAEVDDFDVHTLDYLGLDDTIRPQLPSPSFAFHCGLAFFSSPPAEEEEY
# DAYDDQAFSRQRLSTYETSSSDNYSPASYVAKGFKQSGDLLSAPTRPRAISVGNLEEPTRTFQRRATVVDAHPYINELTQQSSGMSVMSNNLGTPGIL
# QSSDKLGSVRGGTSVHFPNGETPSRASAYLLAPGATNRSLSPKSEGPSSQIQTPTRSLWIGNLDNAVTSEQLIHVFAPYGAIESLRLLPEKVSFVNQI
# FNWNESHNISGVWIRQLC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g249
###
# start gene g250
Scaffold_6	AUGUSTUS	gene	1101105	1102316	0.54	+	.	g250
Scaffold_6	AUGUSTUS	transcript	1101105	1102316	0.54	+	.	g250.t1
Scaffold_6	AUGUSTUS	start_codon	1101105	1101107	.	+	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_6	AUGUSTUS	CDS	1101105	1102316	0.54	+	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_6	AUGUSTUS	stop_codon	1102314	1102316	.	+	0	transcript_id "g250.t1"; gene_id "g250";
# protein sequence = [MWEVAQGRFGARSMRACLESPHITLSQQRRIATAVILNSIPLATNPNGALLLTWLLDTSGFPSRYNLLAPRFTPHLSH
# LCTHKLASLTVLRIVNQKIEPEASRQIVEALFASSGDHVLTDVLGDQVNGVAVVHKILTSPFLDPMDKAVYMEATKRVLIELKVIATQAYRRLIEEVG
# LPIPNYQPTYTNSVPVSGKGKNSQNSYVPGLPQGYPSNDQGLASMMAALQMGGQNPQAGPPQLHIDPAYEVAGGRPQANPQNVYNPGNDHYNSYGMRQ
# PEMTSPRGSIRRTGSLPAAGTNPQNGQYSTQNGQYGAQSPSLTQGGTMLQYGGMPAQNIPAHLYQTPQYMYYAQNSPNMGPSLERRKIDITTKFTNVI
# PFSSRPLSITFLPPLSIRLQTVCTWFGLFVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g250
###
# start gene g251
Scaffold_6	AUGUSTUS	gene	1103501	1104918	0.22	+	.	g251
Scaffold_6	AUGUSTUS	transcript	1103501	1104918	0.22	+	.	g251.t1
Scaffold_6	AUGUSTUS	start_codon	1103501	1103503	.	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_6	AUGUSTUS	CDS	1103501	1103729	0.23	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_6	AUGUSTUS	CDS	1103816	1104024	0.33	+	2	transcript_id "g251.t1"; gene_id "g251";
Scaffold_6	AUGUSTUS	CDS	1104152	1104258	0.81	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_6	AUGUSTUS	CDS	1104345	1104918	0.82	+	1	transcript_id "g251.t1"; gene_id "g251";
Scaffold_6	AUGUSTUS	stop_codon	1104916	1104918	.	+	0	transcript_id "g251.t1"; gene_id "g251";
# protein sequence = [MFKLRPLGSARRPSSSTATSLKNWRTQSRQRLAVTSAVVVVSVLAYSGLKHTVIQNDSLPPASFKHEYSTEQPKGPHL
# TSCFSSQKLLPDNSKSEVIQSPTTAKWLDNVALRDLALHKEYAACVDARGDVYQWGQGGQPSPVLKGQTRCHGPNKTRSHGHNYLGGKLGGYGAEKSS
# VLPKRLFISISAGTDHLLGLTSSGRAFAHPITNSANAYGQLGFRKFDMSSPDSKERIPVELVPRSVADPYAKASPFRRRDSQSGVTSEKTNTAVTLPF
# CPSIFEIPSLQSIKVSQLVAGGRSSFALTATGRVLGWGANEYGYAHIRFRCRHWLMLEFSQIGLGDNITLDTITVPTEVILWRMAQGTQTKCVNVTAG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g251
###
# start gene g252
Scaffold_6	AUGUSTUS	gene	1107197	1107936	0.29	-	.	g252
Scaffold_6	AUGUSTUS	transcript	1107197	1107936	0.29	-	.	g252.t1
Scaffold_6	AUGUSTUS	stop_codon	1107197	1107199	.	-	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_6	AUGUSTUS	CDS	1107197	1107302	0.85	-	1	transcript_id "g252.t1"; gene_id "g252";
Scaffold_6	AUGUSTUS	CDS	1107355	1107499	0.67	-	2	transcript_id "g252.t1"; gene_id "g252";
Scaffold_6	AUGUSTUS	CDS	1107591	1107789	0.48	-	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_6	AUGUSTUS	CDS	1107934	1107936	0.3	-	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_6	AUGUSTUS	start_codon	1107934	1107936	.	-	0	transcript_id "g252.t1"; gene_id "g252";
# protein sequence = [MYLSTVQMAPLQNTVLYSANSYPNFYWTEERNTTEWNVFMSEMTRAGNKLQELMLEALVPSLKDAHLANPATYLNGTA
# ALNITGCAHSCVYQLNESTADTGICTIANGTDRDSFLWYDELHPSEQTERNIAREIAEVIEGKQNQWTRWLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g252
###
# start gene g253
Scaffold_6	AUGUSTUS	gene	1110398	1111515	0.53	+	.	g253
Scaffold_6	AUGUSTUS	transcript	1110398	1111515	0.53	+	.	g253.t1
Scaffold_6	AUGUSTUS	start_codon	1110398	1110400	.	+	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_6	AUGUSTUS	CDS	1110398	1111007	0.55	+	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_6	AUGUSTUS	CDS	1111049	1111515	0.54	+	2	transcript_id "g253.t1"; gene_id "g253";
Scaffold_6	AUGUSTUS	stop_codon	1111513	1111515	.	+	0	transcript_id "g253.t1"; gene_id "g253";
# protein sequence = [MSRRGTTPNPLPLGSFSSHFAQLTSQSQPVQKQSQARPNTLAPRASPLARSPSGLNSANVLSVEEWETKAPLNDLQIR
# SVAAVKKASEIKRVPDKVRYIYRLRVIFQFDSLVPPSLILLVMKKIPRLVPLLRSQKGSYHPPSHQERQVPARDLEHRLALGQLAINFIPNPLHTPQQ
# FYDWHALISRSVTHAQESIFAHISIQFHQVEDEITSMHFQWQGVEDGGRSLKESSEGLLIERDSLLKLESELGERLDYFKELEYATRMLNASVLEGSA
# GKGGRPLVMEFEFLDMVERVVICIQWLEAHRHYREAEIYLLRFHQCLTRAMTLIKMYFVGSLRAVQADVARRFGDKVCSSTNLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g253
###
# start gene g254
Scaffold_6	AUGUSTUS	gene	1112151	1113995	0.12	+	.	g254
Scaffold_6	AUGUSTUS	transcript	1112151	1113995	0.12	+	.	g254.t1
Scaffold_6	AUGUSTUS	start_codon	1112151	1112153	.	+	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_6	AUGUSTUS	CDS	1112151	1112466	0.7	+	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_6	AUGUSTUS	CDS	1112520	1112683	0.94	+	2	transcript_id "g254.t1"; gene_id "g254";
Scaffold_6	AUGUSTUS	CDS	1112733	1113096	0.47	+	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_6	AUGUSTUS	CDS	1113146	1113289	0.42	+	2	transcript_id "g254.t1"; gene_id "g254";
Scaffold_6	AUGUSTUS	CDS	1113334	1113995	0.99	+	2	transcript_id "g254.t1"; gene_id "g254";
Scaffold_6	AUGUSTUS	stop_codon	1113993	1113995	.	+	0	transcript_id "g254.t1"; gene_id "g254";
# protein sequence = [MILDVRVDDDGESENDSADVEEKLGLDLNLDPTLRTPDPNSSALGHLKPRLHIAQLLQMILQDAQTRLFFKAQAIVQS
# DIRHYVAKDDDLAYPARLLNAVGLSDSLLRDRANEKESFSQMWSTQLGSDKDHGASLDNQQTWFPTLRKTILVLEQLHEFVNPAIFEDIAEEAIVLCQ
# SSLVAASENIVNSASSSSNRLAPLSETANTASLTSEPIARSTLLDGYLFLVRHLLILREVPVRFGLITESTDNSANTNAARTTDWGALSGPGPQKVGV
# GTSNSVTDTLASIFGGGSAASLLATLGVLPSDFGDAVAGRPDSKRTIDNAKRVIVFDQSVSSISMREHYCTCTNEVCEPLRMWVERVGAFSATSVSSK
# GDFHTSPSATMNISVSSSNQSVGSKDVKGMPDWASPASASEVDHNFKMACEEKLLLAVRKIRLYLGGVETGEEENKNLNNINGNIHDGEKRPVSSPNT
# SARALSNVIVQHVQERIGEEYAWFRDVMWGMSTDAGTSDKTGVSALYTEEQVKELQELRERILDQRTLKAMLKGITEGQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g254
###
# start gene g255
Scaffold_6	AUGUSTUS	gene	1114938	1115461	0.85	-	.	g255
Scaffold_6	AUGUSTUS	transcript	1114938	1115461	0.85	-	.	g255.t1
Scaffold_6	AUGUSTUS	stop_codon	1114938	1114940	.	-	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_6	AUGUSTUS	CDS	1114938	1115358	1	-	1	transcript_id "g255.t1"; gene_id "g255";
Scaffold_6	AUGUSTUS	CDS	1115442	1115461	0.85	-	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_6	AUGUSTUS	start_codon	1115459	1115461	.	-	0	transcript_id "g255.t1"; gene_id "g255";
# protein sequence = [MQADTMEDIPSSDYAAPAAIIPAKFRTTCSRLFNVPAVAEGAALEEAAEEELAKDELVEKKLELELNEEDDEDEDDED
# HDEEDEDQELDVLEGVQVVVGVVEVGVAVVESGVQVDEGVYTLVEVGVYTEDEEEESPLLPSLNDQVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g255
###
# start gene g256
Scaffold_6	AUGUSTUS	gene	1119101	1119547	1	-	.	g256
Scaffold_6	AUGUSTUS	transcript	1119101	1119547	1	-	.	g256.t1
Scaffold_6	AUGUSTUS	stop_codon	1119101	1119103	.	-	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_6	AUGUSTUS	CDS	1119101	1119547	1	-	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_6	AUGUSTUS	start_codon	1119545	1119547	.	-	0	transcript_id "g256.t1"; gene_id "g256";
# protein sequence = [MTAASSISKTPDGTTAVGVADVVLVVAVLEVENDNNDEDEDVNVDVNEDVDEDVDGEVEDNKVDELLRVLVEVGVQVL
# VEDVDGGGDQVEVGGVYVEVGVAEVEVAPESKFQDPVRTPSSSEAKYWNRPSEKSRPPYGHPGHCVEAET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g256
###
# start gene g257
Scaffold_6	AUGUSTUS	gene	1120677	1121616	0.28	-	.	g257
Scaffold_6	AUGUSTUS	transcript	1120677	1121616	0.28	-	.	g257.t1
Scaffold_6	AUGUSTUS	stop_codon	1120677	1120679	.	-	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_6	AUGUSTUS	CDS	1120677	1120964	0.94	-	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_6	AUGUSTUS	CDS	1121110	1121616	0.28	-	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_6	AUGUSTUS	start_codon	1121614	1121616	.	-	0	transcript_id "g257.t1"; gene_id "g257";
# protein sequence = [MSVLVKSDQVGSLFVKGAPESVLERCTSILVDGKIIPFTPEIKESLLQTTVTYGGHGLRNLALAYRDVQDTDAAHYQS
# ESTRDYSRFEQNLTFVSIVGMLDPPRPEVRPAVANCKAAGIRVVCITGDNKRTAETICRQIGIFDEDEDLTGKSYTGRELDDLSHEEKIAATGDGVND
# APALKKADIGVAMGSGTDVAKLAADMVLADSNFATIEGAVEEGRLIYNNTKQFIRYLSKSHISLGACAMGRNTYRLTVVSSNIGEVVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g257
###
# start gene g258
Scaffold_6	AUGUSTUS	gene	1124152	1124415	0.9	-	.	g258
Scaffold_6	AUGUSTUS	transcript	1124152	1124415	0.9	-	.	g258.t1
Scaffold_6	AUGUSTUS	stop_codon	1124152	1124154	.	-	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_6	AUGUSTUS	CDS	1124152	1124415	0.9	-	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_6	AUGUSTUS	start_codon	1124413	1124415	.	-	0	transcript_id "g258.t1"; gene_id "g258";
# protein sequence = [MSNELDDILCKTLTRKHIGHSVAPLYTAASGLLGSFRVFGRFEWLDDLEEIDEAERGSDREADSSPPSESGSSFLAAK
# IWSSVQESS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g258
###
# start gene g259
Scaffold_6	AUGUSTUS	gene	1124945	1126087	0.82	+	.	g259
Scaffold_6	AUGUSTUS	transcript	1124945	1126087	0.82	+	.	g259.t1
Scaffold_6	AUGUSTUS	start_codon	1124945	1124947	.	+	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_6	AUGUSTUS	CDS	1124945	1126087	0.82	+	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_6	AUGUSTUS	stop_codon	1126085	1126087	.	+	0	transcript_id "g259.t1"; gene_id "g259";
# protein sequence = [MRQVGDRLIPVGVTSGRVLALSPEEAASAASGGDNGGGSWRPRRRQQGGNGLEQYLGQDLEEVRSDDCSCLLLTSFRF
# LMMQIMMMEAMRLSLLEHEAQQRKEAEEKKKADAQANKVTDDNETNETVASSTSSNGASTSSAPNLNSIDLSSTSPLSSSSSSTPAQQKNDSLRVKRG
# SLFNRSRSPSPAPPSSQSSLQNTPPFSTLGAALSTASTASAILRSSSSTSASSDPSPEKSSQAPLLAKEATSPSTIESASTSSLPSNTSSSTTSPVPP
# SITIAPVPPSAPIFLPPASPTPLESHSASKRPPSINTPFGDNDSSYENLPSSPEEIPEETPCEPLIPKDGTKMETELKSDPEAPVGSSERNQYQERLS
# GPSASISQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g259
###
# start gene g260
Scaffold_6	AUGUSTUS	gene	1127878	1129322	0.31	-	.	g260
Scaffold_6	AUGUSTUS	transcript	1127878	1129322	0.31	-	.	g260.t1
Scaffold_6	AUGUSTUS	stop_codon	1127878	1127880	.	-	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_6	AUGUSTUS	CDS	1127878	1128639	1	-	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_6	AUGUSTUS	CDS	1128714	1129322	0.31	-	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_6	AUGUSTUS	start_codon	1129320	1129322	.	-	0	transcript_id "g260.t1"; gene_id "g260";
# protein sequence = [MHITAAYLDRVVTKPKGLALQYTVWAPREPIGPTDLLPISIHVLPKERNISIRSATVVVERRIQFNESQSPVSASASS
# AIPISPTLSVSSFMTYSPASQNFPVSSRSFSTMTSPQSGYPSSVSLASDVRPLLPQPQYSRDRSDSSESLVGKPIVLPIAASESSGPFSQAENGIWSK
# TLTVQWPSAKPSSRWGIGETIHSDLVSIIVTGPHSTESFELDEEEIFTTSTNDAERRLAISKTRSQSSSEARSKSKSPRRTRRKLEDSPEPVPSTSTS
# GLKPPPHPRVPPSPTSSSSKRKDSIPRRPHTSAGPRDSSSSHFSTPKVSLETVPIPSNSSLDTAASNKKRPATTSIIGGSSDIQTTQNIHAFSPIISL
# SSTPSTSSGSGSSTLESTEGHKDESSSAAVREWEAELAKIELKSRRSSDLLGFKFKRKRPSVLSTVAGSRCGSVGNTKHPMVQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g260
###
# start gene g261
Scaffold_6	AUGUSTUS	gene	1132512	1133419	0.4	+	.	g261
Scaffold_6	AUGUSTUS	transcript	1132512	1133419	0.4	+	.	g261.t1
Scaffold_6	AUGUSTUS	start_codon	1132512	1132514	.	+	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_6	AUGUSTUS	CDS	1132512	1132647	0.44	+	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_6	AUGUSTUS	CDS	1132737	1133419	0.65	+	2	transcript_id "g261.t1"; gene_id "g261";
Scaffold_6	AUGUSTUS	stop_codon	1133417	1133419	.	+	0	transcript_id "g261.t1"; gene_id "g261";
# protein sequence = [MEPGPSTRNAQMPFDNFTRTQGSFSSSLVSKPDTVVWQMPPPSNPVSRINPPPSESNWNFLPSVVATDAVGSSSRPST
# RLLDKRLHSITSFEINPAIAKLVDPVMLKGVADAANQKAQERSRTLGLVMKRRKSTPKSTKAEKSTTGKSRASRAVNSGMIEKSRNVPKRKEKERGKT
# KEISGSSLLQKSWTRECSTFKRPVFDDSFSITSSSTSSPEVLDDSMSIDETNSPDTSLMSPSPPLLTTRLPNPHTPYPYLLKFRTHLLSTAGVNPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g261
###
# start gene g262
Scaffold_6	AUGUSTUS	gene	1133588	1133926	0.88	+	.	g262
Scaffold_6	AUGUSTUS	transcript	1133588	1133926	0.88	+	.	g262.t1
Scaffold_6	AUGUSTUS	start_codon	1133588	1133590	.	+	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_6	AUGUSTUS	CDS	1133588	1133926	0.88	+	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_6	AUGUSTUS	stop_codon	1133924	1133926	.	+	0	transcript_id "g262.t1"; gene_id "g262";
# protein sequence = [MRRVNSFPAKNVRLIDNIGVVRDLPTKQRPFKTPFLPTTQRSNTGQALAVNATYPKTEKSPVSRMNDVHREAFAHTIE
# ETEPHGMVCDDAETSYEHDSFDMDALEETLKQYD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g262
###
# start gene g263
Scaffold_6	AUGUSTUS	gene	1137001	1137696	0.24	+	.	g263
Scaffold_6	AUGUSTUS	transcript	1137001	1137696	0.24	+	.	g263.t1
Scaffold_6	AUGUSTUS	start_codon	1137001	1137003	.	+	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_6	AUGUSTUS	CDS	1137001	1137696	0.24	+	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_6	AUGUSTUS	stop_codon	1137694	1137696	.	+	0	transcript_id "g263.t1"; gene_id "g263";
# protein sequence = [MVALQKELSLYQFIKIPEVPTFTGGAIGYVAYDCIQHFEPKTACELKDPLNIPEAVFMLADTLVIYDHIFQTIKVVSH
# VFMPSDAGKNNLSFVYQTAVDKARRLAKVLITSSTPEPVQPPIVSGNEAVSNVGKQGYEGFVTTLKKHIVAGDIIQAVPSQRLARPTSLHPFNAYRHL
# RQVNPSPYMFYLDCGDLQIVGASPETLCKVEKNIVYNHAIAGTTKRGKTPEGRSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g263
###
# start gene g264
Scaffold_6	AUGUSTUS	gene	1138448	1139209	0.97	-	.	g264
Scaffold_6	AUGUSTUS	transcript	1138448	1139209	0.97	-	.	g264.t1
Scaffold_6	AUGUSTUS	stop_codon	1138448	1138450	.	-	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_6	AUGUSTUS	CDS	1138448	1139209	0.97	-	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_6	AUGUSTUS	start_codon	1139207	1139209	.	-	0	transcript_id "g264.t1"; gene_id "g264";
# protein sequence = [MSQYGSTQTSQWSLRDSLHRPTKDATLSALLASGAHFGHASSRMNPNFLPYAYGTRAGITLIDLDHTLPLLRRAAKVV
# RAVAANDGQIVFIGTRADIRPVVQKAAQRLGTQGFHVGDRWLPGTLTNKWQMFGHETVRSKRIVPDLVILLNPIQNMNAIQECALSNVPTIAIVDSNV
# DPRIVMYPIPANDESPRTAEIIAGVLSIAGREGIAIREAETQRMRMAVDSAWEDFNKMQVMQDARQPQRSDAEAFDY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g264
###
# start gene g265
Scaffold_6	AUGUSTUS	gene	1140041	1140723	0.96	+	.	g265
Scaffold_6	AUGUSTUS	transcript	1140041	1140723	0.96	+	.	g265.t1
Scaffold_6	AUGUSTUS	start_codon	1140041	1140043	.	+	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_6	AUGUSTUS	CDS	1140041	1140216	0.97	+	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_6	AUGUSTUS	CDS	1140279	1140723	0.99	+	1	transcript_id "g265.t1"; gene_id "g265";
Scaffold_6	AUGUSTUS	stop_codon	1140721	1140723	.	+	0	transcript_id "g265.t1"; gene_id "g265";
# protein sequence = [MIHWPFEVTEKDGSPLIKVSYLGEEKTFSPQEISSMVLTKMKEVSEAKLGKTVKKAVVTVPAYFNDSQRLATKDAGAI
# AGLDVLRIINEPTAAAIAYDRQSKTEKNVLIFDLGGGTFDVSLLNISGGVFAVKATAGDTHLGGEDFDNTLLEHFKNEFKRKSKLDISDDARALRRLR
# SACERAKRTLSSVTQTTVEVDSLYQVSSTI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g265
###
# start gene g266
Scaffold_6	AUGUSTUS	gene	1140815	1141831	0.11	+	.	g266
Scaffold_6	AUGUSTUS	transcript	1140815	1141831	0.11	+	.	g266.t1
Scaffold_6	AUGUSTUS	start_codon	1140815	1140817	.	+	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_6	AUGUSTUS	CDS	1140815	1141129	0.33	+	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_6	AUGUSTUS	CDS	1141290	1141428	0.37	+	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_6	AUGUSTUS	CDS	1141503	1141831	0.56	+	2	transcript_id "g266.t1"; gene_id "g266";
Scaffold_6	AUGUSTUS	stop_codon	1141829	1141831	.	+	0	transcript_id "g266.t1"; gene_id "g266";
# protein sequence = [MFKSTLDPVEKVLKDAKMAREKVDDIVLVGGSTRIPKIQALVSEYFGGRQLNKSINPDEAVAYGAAVQAAVLTGQTSD
# QTKDLLLLDVAPLSLGVAMQGDVFGCVCRDNRLLGEFELTGIPPMPRGQAELVTTFEIDANGLLKVSAQDRSSAITNSVGRLSSAEIDQMIKDAEQFK
# MADKEFTARHEAKSDLEAYIQQVESTITSPEIGMKLKRGAKSQVEAELARALEKLEIVDSTADELKKAQLGIKRALQKATAGIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g266
###
# start gene g267
Scaffold_6	AUGUSTUS	gene	1142170	1142856	0.46	+	.	g267
Scaffold_6	AUGUSTUS	transcript	1142170	1142856	0.46	+	.	g267.t1
Scaffold_6	AUGUSTUS	start_codon	1142170	1142172	.	+	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_6	AUGUSTUS	CDS	1142170	1142856	0.46	+	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_6	AUGUSTUS	stop_codon	1142854	1142856	.	+	0	transcript_id "g267.t1"; gene_id "g267";
# protein sequence = [MMDPEDDYNTIVEAEQKIKASRVQREKEIEEAHANMKGASSIQIPEKIAYILEALSKTLEAAKQSAKRPKSVPSAETH
# AATVNELDNSKLSLAKSISDAENMLASQEAELAALKAECQSLEHYDPATEHEKDLDGTACVVVCPDSNICYSIVITSLRLKIYRGMGFDIALDDKNQV
# SNVLIRMFYACAPVKYNHPSSGSQSGDVHSVPLNVDKSPADYTRHLWKLAAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g267
###
# start gene g268
Scaffold_6	AUGUSTUS	gene	1144546	1146312	0.23	-	.	g268
Scaffold_6	AUGUSTUS	transcript	1144546	1146312	0.23	-	.	g268.t1
Scaffold_6	AUGUSTUS	stop_codon	1144546	1144548	.	-	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_6	AUGUSTUS	CDS	1144546	1144981	0.91	-	1	transcript_id "g268.t1"; gene_id "g268";
Scaffold_6	AUGUSTUS	CDS	1145770	1145915	1	-	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_6	AUGUSTUS	CDS	1145977	1146312	0.49	-	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_6	AUGUSTUS	start_codon	1146310	1146312	.	-	0	transcript_id "g268.t1"; gene_id "g268";
# protein sequence = [MPITSDKVFSPSDHADLKTLFVDLNEEWKISKFETTPLMSSYLVAFANGPFEYLESFAKMPLSGRTIPLRIYATKDLI
# HQAQFALDVKAKVLPLYEQVFEVEYPLPKLDTLVANDFDAGAMENWGLITGRTSALLLDPKKADLAAKKRVVVVQSHEVAHMCVTNDLWAGISKSTGT
# DIINFMDNWVKKVRPTPETYGRLVDLPLTYLQIGFPVVTVTETSGGIKVRQDRFLETGLAEGKDNETIWNIPLSILTFDASGKTIIDKTAVLDSREST
# FALDTSKPYKLNAGTNGVCECHSFDYTGSKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g268
###
# start gene g269
Scaffold_6	AUGUSTUS	gene	1148304	1148798	0.64	+	.	g269
Scaffold_6	AUGUSTUS	transcript	1148304	1148798	0.64	+	.	g269.t1
Scaffold_6	AUGUSTUS	start_codon	1148304	1148306	.	+	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_6	AUGUSTUS	CDS	1148304	1148798	0.64	+	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_6	AUGUSTUS	stop_codon	1148796	1148798	.	+	0	transcript_id "g269.t1"; gene_id "g269";
# protein sequence = [MSSPTSASDLESQVHKGKEVVQIVELGEEEKKYEVDLEPNEHPQQHTSFKKWTVILVVATSALCVTCASSAVRSALHV
# QNHAYQRSCQASFTEAGIAAEFHVPHEVTILSITFFVAGLGIGPLLTGPLSEVYGRNIIYRVSYILLCAFTFGVAFAPDIGEFWPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g269
###
# start gene g270
Scaffold_6	AUGUSTUS	gene	1151057	1152210	0.23	+	.	g270
Scaffold_6	AUGUSTUS	transcript	1151057	1152210	0.23	+	.	g270.t1
Scaffold_6	AUGUSTUS	start_codon	1151057	1151059	.	+	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_6	AUGUSTUS	CDS	1151057	1151563	0.55	+	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_6	AUGUSTUS	CDS	1151662	1152210	0.41	+	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_6	AUGUSTUS	stop_codon	1152208	1152210	.	+	0	transcript_id "g270.t1"; gene_id "g270";
# protein sequence = [MPFDPVRDAVLNSPATEGLPTSPSLARRATHLSVLLNSDSEPLPRPSSSLPQSLHFEPTDKLVFSKPLKKAHDKSVSL
# SNSRPSSSSSFLPTSTDFPVMRSSPLLYNPTHRLTPPTSILTPMSKAEMEMYKSYVGKGTARLTKRKRPRDDSDTADEPPVKKYTGRSGVVRLDSPII
# GLKNFNNWVKSVLISKFAHPALAASSVRTQKNKGKVLDLGCGKGGDITKWSKAKISDYVGAGVLPSSNLFLRWLIFSSDIAAISVEQAQERWETNRNA
# SRFQASFATYDFCTQNLEDVFNPDILAKPFDVVSSQFCIHYAFEKEETVRRMFRKCQSLAETRRYVYWNNTQRRATT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g270
###
# start gene g271
Scaffold_6	AUGUSTUS	gene	1153493	1155518	0.32	-	.	g271
Scaffold_6	AUGUSTUS	transcript	1153493	1155518	0.32	-	.	g271.t1
Scaffold_6	AUGUSTUS	stop_codon	1153493	1153495	.	-	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_6	AUGUSTUS	CDS	1153493	1153824	0.74	-	2	transcript_id "g271.t1"; gene_id "g271";
Scaffold_6	AUGUSTUS	CDS	1153865	1154139	0.95	-	1	transcript_id "g271.t1"; gene_id "g271";
Scaffold_6	AUGUSTUS	CDS	1154194	1155518	0.48	-	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_6	AUGUSTUS	start_codon	1155516	1155518	.	-	0	transcript_id "g271.t1"; gene_id "g271";
# protein sequence = [MLTLDLKKSNDNLVVHGKLIIYLSTNVTQPIPNPGPSQVNGLSSALADMGLNNTNSPGASTSNLVLPTNPSGTLSRTT
# SSHATATDITASPAVVAPSSAPSTETEQPSPQIVAAPSSSRPTSISGTNPSANNAAPANPMNPSATAGNANQMRNFNPNVDQYGRLPPGWERRIDPLG
# RTYYVDHNTRTTTWNRPSDSAAVNNDVQDSETNAARDQHSRRILADDLLEANNSNNSTSNVFRNSTATVNATANPAPAALTTGSNATTAGSGSLPNGW
# EERFTLEGRPYYVDHNTRTTTWVDPRRQAIIRVMGPNGQGSSLQPQAISQLGPLPSGWEMRLTSTARVYFVDHNTKTTTWDDPRLPSTLDANVPQYKR
# DFRRKLIYFRSQPAMRAQPGNCQIKIRRNHIFEDSYAEIMRQTPNDLKKRLMIKFDGEDGLDYGVFPGTLEFFFLLSHEMFNPFYCLFEYSAHDNYTL
# QINPASGVNPEHLNYFKFIGRCLGLGIFHRRFLDAYFIVSFYKMILKKKVTLADLESVDTELHLRSYNKADSFLCSENDITDIIDTSFTTTEERFGEM
# VTIELKPGGEDIPVTEDNKKDYVECIVDYRISKRVKEQFDAFMSGFSELIPQDLITVFDERELELLIGGMSEIDV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g271
###
# start gene g272
Scaffold_6	AUGUSTUS	gene	1158692	1159597	0.68	+	.	g272
Scaffold_6	AUGUSTUS	transcript	1158692	1159597	0.68	+	.	g272.t1
Scaffold_6	AUGUSTUS	start_codon	1158692	1158694	.	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_6	AUGUSTUS	CDS	1158692	1159597	0.68	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_6	AUGUSTUS	stop_codon	1159595	1159597	.	+	0	transcript_id "g272.t1"; gene_id "g272";
# protein sequence = [MPGCEIGERASKRKTLEPTPQREIAETRPMKEYRERNLQNAPSRTRTSLTGLLMHLSSSPYSHRNTGGLSKFRLNLGN
# AIESIEQSGVNPIFPKKLWKSVLRDEYIELSEVHALGATDYIPKAPQPASNKFAALKSSTFAKPASTKAITDQASWRRAWRATADAISFAFADRRNEL
# SAYEEHVGRLFDDNLPSFHHNVINYDKAVRQLIGSRRDILFDEFEHSEVARIRNMYLLPTGTHFSTSTFPAPRANQASLHPRNRAREICRKFNRGNCD
# GCERKHICATCSESGHGSHNCRKTSWK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g272
###
# start gene g273
Scaffold_6	AUGUSTUS	gene	1164677	1165264	0.84	+	.	g273
Scaffold_6	AUGUSTUS	transcript	1164677	1165264	0.84	+	.	g273.t1
Scaffold_6	AUGUSTUS	start_codon	1164677	1164679	.	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_6	AUGUSTUS	CDS	1164677	1165264	0.84	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_6	AUGUSTUS	stop_codon	1165262	1165264	.	+	0	transcript_id "g273.t1"; gene_id "g273";
# protein sequence = [MFIKFAEEYLAVLRSEQEQLDSVVKEQNLSPEEATRMTTEYEMLSRNIEDLKQKIADTEQTVMSLEVSLTNRISGTEE
# TLHIYNVALSTLGLLPPLPPPHNDIDLTLELNTASSDHSQLLSGLDIRKVIKPTLNSIAESKRSTRAEVENERIRVDNEIEQLTLECDTGEDEISQLE
# KQVAAVNEQAIDLHNVYVN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g273
###
# start gene g274
Scaffold_6	AUGUSTUS	gene	1174803	1175873	0.61	+	.	g274
Scaffold_6	AUGUSTUS	transcript	1174803	1175873	0.61	+	.	g274.t1
Scaffold_6	AUGUSTUS	start_codon	1174803	1174805	.	+	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_6	AUGUSTUS	CDS	1174803	1175382	0.62	+	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_6	AUGUSTUS	CDS	1175491	1175873	0.97	+	2	transcript_id "g274.t1"; gene_id "g274";
Scaffold_6	AUGUSTUS	stop_codon	1175871	1175873	.	+	0	transcript_id "g274.t1"; gene_id "g274";
# protein sequence = [MKTYCPVSVRDLMKQLSEVEVFGDTSSVRKIHNKLSDRILIPGKVFIFDEDSRPGYYGTWTRSSRLIGARTPFAKDVL
# ELDYGYDSGEDWEEEPAGDADDVMDDAEDDAATEDQDSDIDDWLVEDDEVEEDIPADERAGSPIFNPLPKRRADDAPPQTVKKRKVVVPLVPFAKGPC
# WENSIGQNESMFDPFRILEEQKSVRASEKGFAVPALPNHIVQASTAKGSDTGSSPAPVVAPSGPKKPAFTPKTAFPDEHLPILLSKINTAQAANLTVL
# VEAVSQELREHKVKKNAIEAKIREVGEKCKVRKFWVVKENHPVGIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g274
###
# start gene g275
Scaffold_6	AUGUSTUS	gene	1178867	1179802	0.79	-	.	g275
Scaffold_6	AUGUSTUS	transcript	1178867	1179802	0.79	-	.	g275.t1
Scaffold_6	AUGUSTUS	stop_codon	1178867	1178869	.	-	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_6	AUGUSTUS	CDS	1178867	1179802	0.79	-	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_6	AUGUSTUS	start_codon	1179800	1179802	.	-	0	transcript_id "g275.t1"; gene_id "g275";
# protein sequence = [MYVFQLMEYWFPNLICHLDHSKNNSAPQSHSSTSLPPPPHQTLQHPFTGALHSTNKMPTFSQSSYMFSTPPPPSIIQT
# HPSQDDPAIDLGDAFEAAQHILKALNFGVDLSKVPQEAEAGSTFSPPVPNSQSITGAVTVDVANPSITGGMNPDGVRAELQVQLVLLAAQLSEMASVP
# SEITSASSAVLITASTSAGNEGASYGDASSQSLLATSPAPVSYSDRPNSKADTGGTLPQAAPPETPRDARSFSEAQSKVAALPPNGQIHVPQCLRLHQ
# HRRRKSFRCTMLMILTTMIWTRLLCSSCCVAALAILG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g275
###
# start gene g276
Scaffold_6	AUGUSTUS	gene	1189402	1189888	0.41	-	.	g276
Scaffold_6	AUGUSTUS	transcript	1189402	1189888	0.41	-	.	g276.t1
Scaffold_6	AUGUSTUS	stop_codon	1189402	1189404	.	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_6	AUGUSTUS	CDS	1189402	1189815	0.42	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_6	AUGUSTUS	CDS	1189871	1189888	0.47	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_6	AUGUSTUS	start_codon	1189886	1189888	.	-	0	transcript_id "g276.t1"; gene_id "g276";
# protein sequence = [MSHYPEADEAQHRHYNDGYLPHTSGTPSPYEHYDQPLTQASQFDPYGVSTAGPYAQQPAASNYYGGPVDAYGAPIHSP
# PPGGYHPTSPPPPNVLPPFGAPIHSPPVHDYLSSPPPQNAYPTSYGLRDEGFTPRPNYGDGTSLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g276
###
# start gene g277
Scaffold_6	AUGUSTUS	gene	1195306	1195657	0.62	-	.	g277
Scaffold_6	AUGUSTUS	transcript	1195306	1195657	0.62	-	.	g277.t1
Scaffold_6	AUGUSTUS	stop_codon	1195306	1195308	.	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_6	AUGUSTUS	CDS	1195306	1195425	0.91	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_6	AUGUSTUS	CDS	1195481	1195657	0.65	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_6	AUGUSTUS	start_codon	1195655	1195657	.	-	0	transcript_id "g277.t1"; gene_id "g277";
# protein sequence = [MVQLTAVFLFASVLTIAMGTPLIKRDMATIQADITNISSLLVTWDNDVNAFAGTTDGAAAIHDDSVALESAFNTAITD
# TQVYSSTIPSTLNYPDCKNP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g277
###
# start gene g278
Scaffold_6	AUGUSTUS	gene	1218544	1220213	0.29	-	.	g278
Scaffold_6	AUGUSTUS	transcript	1218544	1220213	0.29	-	.	g278.t1
Scaffold_6	AUGUSTUS	stop_codon	1218544	1218546	.	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_6	AUGUSTUS	CDS	1218544	1218873	0.84	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_6	AUGUSTUS	CDS	1218995	1219352	0.47	-	1	transcript_id "g278.t1"; gene_id "g278";
Scaffold_6	AUGUSTUS	CDS	1219466	1219889	0.64	-	2	transcript_id "g278.t1"; gene_id "g278";
Scaffold_6	AUGUSTUS	CDS	1220006	1220213	0.79	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_6	AUGUSTUS	start_codon	1220211	1220213	.	-	0	transcript_id "g278.t1"; gene_id "g278";
# protein sequence = [MPPKTQLKSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTTLPEAMEENNNSSTAPSIARRTGKQ
# PQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGAEIQHDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSG
# FKGSIETLGTVLAALGRPSDSSGIRARSRSRGIRRGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRK
# YNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRLTIPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAF
# NHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g278
###
# start gene g279
Scaffold_6	AUGUSTUS	gene	1229135	1229806	0.53	+	.	g279
Scaffold_6	AUGUSTUS	transcript	1229135	1229806	0.53	+	.	g279.t1
Scaffold_6	AUGUSTUS	start_codon	1229135	1229137	.	+	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_6	AUGUSTUS	CDS	1229135	1229806	0.53	+	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_6	AUGUSTUS	stop_codon	1229804	1229806	.	+	0	transcript_id "g279.t1"; gene_id "g279";
# protein sequence = [MHSYRALIPYVTLALTLAANASPVGYYSNTYATREVSSPETYDMRDIFSPAEDFPKARDSGNLLLREVPTVPNGHPPP
# YEEAIAAPHSTAEKTPPKIDTIEKAPPKIDTIEKPVDPTKVEPKPPAAPVPSGVVKGTKTGWTSKINPKVKEYAKNTAIVGVSAAALGGALGGLLWAV
# SGSCTGPDHNPERRSEFFLFPFPFITITQIVCRPLRWCALLIQDGDF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g279
###
# start gene g280
Scaffold_6	AUGUSTUS	gene	1230038	1230379	0.44	+	.	g280
Scaffold_6	AUGUSTUS	transcript	1230038	1230379	0.44	+	.	g280.t1
Scaffold_6	AUGUSTUS	start_codon	1230038	1230040	.	+	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_6	AUGUSTUS	CDS	1230038	1230379	0.44	+	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_6	AUGUSTUS	stop_codon	1230377	1230379	.	+	0	transcript_id "g280.t1"; gene_id "g280";
# protein sequence = [MDSTDFFSFLHGAPAESEKNDMDEEMEEVDPLETLPQKRKATESFSKLPDDSSSSKKAKMEATPATESISNPVVLDDF
# ETEAKREVAASAGLTGGVEAGSRLELRHQVRFSNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g280
###
# start gene g281
Scaffold_6	AUGUSTUS	gene	1231410	1232099	0.72	+	.	g281
Scaffold_6	AUGUSTUS	transcript	1231410	1232099	0.72	+	.	g281.t1
Scaffold_6	AUGUSTUS	start_codon	1231410	1231412	.	+	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_6	AUGUSTUS	CDS	1231410	1232099	0.72	+	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_6	AUGUSTUS	stop_codon	1232097	1232099	.	+	0	transcript_id "g281.t1"; gene_id "g281";
# protein sequence = [MIMVKNYNPVIVFSFSKRECEANALLMSKFEFNSTDEQDLVTNIFTNAIENLSPDDRNLPQIAQLLPLLRRGIGVHHS
# GLLPILKEVIEILFQEGLIKVLFATETFSIGLNMPAKTVVFTDTRKYDGREQRSLSSGEYIQMSGRAGRRGLDDRGVVIMMCDEKLEPSVAKEMIKGE
# ADRLDSAFHIGYNMVMNLMKVEGISPEFMLERCFHQFQSSTGIPKLQEGERRD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g281
###
# start gene g282
Scaffold_6	AUGUSTUS	gene	1234680	1235282	0.99	-	.	g282
Scaffold_6	AUGUSTUS	transcript	1234680	1235282	0.99	-	.	g282.t1
Scaffold_6	AUGUSTUS	stop_codon	1234680	1234682	.	-	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_6	AUGUSTUS	CDS	1234680	1235282	0.99	-	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_6	AUGUSTUS	start_codon	1235280	1235282	.	-	0	transcript_id "g282.t1"; gene_id "g282";
# protein sequence = [MGSNCFHHSILLNSSGSSKFATELPSYVTKVHDEASKLDLAQFDSFHSRASGSLGASQPATGSVRMALEREGGIRCVT
# IPDELSMQSAVAFAGASFFLITARMPNLLADDHKALVELACSTTLAAAYKPQLLDAVVPPRSDGRKRNIVFIVCGGFKVSLRELAEYEEVLRAEIERN
# VNGYWEVVLNDGQIVDVDYSLKQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g282
###
# start gene g283
Scaffold_6	AUGUSTUS	gene	1241063	1242767	0.64	+	.	g283
Scaffold_6	AUGUSTUS	transcript	1241063	1242767	0.64	+	.	g283.t1
Scaffold_6	AUGUSTUS	start_codon	1241063	1241065	.	+	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_6	AUGUSTUS	CDS	1241063	1241223	0.65	+	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_6	AUGUSTUS	CDS	1241379	1241407	0.76	+	1	transcript_id "g283.t1"; gene_id "g283";
Scaffold_6	AUGUSTUS	CDS	1241457	1241983	1	+	2	transcript_id "g283.t1"; gene_id "g283";
Scaffold_6	AUGUSTUS	CDS	1242036	1242066	1	+	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_6	AUGUSTUS	CDS	1242202	1242767	0.98	+	2	transcript_id "g283.t1"; gene_id "g283";
Scaffold_6	AUGUSTUS	stop_codon	1242765	1242767	.	+	0	transcript_id "g283.t1"; gene_id "g283";
# protein sequence = [MTTVSLSFPQAAASITQYIDISIDGDTAVAFTENVGQRFLSYGWQVLHVDNGDSELTEFTALVSLKADDIQALKTKFG
# LPADKSFFVPPATYDAYADIGKRGASLEAQWNSLLGEYGQKYPKEHGELTRRISGELPTNWEQCLPVYKSTDAAQASRKLSEIVLTALAPVLPELLGG
# SADLTGSNLTKVKGSVDFQPPSTGLGNYAGTYIRYGVREHGMGAIANGIHAYGGIIPYVATFLNFVSYAAGAVLLNQHYILATHDSIGLGEDGPTHQP
# IETAIHFRSTPNLAFWRPADGNETSAAYLVALKSKKTPSILSLSRQNLPNLEASSIEKAAKGGYVVHEVESEDLTIVSAGSEVSIALEAAAKLNAEGV
# KTRVVSLPCWLVFDKQPEEYRLSVLRSGAPILSLEALSTAGWSKYSHEVKISLPISNILLFICLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g283
###
# start gene g284
Scaffold_6	AUGUSTUS	gene	1244691	1245163	0.29	-	.	g284
Scaffold_6	AUGUSTUS	transcript	1244691	1245163	0.29	-	.	g284.t1
Scaffold_6	AUGUSTUS	stop_codon	1244691	1244693	.	-	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_6	AUGUSTUS	CDS	1244691	1244900	0.98	-	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_6	AUGUSTUS	CDS	1244951	1245163	0.29	-	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_6	AUGUSTUS	start_codon	1245161	1245163	.	-	0	transcript_id "g284.t1"; gene_id "g284";
# protein sequence = [MSNPQQTLKCLSARMASVGYMFTRGGVVVVGVENGPDVNGRLDAVTEVALSEGIDDFEPLPPENDSLSRIKFYCETSA
# LVELTDKLSKHPGVAILESEFVYNPTEKTAVSDQDAEILEDLVHALEVHDDVIHVTTSAAIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g284
###
# start gene g285
Scaffold_6	AUGUSTUS	gene	1245996	1246409	0.87	+	.	g285
Scaffold_6	AUGUSTUS	transcript	1245996	1246409	0.87	+	.	g285.t1
Scaffold_6	AUGUSTUS	start_codon	1245996	1245998	.	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_6	AUGUSTUS	CDS	1245996	1246409	0.87	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_6	AUGUSTUS	stop_codon	1246407	1246409	.	+	0	transcript_id "g285.t1"; gene_id "g285";
# protein sequence = [MQIFTVVSLQSILFFHLSELNVCLQDLYETDIAGSVADEKLLESPTQISTAEVPVSEPVEKSSVAPAPSDDSTATSSA
# SASQPSAPATLAQPVQQIPTYEDPTIYRDTSSGMQASYEQNFSALEHRSVRPSEMKDDG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g285
###
# start gene g286
Scaffold_6	AUGUSTUS	gene	1247159	1247885	0.69	+	.	g286
Scaffold_6	AUGUSTUS	transcript	1247159	1247885	0.69	+	.	g286.t1
Scaffold_6	AUGUSTUS	start_codon	1247159	1247161	.	+	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_6	AUGUSTUS	CDS	1247159	1247317	0.69	+	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_6	AUGUSTUS	CDS	1247385	1247885	1	+	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_6	AUGUSTUS	stop_codon	1247883	1247885	.	+	0	transcript_id "g286.t1"; gene_id "g286";
# protein sequence = [MREFFSQFGRVVDSTVMLDRETGRSKGFGFISLEDANVQQFLGFGHLEIDGKLIDVKLAQPRYQRESFQEDEQSGGGD
# YNNNMRGAGNRGPNNYSAGGVSGNGTTFNNGVGGAVPASSVPFDPQALAALYTRMFQMANGGAVNSMMGGGMGGGMGGGMNPMMNMGANMGMGGVGGG
# RGGGVQGGGLPRGPRGGPGGMGATGVGPSRQPRGQHNYHPYGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g286
###
# start gene g287
Scaffold_6	AUGUSTUS	gene	1250022	1250855	0.43	-	.	g287
Scaffold_6	AUGUSTUS	transcript	1250022	1250855	0.43	-	.	g287.t1
Scaffold_6	AUGUSTUS	stop_codon	1250022	1250024	.	-	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_6	AUGUSTUS	CDS	1250022	1250358	0.7	-	1	transcript_id "g287.t1"; gene_id "g287";
Scaffold_6	AUGUSTUS	CDS	1250494	1250632	0.43	-	2	transcript_id "g287.t1"; gene_id "g287";
Scaffold_6	AUGUSTUS	CDS	1250735	1250855	0.54	-	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_6	AUGUSTUS	start_codon	1250853	1250855	.	-	0	transcript_id "g287.t1"; gene_id "g287";
# protein sequence = [MATSAKELGKKIIGYPERVVPVVTVKDWFSQFNRNPIQQVFGFACVAVDFYNAHHTIYQDLGWLTGDVIAGLTVGIVL
# VPKACLMLSFTATCDLIRSAYQFFATSKDVSIGPVAVMSLTVSQIIAHVDDAHPGKWEGPEIATTVAFICGFIVLGIGLLRLGWLVEFIPAPAVSGFM
# TGSAINIASGQVPGLMGITGFK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g287
###
# start gene g288
Scaffold_6	AUGUSTUS	gene	1254834	1255194	0.56	+	.	g288
Scaffold_6	AUGUSTUS	transcript	1254834	1255194	0.56	+	.	g288.t1
Scaffold_6	AUGUSTUS	start_codon	1254834	1254836	.	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_6	AUGUSTUS	CDS	1254834	1254836	0.56	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_6	AUGUSTUS	CDS	1254913	1255194	0.56	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_6	AUGUSTUS	stop_codon	1255192	1255194	.	+	0	transcript_id "g288.t1"; gene_id "g288";
# protein sequence = [MHILPFWSGAEHHDFHHMAFTNNYSTSFRWWDRIFGTDDKYLVYRERVQAAKAKALSKEDFLKAEQALMDEVLAEGLK
# AENEVEERSSRKVKVQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g288
###
# start gene g289
Scaffold_6	AUGUSTUS	gene	1255678	1256676	0.93	+	.	g289
Scaffold_6	AUGUSTUS	transcript	1255678	1256676	0.93	+	.	g289.t1
Scaffold_6	AUGUSTUS	start_codon	1255678	1255680	.	+	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_6	AUGUSTUS	CDS	1255678	1255793	0.98	+	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_6	AUGUSTUS	CDS	1255902	1256676	0.93	+	1	transcript_id "g289.t1"; gene_id "g289";
Scaffold_6	AUGUSTUS	stop_codon	1256674	1256676	.	+	0	transcript_id "g289.t1"; gene_id "g289";
# protein sequence = [MSLPPDRPSSTSKGRQKEESPQPTDIAEKLIAFRRRTAVDKRPSASSGSRSPKKLHAPPAMVNKSPPDTTADEFSRKL
# QISSSSSPSRLMPAGPRQNQASKLYNPDRDPIPTMRRTAEPDTMSDTDSSHAPRYKRSPSVTRERERDAPARQLFDHRKDDPVRFAVFARPQRPVPTP
# KSSGEYISAASSISSSFTLSSATDDSSASSAIFDQSRPNARSEDSATNAFSNHFKRLYRNITSLENRIKDEDVESEDDSRYTNRILSKEKDRTQENEE
# AEKWSKRIEDHKRYVCHDFMWT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g289
###
# start gene g290
Scaffold_6	AUGUSTUS	gene	1256718	1258689	0.67	+	.	g290
Scaffold_6	AUGUSTUS	transcript	1256718	1258689	0.67	+	.	g290.t1
Scaffold_6	AUGUSTUS	start_codon	1256718	1256720	.	+	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_6	AUGUSTUS	CDS	1256718	1257352	0.67	+	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_6	AUGUSTUS	CDS	1257402	1258689	1	+	1	transcript_id "g290.t1"; gene_id "g290";
Scaffold_6	AUGUSTUS	stop_codon	1258687	1258689	.	+	0	transcript_id "g290.t1"; gene_id "g290";
# protein sequence = [MLQISLSPSVPDSLRTIPTKYNIIMRLWVTGFNKLLQSLQRACLESPLAMEYLQEFIMYAYTFYTGLYEEHPLIGFRS
# NWLEALGDLARYRMAVAAIASSTVDGPALTAANVLEAAADGWARNNALKPKRRPSVSVPAARIDDSPSPSVGVAAARALELLPEKDQWRAIAQEWYGI
# GIMDQPGTGKLHHHLGFLYREVEGEELRAIYHFVKSLVSLHPFLTSRENVLHVWSPDAQARRQLPDARATELFVLLHGMLFTNIQLDDFEPTFSRFME
# RLELEVPEEREWIMMAIVNIGSLFEYGKTNGVLKRAGALGSSSSAPVISRIAKKEAQRDDDKMDVDDETKPRPDASPCISELDTTPDDLPRAFKLAME
# VTFTMLRFVLQHPSRRPSPFSESRINPYLTVLLTFLSIMLKHQKTKEILERSLPWDEFAAMLALVPRNVMMSEGLSPLNNSRERWAMLAANTAPPLPE
# DWCLRGMEWVGRKIFPYGYWKGFEDRKVEIEILSEAERVDITDGHIEDDDEHTESIAKNETKKRWVRIVRCAIGIADVVDGFNWVEGTREWKVEGVLS
# AKVEQWKEEDRLQKESEELRRMGNSWADDSMDVDEDNVESFSDGSEEDDENDSEEIRALKVRSLLVFYLVSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g290
###
# start gene g291
Scaffold_6	AUGUSTUS	gene	1267320	1269062	0.68	-	.	g291
Scaffold_6	AUGUSTUS	transcript	1267320	1269062	0.68	-	.	g291.t1
Scaffold_6	AUGUSTUS	stop_codon	1267320	1267322	.	-	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_6	AUGUSTUS	CDS	1267320	1267598	0.96	-	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_6	AUGUSTUS	CDS	1267660	1268107	0.81	-	1	transcript_id "g291.t1"; gene_id "g291";
Scaffold_6	AUGUSTUS	CDS	1268161	1268472	0.91	-	1	transcript_id "g291.t1"; gene_id "g291";
Scaffold_6	AUGUSTUS	CDS	1268608	1269062	0.85	-	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_6	AUGUSTUS	start_codon	1269060	1269062	.	-	0	transcript_id "g291.t1"; gene_id "g291";
# protein sequence = [MTNVNLSVAFAEIDWHDYAIVQTIEFTIADATSELPPPMSVQEVENMTLAQKRMAAMIMENTVEDVEAHRAKQAAAEA
# EAAAAVGNAGIGGDDAAMEESDDEDEERVMREQEEKRREIERAKALQASSVNAAAGPMKIRTDYVPKRNSMLTLSSMERATRALEARKAQASELQRGA
# NVVSSLKNLARTRVDIFGAEQDEERRKKEEEEERERRKEREKVVWDGHTASKANTLDKFSTNVNFDEQIAAIHRSKGLGPQQANAIGPGIGPAAAPSP
# LTSLPPPHASLPAPPQASSNPAYSTATVSSGPQPASAYQTPPVMLPPLHFQGIETTQPFGYQPGIAPGMHPSRVAALAAANGVLQSQAGVVRSADQME
# GVEDDIPPAKRQKVNKIPGSQIYSEEDWIGMHPHPISLQFQLPTDNTKPEWKFDGKIVTVPDLPLNLLVSTLRERIIQHIGSSVNVSRIRLSYAGKML
# TNKSTIASYNMEDEELVTLTLGDAKKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g291
###
# start gene g292
Scaffold_6	AUGUSTUS	gene	1269423	1269884	0.63	-	.	g292
Scaffold_6	AUGUSTUS	transcript	1269423	1269884	0.63	-	.	g292.t1
Scaffold_6	AUGUSTUS	stop_codon	1269423	1269425	.	-	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_6	AUGUSTUS	CDS	1269423	1269766	0.89	-	2	transcript_id "g292.t1"; gene_id "g292";
Scaffold_6	AUGUSTUS	CDS	1269806	1269884	0.7	-	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_6	AUGUSTUS	start_codon	1269882	1269884	.	-	0	transcript_id "g292.t1"; gene_id "g292";
# protein sequence = [MEFLSRQRKDLPAVLFFLLQKSNARFSVIDKTASYVAQSANPPLFEDKVREGQRSDPKFSFLNPADPYHAYYRHKMDK
# IFQGEIDDEQVPSGDDKVDGAAIQAKVVDVGLEPPTPVFIIDMPNISAIDLCVVLYSFLTYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g292
###
# start gene g293
Scaffold_6	AUGUSTUS	gene	1275735	1276602	0.14	-	.	g293
Scaffold_6	AUGUSTUS	transcript	1275735	1276602	0.14	-	.	g293.t1
Scaffold_6	AUGUSTUS	stop_codon	1275735	1275737	.	-	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_6	AUGUSTUS	CDS	1275735	1276253	0.74	-	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_6	AUGUSTUS	CDS	1276340	1276486	0.14	-	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_6	AUGUSTUS	CDS	1276543	1276602	0.19	-	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_6	AUGUSTUS	start_codon	1276600	1276602	.	-	0	transcript_id "g293.t1"; gene_id "g293";
# protein sequence = [MFTFSRATITRKLFPLGTWDNVERWRQDPYVAGGRGMMFNTGDLGRWRPDGQLDHMGRVDDQVKVKGFRTCEGVFKTA
# ALLVDSELWGFVTPSTVDPESVREAVSRVQPYYAVPTHYIALEDFPATRNGKVDKRALRSIALSSTLPYDMPSPCLSASSSPTCSDSEGVITPSSPFS
# NSLSSSHIYGESSFWTDISLDDEAKGVTQKEFTDENLDLFRSIIQHTKRPEPLRFRSNDPILAQQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g293
###
# start gene g294
Scaffold_6	AUGUSTUS	gene	1280619	1281284	0.99	-	.	g294
Scaffold_6	AUGUSTUS	transcript	1280619	1281284	0.99	-	.	g294.t1
Scaffold_6	AUGUSTUS	stop_codon	1280619	1280621	.	-	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_6	AUGUSTUS	CDS	1280619	1281284	0.99	-	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_6	AUGUSTUS	start_codon	1281282	1281284	.	-	0	transcript_id "g294.t1"; gene_id "g294";
# protein sequence = [MFNSVILHRLSENPNLIHGILATHKTFEDLGTFTLARGLREIRRVQVAKEDQARKSSLDDKRKSRRVSKEEHAPEEKK
# NLVNNEDENDPDENSAASQIPHSDHDGGPTTTTEPVVSPTPDSIPSAKPSEKSKGKMKQRRSSSSLDAGSLERMAAAGIGRNGFVPTPEWVYSLSISI
# YVKHAKTFCRRSLRGSKGTTCLNLCCENELMYQQAAAGYRNVDDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g294
###
# start gene g295
Scaffold_6	AUGUSTUS	gene	1282179	1283456	0.33	-	.	g295
Scaffold_6	AUGUSTUS	transcript	1282179	1283456	0.33	-	.	g295.t1
Scaffold_6	AUGUSTUS	stop_codon	1282179	1282181	.	-	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_6	AUGUSTUS	CDS	1282179	1282686	0.94	-	1	transcript_id "g295.t1"; gene_id "g295";
Scaffold_6	AUGUSTUS	CDS	1282734	1283259	0.92	-	2	transcript_id "g295.t1"; gene_id "g295";
Scaffold_6	AUGUSTUS	CDS	1283330	1283365	0.92	-	2	transcript_id "g295.t1"; gene_id "g295";
Scaffold_6	AUGUSTUS	CDS	1283435	1283456	0.39	-	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_6	AUGUSTUS	start_codon	1283454	1283456	.	-	0	transcript_id "g295.t1"; gene_id "g295";
# protein sequence = [MAIGIKCASEVFSLITPNDKAPENVATLIRVISLRLFNLVSDHTFPGPSSTSVSALATSFIKAGTGTGERNATKEVLN
# CLRVLQRVLPVVFETEGAESGSFEVDVFWKKVEVDNMEEQPVPQTESPQFVIEDDEDSEDEAKSSAPQSAPTPHPKKQLPSLGERLFSSIIDLLFCCG
# FTLPMQIQKDHYKINYVIWEKGIGSMVDPGPGHQYDSNKTEVLRLLLVLLSRQIYVSASSLFSKPSMYTLHLVQKLPRRDVLTLLCSLLNTAMNSPQA
# QPITINSMAGKLPYNHLVFKGEDPRVNLVAICFEVLGVLLDFQSGSARDVVVGTNEQQTSAPTARTNEFRYFLMKLVSTFLIKPNHDTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g295
###
# start gene g296
Scaffold_6	AUGUSTUS	gene	1287595	1287939	0.87	-	.	g296
Scaffold_6	AUGUSTUS	transcript	1287595	1287939	0.87	-	.	g296.t1
Scaffold_6	AUGUSTUS	stop_codon	1287595	1287597	.	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_6	AUGUSTUS	CDS	1287595	1287939	0.87	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_6	AUGUSTUS	start_codon	1287937	1287939	.	-	0	transcript_id "g296.t1"; gene_id "g296";
# protein sequence = [MSWKTLPECGGSSLHNPILLNSSLQHSIPAPPPPPYYYSADDQVMMEDESGRIQLVGERLKSEKLVTGLIIGALGMET
# PDGKFEVADFCYAGLPPQPSTTKEELEDRMEVDSTY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g296
###
# start gene g297
Scaffold_6	AUGUSTUS	gene	1289030	1289905	0.81	+	.	g297
Scaffold_6	AUGUSTUS	transcript	1289030	1289905	0.81	+	.	g297.t1
Scaffold_6	AUGUSTUS	start_codon	1289030	1289032	.	+	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_6	AUGUSTUS	CDS	1289030	1289905	0.81	+	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_6	AUGUSTUS	stop_codon	1289903	1289905	.	+	0	transcript_id "g297.t1"; gene_id "g297";
# protein sequence = [MSVPSIDFLVHALSSLLPDFIKLKLEQNRSDSTILPVRLVVIDALGELFHSSGKTSTQTLVQRAQNVTEISAHLHSVA
# SKFGIVVIVLNEVVDAFDREPDNEETPTTGLSYAEQSKWFARAHSLPGENRKEASLGLVWANQVNARIMMSRTGRRRYTNFGQSATQKRQKTSNGHHT
# GNTPTEDPERLELVRRLSIVFSSASDPGSLDYVVDSAGITVLQEEEQGSSRKTTANEPTALPSVALPPTMSSSQIAPLDAGVVESETAVRIDLPPEPN
# GAPDDEDEWEAFWERTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g297
###
# start gene g298
Scaffold_6	AUGUSTUS	gene	1295177	1295518	0.46	-	.	g298
Scaffold_6	AUGUSTUS	transcript	1295177	1295518	0.46	-	.	g298.t1
Scaffold_6	AUGUSTUS	stop_codon	1295177	1295179	.	-	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_6	AUGUSTUS	CDS	1295177	1295518	0.46	-	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_6	AUGUSTUS	start_codon	1295516	1295518	.	-	0	transcript_id "g298.t1"; gene_id "g298";
# protein sequence = [MSNYADGSTVVGDDSRDQQDFLKSKPKVNDDLLPNPVSPKKRVGHPFVNSIETELEERPFFVRIGKDGLIAALQKLDR
# QLAEVCIYEYHLQQTQLSDFFQIVWEAQITFEEGM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g298
###
# start gene g299
Scaffold_6	AUGUSTUS	gene	1296792	1298849	0.64	+	.	g299
Scaffold_6	AUGUSTUS	transcript	1296792	1298849	0.64	+	.	g299.t1
Scaffold_6	AUGUSTUS	start_codon	1296792	1296794	.	+	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_6	AUGUSTUS	CDS	1296792	1296944	0.76	+	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_6	AUGUSTUS	CDS	1297086	1297366	0.76	+	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_6	AUGUSTUS	CDS	1297478	1298849	0.94	+	1	transcript_id "g299.t1"; gene_id "g299";
Scaffold_6	AUGUSTUS	stop_codon	1298847	1298849	.	+	0	transcript_id "g299.t1"; gene_id "g299";
# protein sequence = [MKRAQEVIAPYRDPAAGIPDPSFVLQLPDEIYSGSNLYAVQKFFDGEFQFDRFNKVFPTPSDYSSKSNKDALETFSQA
# ITSNLIGGVGYFYGNSIINEKFSYEWDEDDEAEDRSASDEKGPRLTEPKKLLTATPSRSFFPRGFYCISSRCVALEDNVYHSLEILKDWIDLIDDNGW
# VAREQILGEEARSKVNLSSFISSCIAILYSTQVPAEFLTQVPNYANPPTLTVAVTAFINRVKIASLGPSDADLGMDFGMGSSQTPLTEVKTEPGNRSL
# DPEVATAFLKGIYKPLKRHYDWFRRTQRGQIKQYGRKARSRTEAYRWRGRSDKHVLTSGMDDYPRGPPHAGELHLDLISWMALFSRTMREIAEFIGEN
# DDAISYGEIEKAILDNIEGELAFSRSIGIMGWSSLLDLHWNEEQQMYCDANVDDDGELTSSSFCIYHTDSDCTVGLSDESYHVCNKGYLSLFPFMLSL
# LSPDSPHLGAILDVVRDPEQLWSDYGLRSLSASHPEYGTGENYWKGPIWVQMNYLVLGALHNRYAVEEGPYKLRAQEIYRELRKNIIDNVFKVTVQLS
# SCQIFAEPSCKEYERTGYVWEQYDPNTGYGQRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g299
###
# start gene g300
Scaffold_6	AUGUSTUS	gene	1299313	1300380	1	-	.	g300
Scaffold_6	AUGUSTUS	transcript	1299313	1300380	1	-	.	g300.t1
Scaffold_6	AUGUSTUS	stop_codon	1299313	1299315	.	-	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_6	AUGUSTUS	CDS	1299313	1300380	1	-	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_6	AUGUSTUS	start_codon	1300378	1300380	.	-	0	transcript_id "g300.t1"; gene_id "g300";
# protein sequence = [MPRRSDGRSIEEVRGEEDYQDPDITIRDGNSPGNDSEIIEVIKVRRHTQDERENQLPSVSETAAKSSKSLKSRASRAF
# NSLKNVGRSVSRSRIIPEVVTSDAETSRAPSPTPSRRGSMIFSLFSHSPSLESRSSFDSFNESPPSSVTEASTPEAFDVELHSPSSAEMQGFVPYPDT
# DDDGEGEDDMETTPRAPRRHCPSPALHPSVVPSSVPRLNRRRFSVLSLFTASKDSERSDAGSSTPTSPSIPTLDSLSRDSLGPSRTDSTESSSSSGPT
# TPVDEAFPDPLPNRPSISMLKRLPSFSRSPRKKEATPLVIEPIAPNSPVALGEIGEPDLSFGEIRLDSLHFDELSFDAGRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g300
###
# start gene g301
Scaffold_6	AUGUSTUS	gene	1301179	1303371	0.48	-	.	g301
Scaffold_6	AUGUSTUS	transcript	1301179	1303371	0.48	-	.	g301.t1
Scaffold_6	AUGUSTUS	stop_codon	1301179	1301181	.	-	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_6	AUGUSTUS	CDS	1301179	1303371	0.48	-	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_6	AUGUSTUS	start_codon	1303369	1303371	.	-	0	transcript_id "g301.t1"; gene_id "g301";
# protein sequence = [MWIANDSCKLEEMSIRMGAKGLNEDGAIFGETASSYIYHSSSSVGSLTFIFRFRTHIMPSLPKTSNSTLCDTLPAPRL
# SRDSDNIMSSYADEKLEMPTLSRPVSDSPRPSVIKEPLRLTSTSLQQPPGRKLCVRHQRMADEGTNLKLQHVRTRLNSACPCTYSSQSLDALSLEERG
# AVNAIWSSFSSSSHPRRALILQGLLTMCCFSQLSLLTEQLAHLIRIDPFTVLPRELSLKVLSYLDATSLCRAAQVTKKWKSLADDDILWRGICEQHIG
# QKCHKCGWGLPVLEKKKIYHLPGSPCPSPDLPSLKRSLEDSTDLVAPPLKRQRSDVLHPSSDINPELESSSSSSSLLALTDTKPAATTRPWKDVYSER
# MTIERNWRRGRCTVRTLKGHTDGVMCLQYSETLTHPSFPVLITGSYDRTVRVWNLETGVELHCLKGHTRAIRALQFDDVKLITGSMDMTLKVWDWRRG
# RCIRTLTGHTEGVVCLNFDSNVLASGSVDATIKVWNLRTGGAFTLRGHQDWVNSVQLWDSLKTGQSSASSATPVFDVPGCGAPQIDPGKMLFSASDDG
# TIRLWDLTLRTCIKQFTGHVGQVQSIKLLLADECDEPADVEIADLDQEERTLNHVVALDSSSPSLASTSSSSFVSDQSLASRPVASTVSRTKKPLLVS
# GSLDNTTKIWDIETAQPIQTFFGHIEGVWSVSVNKMRLVSGSHDRTIKVRIPELLPFKINLILS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g301
###
# start gene g302
Scaffold_6	AUGUSTUS	gene	1310872	1311465	0.33	-	.	g302
Scaffold_6	AUGUSTUS	transcript	1310872	1311465	0.33	-	.	g302.t1
Scaffold_6	AUGUSTUS	stop_codon	1310872	1310874	.	-	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_6	AUGUSTUS	CDS	1310872	1311203	0.72	-	2	transcript_id "g302.t1"; gene_id "g302";
Scaffold_6	AUGUSTUS	CDS	1311312	1311465	0.34	-	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_6	AUGUSTUS	start_codon	1311463	1311465	.	-	0	transcript_id "g302.t1"; gene_id "g302";
# protein sequence = [MSDNYVVHELLASADQATSCDPKVMHPNEVAGEDIFCSAGDGLWREVAQGKDPCIGYVFRETAKPFRKIVILGDTCDP
# SAMTPLCLDPSPSLLIHEAADAHIPQEIDPKSKRSYDVVKEKALARGHSLPEMAGAFARTIGAQKLVLNHLGGRQASQCSSIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g302
###
# start gene g303
Scaffold_6	AUGUSTUS	gene	1315151	1315462	0.38	+	.	g303
Scaffold_6	AUGUSTUS	transcript	1315151	1315462	0.38	+	.	g303.t1
Scaffold_6	AUGUSTUS	start_codon	1315151	1315153	.	+	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_6	AUGUSTUS	CDS	1315151	1315462	0.38	+	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_6	AUGUSTUS	stop_codon	1315460	1315462	.	+	0	transcript_id "g303.t1"; gene_id "g303";
# protein sequence = [MLKGNVGNSMTEYVFVISTVVRTKHSRIGYQGYDGSQAYEDYKYDANYTRQGPGFPQDQSGRGGGPGHPKKRLQPSEP
# SPHVIFLGLDPDFTESDVCNIHSFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g303
###
# start gene g304
Scaffold_6	AUGUSTUS	gene	1319521	1320811	0.98	-	.	g304
Scaffold_6	AUGUSTUS	transcript	1319521	1320811	0.98	-	.	g304.t1
Scaffold_6	AUGUSTUS	stop_codon	1319521	1319523	.	-	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_6	AUGUSTUS	CDS	1319521	1320381	0.98	-	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_6	AUGUSTUS	CDS	1320467	1320811	0.98	-	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_6	AUGUSTUS	start_codon	1320809	1320811	.	-	0	transcript_id "g304.t1"; gene_id "g304";
# protein sequence = [MSSKITPNTVSPPKKVRVGVLGATGTVGQRFITLLSEHPWFIIEALGASERSKGRKYREAVKWKQTIPLGGLGLGGVG
# TSETEKISSSDLRSDEGRAADLIVKGCTPEEFKTCQLSLEYAFRAANIPLFSNAKNYRRDPHVPLIVPLVNPSHFSIIPQQQSLHSPPLSKGFIVTNA
# NCSTTGYVIPLAALEKAFGPIESVLVTTMQAISGAGYPGVPSLDILGNVVPYIGGEEEKIEWETLKILGGITDSENETDKNGAPLKTFDMHQAGGRPA
# LRVSASCNRVPVVDGHMECVSLRFHRRPPPSPQQVREALSVFTPEIQSLGCPSSPRKAIEVFEEPDRPQPRLDVKGTHNGAGVSVGRVRQCQVLDIKF
# VVLSDNVSIGAATSSIINAEYAVLKGIVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g304
###
# start gene g305
Scaffold_6	AUGUSTUS	gene	1322643	1324589	0.18	+	.	g305
Scaffold_6	AUGUSTUS	transcript	1322643	1324589	0.18	+	.	g305.t1
Scaffold_6	AUGUSTUS	start_codon	1322643	1322645	.	+	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_6	AUGUSTUS	CDS	1322643	1322825	0.53	+	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_6	AUGUSTUS	CDS	1322967	1323444	0.35	+	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_6	AUGUSTUS	CDS	1323763	1324589	0.5	+	2	transcript_id "g305.t1"; gene_id "g305";
Scaffold_6	AUGUSTUS	stop_codon	1324587	1324589	.	+	0	transcript_id "g305.t1"; gene_id "g305";
# protein sequence = [MRYLASVNPPDANSKAKLKLSLDDSSEIEKQILATNPILESFGNAKTTRNDNSSRFGKYIQPLTERNYHIFYQLCAGA
# PLKERKDLGLDTDITKFHYLKQGGPSSTPIAGVDDAEEFRATQQALSVVGISVEKQWAVFRLLAALLHLGNIKITQLRNDSSIDDNDPALLLSTRFLG
# VNVAEFKKWTVKKQIITRSEKIVTSLNGAQATVVRDSVAKFVYAXEYVKEEINWTFIDFSDNQPCIDVIEGKLGVLALLDEESRLPSGSDQSFLQKLN
# NQLLKPQNKVFKKPRFGNTAFTIAHYALDVTYEVEGFLEKNRDTVPDEHMTLLATTKNSFLKEVLDAALNSTKAPDSPNPGSPAGSDSGSGSRRSSVI
# PDPGRQSWVAPSSGATPSASSGPKRPGGFVARKPTQGSIFKASLITLMETLSVTNVHYIRCIKPNEAKRPWEFQPQQVLSQLRACGVLETIRISCAGY
# PTRWTYEEFAERYDQSLILTFSRRC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g305
###
# start gene g306
Scaffold_6	AUGUSTUS	gene	1325213	1326420	0.49	+	.	g306
Scaffold_6	AUGUSTUS	transcript	1325213	1326420	0.49	+	.	g306.t1
Scaffold_6	AUGUSTUS	start_codon	1325213	1325215	.	+	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_6	AUGUSTUS	CDS	1325213	1325224	0.57	+	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_6	AUGUSTUS	CDS	1325278	1326420	0.6	+	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_6	AUGUSTUS	stop_codon	1326418	1326420	.	+	0	transcript_id "g306.t1"; gene_id "g306";
# protein sequence = [MSLISCVRRRLARKQLKVLRQEARSVSKFKEISYKLENKVVELTQTLQTRTQERKDLQAQVTELEQRIQHWTSRHEEV
# DNRARQFQASLQAAEAEVARRDELLLAKADTEKRLEEALAKVFEKEETIQKLTDDLLAKSTQLEHQQRTIDANPVRTQEDSSVIMTLKNEVSNLREQL
# NRSNALNALTRGSRADPPLSPTFAPALRGAETNGAVPAANGHAPQGHQRRHSSAGVYSLAPLDNRSSTDEIMIDVKRSQAMNPRAVSVVYNGEDNFFK
# FHKNGLSGIRDDDPAEEKIRLMQDVKRLDEDILDGLIRGLKIPAPSLTNPSAVKEILFPANLISLVTNEMWKYGLIPESERFLANVMQTIQSHVMVNL
# TDILREVANKIH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g306
###
# start gene g307
Scaffold_6	AUGUSTUS	gene	1326787	1327327	0.79	+	.	g307
Scaffold_6	AUGUSTUS	transcript	1326787	1327327	0.79	+	.	g307.t1
Scaffold_6	AUGUSTUS	start_codon	1326787	1326789	.	+	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_6	AUGUSTUS	CDS	1326787	1326952	0.79	+	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_6	AUGUSTUS	CDS	1327008	1327327	1	+	2	transcript_id "g307.t1"; gene_id "g307";
Scaffold_6	AUGUSTUS	stop_codon	1327325	1327327	.	+	0	transcript_id "g307.t1"; gene_id "g307";
# protein sequence = [MDDILNLLNKVWKSLKSYYMEESVVQQVVTELLKLIGVTSFNDLLMRRNFSSWKRAMQIQYNITRIEEWCKSHDMPEG
# TLQLEHLMQATKLLQLKKVRSASVMHGNLKLILFYQATAADIEIIYDVCWMLSPMQIQRMCTNYYVADYEVASLLFSKIDDFH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g307
###
# start gene g308
Scaffold_6	AUGUSTUS	gene	1328100	1329324	0.07	+	.	g308
Scaffold_6	AUGUSTUS	transcript	1328100	1329324	0.07	+	.	g308.t1
Scaffold_6	AUGUSTUS	start_codon	1328100	1328102	.	+	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_6	AUGUSTUS	CDS	1328100	1328785	0.28	+	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_6	AUGUSTUS	CDS	1328949	1329324	0.33	+	1	transcript_id "g308.t1"; gene_id "g308";
Scaffold_6	AUGUSTUS	stop_codon	1329322	1329324	.	+	0	transcript_id "g308.t1"; gene_id "g308";
# protein sequence = [MITHIPMASHPNPEKVLVIGGGDGGVVREALKYDSVKEVVLCDIDEAVPRVSKLYLPHMAELLADPRVTVHIGDGFAF
# LQSHEGTYDVIVTDSSDPVGPAASLFQKPYYQLLHDALRSGGHIAAQGECLWLHLPLIKEVRANAQEIGFAHVEYAFTTIPTYPSGQIGFLLAGKTGG
# QGLREPIKGPNSPTRYWNPDVHRASFVVPEFARALLEEGKDVSPKFGTNVSLQTLATAKGLAESLPRTNAISLDVNKTDELESQVAAHDLVISLIPYT
# YHAEVIKAAIKGKTDVVTTSYVSPAMRELDEAAKAAGITVLNEIGLDPGIDHLYAVKTIDEVHAKGGKVSLHPFFHCIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g308
###
# start gene g309
Scaffold_6	AUGUSTUS	gene	1329503	1330267	0.3	+	.	g309
Scaffold_6	AUGUSTUS	transcript	1329503	1330267	0.3	+	.	g309.t1
Scaffold_6	AUGUSTUS	start_codon	1329503	1329505	.	+	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_6	AUGUSTUS	CDS	1329503	1330267	0.3	+	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_6	AUGUSTUS	stop_codon	1330265	1330267	.	+	0	transcript_id "g309.t1"; gene_id "g309";
# protein sequence = [MGEAKPYYISPAYAFVAYPNRDSTPFRDFYKINGEGEGETCIRGTLRYQGFPEFIKALVQVGWLNGEGQEWLNKGLTW
# VQVLGKMLAVEGGDEATLISKIKSLCAFPNESEESRIISGFRWIGMFTSDPISPRAASGAAHPNLLDTLCARLEQLMAYAPGERDFVMLQHKFVVEWA
# DKSVQTLTSTLEAYGAPLGYGHSAMALTVGLPCGIATQLILDGVLNMKGVHAPYTREICDPIRERLEAEGVGLVESVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g309
###
# start gene g310
Scaffold_6	AUGUSTUS	gene	1331287	1334061	0.3	+	.	g310
Scaffold_6	AUGUSTUS	transcript	1331287	1334061	0.3	+	.	g310.t1
Scaffold_6	AUGUSTUS	start_codon	1331287	1331289	.	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_6	AUGUSTUS	CDS	1331287	1332137	0.81	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_6	AUGUSTUS	CDS	1332263	1332310	0.86	+	1	transcript_id "g310.t1"; gene_id "g310";
Scaffold_6	AUGUSTUS	CDS	1332405	1332435	0.93	+	1	transcript_id "g310.t1"; gene_id "g310";
Scaffold_6	AUGUSTUS	CDS	1332524	1332865	0.36	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_6	AUGUSTUS	CDS	1332910	1334061	0.39	+	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_6	AUGUSTUS	stop_codon	1334059	1334061	.	+	0	transcript_id "g310.t1"; gene_id "g310";
# protein sequence = [MDSFFGRKKAKTRHSSVSGVTELNESASVPYDKLPSPRSPLPVGTISQGVINGGVISAPMTNPTLTSDGVELNKYMIQ
# RSRAERDKAYDLYPNHRPASPSTTVSWSDSSTAYSDSFQSKPPRDPQTARARRSEASSTSSVHSRSPNMSDFGQIPSQHPSSSSTIRPTSTMTTRSEG
# HRLSKYAPSLVASDVGSHLSHLYHPHRSHNPDEFELPRPTDDEIEALFEQVKLTRGVDDLNLPVEQKWNLVKSDLHIRWKEEKTRDEQAKRQIETGQS
# SAIIVDTPEWNSVAGSITLLKYRERLREHDIQLEYESATDKALAHPQIVTQVASSLNSPHIPTRKLLLDLLSFLTYWNEGKIQPVVVSALEVLSSSNN
# ENGGVYDFWFKSFEQTLSGRGKMGSLVGASEDVKKAGGIDTNLNDYAVGIAILSNLILIVGILDFIEDLDLRLHHRSRMESAGLHHIIALCQEFNVPN
# IDKKLRQLQGSFDEDERNLRSQLDQEILKDLNNPGDVYKAIFAKIESSKARDYFLSMMQHLLLIREEGEPMVHYYQLIDSMVTDIVMDKKLAGAEQRF
# GHSVERIIAQFNETGRLQEVEDELQKSRSEALRLKLENDALLDEISKGQEGMVGRLKEEMLRLEQKLATSRETTARLQNQVESERAEYEDQINQLETQ
# IIELFRMLKEVGRGVTTVLDTGGMDRKTLVQTLEKQFQRTQTINKLEGKDVFGRRRKKEGGFEESDDDDREDTPGKSSLRRSRVLTSKKSLSKKGDKA
# EDSNRASQFMDAEDAHAEEQIQQQLNAGASFVSVNVSFEWFNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g310
###
# start gene g311
Scaffold_6	AUGUSTUS	gene	1334274	1335012	0.9	+	.	g311
Scaffold_6	AUGUSTUS	transcript	1334274	1335012	0.9	+	.	g311.t1
Scaffold_6	AUGUSTUS	start_codon	1334274	1334276	.	+	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_6	AUGUSTUS	CDS	1334274	1334287	0.92	+	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_6	AUGUSTUS	CDS	1334442	1335012	0.9	+	1	transcript_id "g311.t1"; gene_id "g311";
Scaffold_6	AUGUSTUS	stop_codon	1335010	1335012	.	+	0	transcript_id "g311.t1"; gene_id "g311";
# protein sequence = [MYQPPLPVTTLCPDCSSPPPPPPPPPPPPPPPPPPPPPLAAGGFPAPPPPPPPPPIGFKGFPGSAPSSSSSSLASSPA
# PPPPPMPGSARSNTSFGSNPNSARASMLLGANPLSARKDLPITPNIKMKQLQWDKLPQQQVAKTVWNEDQPSRENEMIKILKDDGVWMEMEEDFKAKQ
# LVINLMGKLHCSNLYLNY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g311
###
# start gene g312
Scaffold_6	AUGUSTUS	gene	1336401	1336799	0.46	+	.	g312
Scaffold_6	AUGUSTUS	transcript	1336401	1336799	0.46	+	.	g312.t1
Scaffold_6	AUGUSTUS	start_codon	1336401	1336403	.	+	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_6	AUGUSTUS	CDS	1336401	1336799	0.46	+	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_6	AUGUSTUS	stop_codon	1336797	1336799	.	+	0	transcript_id "g312.t1"; gene_id "g312";
# protein sequence = [MRENREKAAAANNESDDVLDSLLEKLRNGEGGRKSRRTRGTAEAQPAIPLTLQLDSSAVNDTADIARDMLAQLQSNGF
# APMPSPTATSNPSTRRRTRRRMEAPTSDSLLDLRTPTSPLAVEVELDLGSETDS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g312
###
# start gene g313
Scaffold_6	AUGUSTUS	gene	1342757	1345427	0.16	+	.	g313
Scaffold_6	AUGUSTUS	transcript	1342757	1345427	0.16	+	.	g313.t1
Scaffold_6	AUGUSTUS	start_codon	1342757	1342759	.	+	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_6	AUGUSTUS	CDS	1342757	1343492	0.47	+	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_6	AUGUSTUS	CDS	1343615	1344053	0.31	+	2	transcript_id "g313.t1"; gene_id "g313";
Scaffold_6	AUGUSTUS	CDS	1344182	1345427	1	+	1	transcript_id "g313.t1"; gene_id "g313";
Scaffold_6	AUGUSTUS	stop_codon	1345425	1345427	.	+	0	transcript_id "g313.t1"; gene_id "g313";
# protein sequence = [MRPREREFLLFSDCLVWLANEEAEKKEKEWNFELDLGSIWSSFMGSGTSSSEKSVGVQRPRSAALVKSTPLIVEEEFD
# IDTIDKPDDYNSLDHKTHVIPASAIPRNLKRPPMVRTRSKSEAELPALQGKAAVPSTSHDSPPSSAQTQSALAVDKNARRITHQSNFSRTNKNPVLHI
# HGRGRKDSSTSPGYGGMDQDQWLYKGRIELVNLEIVVDTSFTVEDELEELGSDTLNEIKWRWEVLSPEGTKSQQLVALNAQRPNSTLTSSEATQHIRR
# ALQALPFAPNDVRMQGSKVEKRLSKGSVDSGDGASVDGMKEGIKKGKERLNSSKKHRKSRSKDQKVSNPDWHKERRLKSSIGFRRSGFPMKRQRDACA
# VEGYSDGGEGDTIADFVGDVKSARACNACYESVFPLIDHHSDPENKADDSTVRSRSHPPLAHSSVSDSTSSFLPPSTSAMTYVSNTDTITSLSHLPSW
# MTMSVPSLALSSSSNNIGGGARIKSKGKELSGPEALMAIDSKRYGYDLEARRQSDNLGENRSRRDSGVVFDLDSSTDDIALDDVVQPLRRGSRIKLRS
# QSSSGSRPRSFIEVFQSTGGGDTPQPQTLMQSTSPLEEMAEFNEDTIARLAYVDGEDSSVLSSSSVNSSRRHTTINLSTSSSSVSLSISPPISSGELN
# VQGRSLLYNASLAERREDTVRRNKRFSMPAVALQTTSVVARTQSMSPETSGMVSREKSVAFVDSGSPLGRDQDGKRVTGNKIGDLLPGMSGTRSKRFS
# LVLEGVLDTRLVFTLVVAMTMHLQAVDSKAGVTPKKHRKGQI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g313
###
# start gene g314
Scaffold_6	AUGUSTUS	gene	1346050	1346820	0.88	+	.	g314
Scaffold_6	AUGUSTUS	transcript	1346050	1346820	0.88	+	.	g314.t1
Scaffold_6	AUGUSTUS	start_codon	1346050	1346052	.	+	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_6	AUGUSTUS	CDS	1346050	1346820	0.88	+	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_6	AUGUSTUS	stop_codon	1346818	1346820	.	+	0	transcript_id "g314.t1"; gene_id "g314";
# protein sequence = [MPKASAKTFLLPSTSSVIFYKTQRSGAIERERDVILREQQEVDKQLEEVVFDHLHAVAFQGQPLGRTILGPKNNILSI
# QRDDLASYIQTNYTADRMVLVGTGGVDHQSLVKLAEKHFSSLPVSANPLALGRLSSERKPTFVGSEARIRDDELPTAHVAIAVEGVGWSSPDYFPMMV
# MQSIFGNWDRSLGASSLLSSRLSHIISSNSLPTHSCPSHLLLGHRTLGYLSCFRKPDEPGRHAALYAQRMDEDEHCPYRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g314
###
# start gene g315
Scaffold_6	AUGUSTUS	gene	1347439	1349277	1	+	.	g315
Scaffold_6	AUGUSTUS	transcript	1347439	1349277	1	+	.	g315.t1
Scaffold_6	AUGUSTUS	start_codon	1347439	1347441	.	+	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_6	AUGUSTUS	CDS	1347439	1349277	1	+	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_6	AUGUSTUS	stop_codon	1349275	1349277	.	+	0	transcript_id "g315.t1"; gene_id "g315";
# protein sequence = [MQHDNRSVPYLPSERAPDTVPPLPTYEAAVESFSNLAINDARRDPIPRSTSSMSMRSLQSIQPPQHQRMMDPSRHANG
# LPPAPNYARTHANHEPISPRRDNYPESDRMTVSSHDDQSIASPDSFSSSQSTQSWAGYAQPLQHGWPSNGYDPYMSAASSVLGMAPPPGQQYPPSQGP
# YNPNLQYHQYANSQVSLGSNHSGSYAAGYAASVASFPPPNGRATLPPVSDTASEIEPRPSLARGESLLPATNKSKAVDLSTPPYTKQYIDSYRQRIKG
# DPDPEAHFLYAKYLIDAARKIRTSSKDQRSAKKYSELLIGEALKVVRRLATQGDAYAEAQFFLANCFGTGALGLQVDHERAYHLYLQAAKQNHAAASY
# RVAVCNEIGAGTRKEPPRAAAFYRKAASLGDTAAMYKLGMILLQGLLGEAKNPREAVGWLRRAAEQADEENPHALHELGLLYEMPNSGLVPHDPIQAK
# NLFTQAAHLGYTQSQYKLGQCYEYGALSCPVDPRRSIAWYTKAAEKGDPEAELALSGWYLTGSEGVLKQSDNEAYLWARRAANKGLSKAEYAVGYYAE
# VGIGINQDIEFAKRWYMRAAGMWCNAVSRPILLLILVDDICSSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g315
###
# start gene g316
Scaffold_6	AUGUSTUS	gene	1350529	1351209	0.28	-	.	g316
Scaffold_6	AUGUSTUS	transcript	1350529	1351209	0.28	-	.	g316.t1
Scaffold_6	AUGUSTUS	stop_codon	1350529	1350531	.	-	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_6	AUGUSTUS	CDS	1350529	1351209	0.28	-	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_6	AUGUSTUS	start_codon	1351207	1351209	.	-	0	transcript_id "g316.t1"; gene_id "g316";
# protein sequence = [MEGKEIKDDSFRRMEGSQVGLEWVEENESAMKEPIVIESPEGLGMNMPDENFTVDDVGLLVGEKNPIEVIGMFIPFSA
# RMADNHNRTTDVASQANAPGWTVGQWVEYYNLEPHQRDKIFNVISLEISGTLLADRILPPRLVRELDWVENFWPSTRKGKGHTYPKVQLYCLMGVQGA
# WTVSLVIFSSTHVLILPDNRIGILTLLAPLFTTTSCTAPKYYFNHAQNLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g316
###
# start gene g317
Scaffold_6	AUGUSTUS	gene	1351381	1351689	0.69	-	.	g317
Scaffold_6	AUGUSTUS	transcript	1351381	1351689	0.69	-	.	g317.t1
Scaffold_6	AUGUSTUS	stop_codon	1351381	1351383	.	-	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_6	AUGUSTUS	CDS	1351381	1351689	0.69	-	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_6	AUGUSTUS	start_codon	1351687	1351689	.	-	0	transcript_id "g317.t1"; gene_id "g317";
# protein sequence = [MASGRRSTRSNGHNPTEGSPENDATKDQIEATNNESPETKLADDRCPACTPETIAQLDDEVNEQWAMCGACKVWYHWR
# CTGEGVDLDTIDKWSVRTTVYNNI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g317
###
# start gene g318
Scaffold_6	AUGUSTUS	gene	1351797	1353160	0.34	-	.	g318
Scaffold_6	AUGUSTUS	transcript	1351797	1353160	0.34	-	.	g318.t1
Scaffold_6	AUGUSTUS	stop_codon	1351797	1351799	.	-	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_6	AUGUSTUS	CDS	1351797	1352130	0.7	-	1	transcript_id "g318.t1"; gene_id "g318";
Scaffold_6	AUGUSTUS	CDS	1352182	1352303	0.71	-	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_6	AUGUSTUS	CDS	1352403	1352486	0.4	-	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_6	AUGUSTUS	CDS	1352654	1353160	0.69	-	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_6	AUGUSTUS	start_codon	1353158	1353160	.	-	0	transcript_id "g318.t1"; gene_id "g318";
# protein sequence = [MSHLGRPDGKVNEKYSLKPVAAELESLISKPVTFLKDCVGPEVEDAVSSASLGSVILLENLRFHIEEEGSVKNKDGTK
# TKADAAKVTEFRDGLTKLGDVYVNDAFGTAHRAHSSMVGVKLPQRAAGFLVKKELEFFAKALEKPERPFLAILGGAKVSDKILLIENMLDKIGNSLFD
# APGSEKVKGLVEKAKKNNVKLTGTASETEGIPDGWMGLDAGPKSQELFRQTVLEAKTILWNGPPGVFEFPAFSAGSKSLLDANIEAASKGAVVIVGGG
# DTATLVAQHKSEDKLSHVSTGGGASLELLEGKVRPIHSLSTVFIGSHNHSDTPRCRRAQREDLTIKQILNTEGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g318
###
# start gene g319
Scaffold_6	AUGUSTUS	gene	1353220	1354462	0.65	+	.	g319
Scaffold_6	AUGUSTUS	transcript	1353220	1354462	0.65	+	.	g319.t1
Scaffold_6	AUGUSTUS	start_codon	1353220	1353222	.	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_6	AUGUSTUS	CDS	1353220	1353278	0.67	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_6	AUGUSTUS	CDS	1353327	1353477	0.71	+	1	transcript_id "g319.t1"; gene_id "g319";
Scaffold_6	AUGUSTUS	CDS	1353857	1354462	0.77	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_6	AUGUSTUS	stop_codon	1354460	1354462	.	+	0	transcript_id "g319.t1"; gene_id "g319";
# protein sequence = [MVVTILKGIFNGGQCSYNTLSIRTYSGVGDLSILQRNVEVNTNKYAFPFEVEVSNGKLVGKGHDKEPRGVDKLSEEEL
# TERMERIRQQNEKIKQRRVVRFHYITYNEIYSPTYIQDVQADEDAFRKTQQNERAKMARIRKVQESVNNTREQNAKRKMDKIQSREWDSGKHSPGDWK
# ARNQPTQTSPPNESQEADGTSVASSQWARGGSAGRGSIRGRGRGRGSRRGGRPVTPAEVSDLPDSGEAPGAGWEPWGDIAESKPLVDESEDAVAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g319
###
# start gene g320
Scaffold_6	AUGUSTUS	gene	1359466	1360076	0.44	+	.	g320
Scaffold_6	AUGUSTUS	transcript	1359466	1360076	0.44	+	.	g320.t1
Scaffold_6	AUGUSTUS	start_codon	1359466	1359468	.	+	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_6	AUGUSTUS	CDS	1359466	1359488	0.51	+	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_6	AUGUSTUS	CDS	1359557	1360076	0.51	+	1	transcript_id "g320.t1"; gene_id "g320";
Scaffold_6	AUGUSTUS	stop_codon	1360074	1360076	.	+	0	transcript_id "g320.t1"; gene_id "g320";
# protein sequence = [MNGNSKASYGTYGVDQPINAGLDLEMPGPTRWRTPTLVNHVLTAQKLSPSTLDDRVRNMLSYIQQQARLNPEVVYGDG
# KERTRDTPEIRQFCRTLAAEGIVLLQNRNKVLPLLPNRVRKIAIVGPNAKGSVISGGGSAALKASYIITPYQGIQQGAFDDLQISYTIGCYGQSSKHY
# VKVY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g320
###
# start gene g321
Scaffold_6	AUGUSTUS	gene	1362061	1362802	0.98	+	.	g321
Scaffold_6	AUGUSTUS	transcript	1362061	1362802	0.98	+	.	g321.t1
Scaffold_6	AUGUSTUS	start_codon	1362061	1362063	.	+	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_6	AUGUSTUS	CDS	1362061	1362379	0.98	+	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_6	AUGUSTUS	CDS	1362435	1362802	1	+	2	transcript_id "g321.t1"; gene_id "g321";
Scaffold_6	AUGUSTUS	stop_codon	1362800	1362802	.	+	0	transcript_id "g321.t1"; gene_id "g321";
# protein sequence = [MDSVTKSLTSLSLNPTSVNHSSTNSPAAWRDALTANPEVPTSFELIKTLVYKPKTAKASTPVPVVVIARESVSVNSGA
# IGKRLNLKDLRLASEDLLKEFFSLDKDSLSPLALSETNFSKVVTVVDASIATTPAPLALHALTSSATVFLSSSDLLKYLRHLETENTKLQELDLQNLE
# TAAPAATPSKAPSKEKEDAKIEGAVKIAIGVKKEVDFSTWYTNVSSYDLFIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g321
###
# start gene g322
Scaffold_6	AUGUSTUS	gene	1363597	1363971	1	+	.	g322
Scaffold_6	AUGUSTUS	transcript	1363597	1363971	1	+	.	g322.t1
Scaffold_6	AUGUSTUS	start_codon	1363597	1363599	.	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_6	AUGUSTUS	CDS	1363597	1363971	1	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_6	AUGUSTUS	stop_codon	1363969	1363971	.	+	0	transcript_id "g322.t1"; gene_id "g322";
# protein sequence = [MFNIVVEDPTDPTNQRKTYVWQNSWGISTRAIGVMVMVHGDNQGLVLPPRVASIQVVVVPCGITVNTSSETRSRIESA
# CEELAKTLKKGGIKVKADLRDDKTPGYKFNDWEQKVICTFDVRFGC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g322
###
# start gene g323
Scaffold_6	AUGUSTUS	gene	1364655	1366368	0.82	-	.	g323
Scaffold_6	AUGUSTUS	transcript	1364655	1366368	0.82	-	.	g323.t1
Scaffold_6	AUGUSTUS	stop_codon	1364655	1364657	.	-	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_6	AUGUSTUS	CDS	1364655	1365991	0.99	-	2	transcript_id "g323.t1"; gene_id "g323";
Scaffold_6	AUGUSTUS	CDS	1366080	1366368	0.82	-	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_6	AUGUSTUS	start_codon	1366366	1366368	.	-	0	transcript_id "g323.t1"; gene_id "g323";
# protein sequence = [MIGTNKLPTKGDEQVIDIELDKDTVLKPAKTGYPPVKARSHWENMSNIKSSTNIKHKLDDPAPLNAVEPNIPGKLSDL
# SDYHSSQIFPSRLISRLGSDIPQNDRKMASDIPYKLPADSNQLKALIIGRRKAIEVSALHFGPWFIRSCDVQWARAKALQGAYTHHIEVLRERNPCSH
# LIPLTTGDVYAWLEDNRHFVREEPTRTQVNELDSRQDGNLVIGDYSGGKWCRVCGLGLWAHGMQGLEYMKTGAELAVVAATQAKEAEDNQPRLPRIKI
# RLLNGKVVGGGGPSVPAPPLRPEPFQCRIVDKMLQLLKMPVVDVQRIFRVHTQQGIEQTPSTVSSLNPRQLPPWSSRTHLLVRDHSTLVAAVDPRMTL
# GVRALVHPLSLRSFCLPSSPTLFPLDRLGGNAAEVEANLSPYALLALAAKQFIRVLIKEATEVEKRDKELGVGLLFETHHRDVSLLASGPSSRKYKTV
# PGTNGRKGREKEKIKIQSIKVLTPMHIITGVVSSYVRATALASVPSEGRPGVPVSSMMVVSVLLCLDACPD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g323
###
# start gene g324
Scaffold_6	AUGUSTUS	gene	1366738	1367697	0.9	-	.	g324
Scaffold_6	AUGUSTUS	transcript	1366738	1367697	0.9	-	.	g324.t1
Scaffold_6	AUGUSTUS	stop_codon	1366738	1366740	.	-	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_6	AUGUSTUS	CDS	1366738	1367697	0.9	-	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_6	AUGUSTUS	start_codon	1367695	1367697	.	-	0	transcript_id "g324.t1"; gene_id "g324";
# protein sequence = [MCLRSPFRDVALNTLSILESSSDILFARDVIVVPPTNIAPKGRLPPKEKPITRSQKSKFLFLRSQDSHRVVLLRCSIC
# HQSTFNTLQGLYNHGRILHSTDWGSHEQCIKACAVPQEELDADLDLEGGVDVSRGMLLPGVKGLFQMAVEGTRDENPTSASSELEVNEPVGRSIHLTK
# TLGLHSDSPALAQFLGKEAKRKGIKVWDNGKHIDITTFDGKDSPLALKKSWKKRYNHRNRPLVEEGVIMTNDKRSQLAANSTSFIDSTITATSRFHIS
# CRITLTDSSLFIPEGLFSFLWFASPRSPYSQTSVSKKKKTIHING]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g324
###
# start gene g325
Scaffold_6	AUGUSTUS	gene	1367932	1368432	0.95	+	.	g325
Scaffold_6	AUGUSTUS	transcript	1367932	1368432	0.95	+	.	g325.t1
Scaffold_6	AUGUSTUS	start_codon	1367932	1367934	.	+	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_6	AUGUSTUS	CDS	1367932	1368432	0.95	+	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_6	AUGUSTUS	stop_codon	1368430	1368432	.	+	0	transcript_id "g325.t1"; gene_id "g325";
# protein sequence = [MKVIRNKEAKRLFSGKFGPTDVGGKFKQTSMAVELTDTTPPSSAIPRPDPRNLTSLPQILSSLSDFESQEAELSTSLT
# DLLAASEPITQSLSRLQSLAPQFDDLLKNASILSHNVSSTAKTAERIGGRVQSLDEEMRRIREAGDRVGQVIDLKVCYAIHTTVNIRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g325
###
# start gene g326
Scaffold_6	AUGUSTUS	gene	1369208	1369531	0.79	+	.	g326
Scaffold_6	AUGUSTUS	transcript	1369208	1369531	0.79	+	.	g326.t1
Scaffold_6	AUGUSTUS	start_codon	1369208	1369210	.	+	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_6	AUGUSTUS	CDS	1369208	1369531	0.79	+	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_6	AUGUSTUS	stop_codon	1369529	1369531	.	+	0	transcript_id "g326.t1"; gene_id "g326";
# protein sequence = [MSSIAAAARRPQAASNQDDELIDPREIDQVIIEMSGMVGRWNLFKKFLLDSFEAPDPTSASLPLESTASQMVFDEVLV
# KYYIPLEVWYVRAIIDKVILNEPRTSPDY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g326
###
# start gene g327
Scaffold_6	AUGUSTUS	gene	1369573	1369890	0.51	+	.	g327
Scaffold_6	AUGUSTUS	transcript	1369573	1369890	0.51	+	.	g327.t1
Scaffold_6	AUGUSTUS	start_codon	1369573	1369575	.	+	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_6	AUGUSTUS	CDS	1369573	1369890	0.51	+	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_6	AUGUSTUS	stop_codon	1369888	1369890	.	+	0	transcript_id "g327.t1"; gene_id "g327";
# protein sequence = [MTQSATTTTTPDDVFYILKVVLLRLSSTGSLNAVERMAEQLRDILEKDYAVVLKKKMDEVYRSAGTSGQLVRGEKADR
# ENRLAFAVSDIYIYSQLKLNPYLGYPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g327
###
# start gene g328
Scaffold_6	AUGUSTUS	gene	1370822	1371433	0.98	-	.	g328
Scaffold_6	AUGUSTUS	transcript	1370822	1371433	0.98	-	.	g328.t1
Scaffold_6	AUGUSTUS	stop_codon	1370822	1370824	.	-	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_6	AUGUSTUS	CDS	1370822	1371433	0.98	-	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_6	AUGUSTUS	start_codon	1371431	1371433	.	-	0	transcript_id "g328.t1"; gene_id "g328";
# protein sequence = [MYRNSTRCGHNFKLSDSGSKRSEVINKWQMQCEVPLECVLSNVQDYGLLDWLPQAMGAMNRGLNLPAIQRIMTEFEKE
# SSMMDMKEEMMSDAVDDVMDDEEDEEEEGDKILKEVLDEIGVSLSQQVFSTIDSYLLAHTALQLTDAPTGLASVSAHVTRQPVALGETAGAFHGGVDD
# RTGDNSGGGGASDEDALQARLDALRRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g328
###
# start gene g329
Scaffold_6	AUGUSTUS	gene	1377474	1378422	0.85	+	.	g329
Scaffold_6	AUGUSTUS	transcript	1377474	1378422	0.85	+	.	g329.t1
Scaffold_6	AUGUSTUS	start_codon	1377474	1377476	.	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_6	AUGUSTUS	CDS	1377474	1377671	0.85	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_6	AUGUSTUS	CDS	1377721	1378422	0.85	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_6	AUGUSTUS	stop_codon	1378420	1378422	.	+	0	transcript_id "g329.t1"; gene_id "g329";
# protein sequence = [MSLLFNECVPVHTGFTFYDSSIDDPDTALLGSNLWDRLLTDDHEFYISISSLSSPAIICLARRHDSAQDGLVIPRKWL
# THHKHIFGSVQYVHVTRTVPVPLTEVYVSALSPAAYDAAITHDALLESHLCSKKQILRQGSVYSIRPDALVESPSDHRLEFRLDMLEPVSQGYAEAGR
# TTLFVTSLTDTSEDEDEDGETDSSTLGLSSDDESVEISHDFLANSVVYPAYNPISPSISNPSVDLHAEGDLHFKVHALSNPVSILHDDYTVYLRTADL
# GRLGVLSGDWVRVIVIIVPGLIDAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g329
###
# start gene g330
Scaffold_6	AUGUSTUS	gene	1378891	1379274	0.51	+	.	g330
Scaffold_6	AUGUSTUS	transcript	1378891	1379274	0.51	+	.	g330.t1
Scaffold_6	AUGUSTUS	start_codon	1378891	1378893	.	+	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_6	AUGUSTUS	CDS	1378891	1379274	0.51	+	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_6	AUGUSTUS	stop_codon	1379272	1379274	.	+	0	transcript_id "g330.t1"; gene_id "g330";
# protein sequence = [MDQNRFPATPTRPNEVVFFMITNVEYKVPPNDSSNPTVDTYFGSTVGELGCWFDPDSTRMVQAGVDHSFVPDVGGYFG
# SGNIGLSKISPFFKYHSFQFEYHRSLKDRGRQLGNSHIVRRSGTPSSRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g330
###
# start gene g331
Scaffold_6	AUGUSTUS	gene	1379747	1380751	0.59	+	.	g331
Scaffold_6	AUGUSTUS	transcript	1379747	1380751	0.59	+	.	g331.t1
Scaffold_6	AUGUSTUS	start_codon	1379747	1379749	.	+	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_6	AUGUSTUS	CDS	1379747	1380751	0.59	+	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_6	AUGUSTUS	stop_codon	1380749	1380751	.	+	0	transcript_id "g331.t1"; gene_id "g331";
# protein sequence = [MVERVPSGLLVCLKHEVSFEVRRSEEELHQLSKLGFQAPDEFERYAILDILLQNTRIAPDVSLSHLAQQTAAFLPGDL
# CDLVSRAEAAAVNRAGLSLCVNRWFRCHVTYARVFSGSDQSSVFVAGLSLTNADFTQALDQARASYSESIGAPKIPSVSWDDVGGLAQVKADILDTIQ
# LPLDHPELFADGLKKRSGILLYGPPGTGKTLVAKAVATSFSLNFFSIKGPELLNMYIGESEANVRRVFQRARDAKPCVIFFDELDSIAPKRGNQGDSG
# GVMDRIVSQLLAELDGAGTTADVFVIGATNRPDLLDAALLRPGRYVYIAHIILLSRMKFD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g331
###
# start gene g332
Scaffold_6	AUGUSTUS	gene	1387040	1387669	0.98	+	.	g332
Scaffold_6	AUGUSTUS	transcript	1387040	1387669	0.98	+	.	g332.t1
Scaffold_6	AUGUSTUS	start_codon	1387040	1387042	.	+	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_6	AUGUSTUS	CDS	1387040	1387669	0.98	+	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_6	AUGUSTUS	stop_codon	1387667	1387669	.	+	0	transcript_id "g332.t1"; gene_id "g332";
# protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ
# VPIKAHQEDPIRMWSILEKQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI
# RALPEEYRHLSSNLLTVIYHHLGWHHQMGQTSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g332
###
# start gene g333
Scaffold_6	AUGUSTUS	gene	1392638	1393840	0.13	+	.	g333
Scaffold_6	AUGUSTUS	transcript	1392638	1393840	0.13	+	.	g333.t1
Scaffold_6	AUGUSTUS	start_codon	1392638	1392640	.	+	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_6	AUGUSTUS	CDS	1392638	1392940	0.13	+	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_6	AUGUSTUS	CDS	1393325	1393840	0.96	+	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_6	AUGUSTUS	stop_codon	1393838	1393840	.	+	0	transcript_id "g333.t1"; gene_id "g333";
# protein sequence = [MAPSETTSVQATAPIRQTTPVQFMTEMVRNYIDYAAMLEEKEREQNEQESDDDTDMEGTTNLGHRLHLYLYVKLSKIS
# VHPQQDFLSTTPPLNPPRNLLRLGVRIESQQAGVILSNIYAVQVNKQLQAKEAKDKGKGKTKLMGDGKAKLFTGDEFFRLCEEHEKQQKEDAENAIER
# RNFRQIHAERLAEWKKENEAIKERNKLKKADYDLAVVAWEEEKAKAKEEKRKPRWNKPKWREDFKPETLKQRPKKNVEGEEEDDESDESGDEHELN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g333
###
# start gene g334
Scaffold_6	AUGUSTUS	gene	1394116	1394972	0.66	+	.	g334
Scaffold_6	AUGUSTUS	transcript	1394116	1394972	0.66	+	.	g334.t1
Scaffold_6	AUGUSTUS	start_codon	1394116	1394118	.	+	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_6	AUGUSTUS	CDS	1394116	1394308	0.67	+	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_6	AUGUSTUS	CDS	1394389	1394972	0.91	+	2	transcript_id "g334.t1"; gene_id "g334";
Scaffold_6	AUGUSTUS	stop_codon	1394970	1394972	.	+	0	transcript_id "g334.t1"; gene_id "g334";
# protein sequence = [MMVDDCMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYSNKAKVTEVDDDGV
# TESAGSATASSLSNVLSALSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEARQVLFSRVLHVPSLNNN
# LLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLPMPIFTHREVFSHKLGQSPIKLNASCRAIRPMRCC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g334
###
# start gene g335
Scaffold_6	AUGUSTUS	gene	1401590	1402803	0.53	+	.	g335
Scaffold_6	AUGUSTUS	transcript	1401590	1402803	0.53	+	.	g335.t1
Scaffold_6	AUGUSTUS	start_codon	1401590	1401592	.	+	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_6	AUGUSTUS	CDS	1401590	1401857	0.78	+	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_6	AUGUSTUS	CDS	1401899	1402803	0.53	+	2	transcript_id "g335.t1"; gene_id "g335";
Scaffold_6	AUGUSTUS	stop_codon	1402801	1402803	.	+	0	transcript_id "g335.t1"; gene_id "g335";
# protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ
# VPIKAHQEDPIPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALIRALPEEYRHLSSNL
# LMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKGIQANKAKVTEVDDD
# GVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRHWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEARQVLFSRVLHVPSLN
# NLLSVLYSPSTKVLLYKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g335
###
# start gene g336
Scaffold_6	AUGUSTUS	gene	1403022	1403462	0.72	+	.	g336
Scaffold_6	AUGUSTUS	transcript	1403022	1403462	0.72	+	.	g336.t1
Scaffold_6	AUGUSTUS	start_codon	1403022	1403024	.	+	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_6	AUGUSTUS	CDS	1403022	1403462	0.72	+	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_6	AUGUSTUS	stop_codon	1403460	1403462	.	+	0	transcript_id "g336.t1"; gene_id "g336";
# protein sequence = [MVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPM
# KKKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGSKYNARPEIDLSKMESLKG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g336
###
# start gene g337
Scaffold_6	AUGUSTUS	gene	1403492	1405822	0.3	+	.	g337
Scaffold_6	AUGUSTUS	transcript	1403492	1405822	0.3	+	.	g337.t1
Scaffold_6	AUGUSTUS	start_codon	1403492	1403494	.	+	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_6	AUGUSTUS	CDS	1403492	1404159	0.97	+	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_6	AUGUSTUS	CDS	1404263	1404577	0.62	+	1	transcript_id "g337.t1"; gene_id "g337";
Scaffold_6	AUGUSTUS	CDS	1404665	1405141	0.46	+	1	transcript_id "g337.t1"; gene_id "g337";
Scaffold_6	AUGUSTUS	CDS	1405318	1405822	0.98	+	1	transcript_id "g337.t1"; gene_id "g337";
Scaffold_6	AUGUSTUS	stop_codon	1405820	1405822	.	+	0	transcript_id "g337.t1"; gene_id "g337";
# protein sequence = [MLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVF
# IGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNS
# PRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPVNGGKPNHPHLVEAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHN
# ADGSIERFKARLCAQGFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELALKSLQAKQVHLWFEAVPRLWSEKLCSVLVKLGFKRLESDPCVYLF
# QRGDIKVIVPVWVDDITSSKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGMQDSKPVKTPLNPNVTLSKED
# SPQTPEDKEAMINVPYIPTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVA
# SPTIIHVDNQSSIQVAKNPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPITSDDE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g337
###
# start gene g338
Scaffold_6	AUGUSTUS	gene	1408401	1409170	0.36	-	.	g338
Scaffold_6	AUGUSTUS	transcript	1408401	1409170	0.36	-	.	g338.t1
Scaffold_6	AUGUSTUS	stop_codon	1408401	1408403	.	-	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_6	AUGUSTUS	CDS	1408401	1408947	1	-	1	transcript_id "g338.t1"; gene_id "g338";
Scaffold_6	AUGUSTUS	CDS	1408992	1409170	0.36	-	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_6	AUGUSTUS	start_codon	1409168	1409170	.	-	0	transcript_id "g338.t1"; gene_id "g338";
# protein sequence = [MASVVSCGEPTKQLTPNPAMRSLSTVDQRVKTALAGPRSLAGTKRAAPESNSGSSNSIPRNHPSQLQSTYTAPPLPSP
# PEHLLNNPQIQSTLKAMAPYIKVETPFNVDRLENLLASHPNQPFVASVMRSLREGFWPFYEAEWEVESKQKLDNYVSEPQDFAALRAHRDQEVAAGRW
# SEALPEDFVLLPGMKVSPMFVVWQKGKPRVVMDHTGSGLNDNIPKAEGKSSMMICTPLVKYLMIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g338
###
# start gene g339
Scaffold_6	AUGUSTUS	gene	1412174	1412910	0.28	-	.	g339
Scaffold_6	AUGUSTUS	transcript	1412174	1412910	0.28	-	.	g339.t1
Scaffold_6	AUGUSTUS	stop_codon	1412174	1412176	.	-	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_6	AUGUSTUS	CDS	1412174	1412318	0.63	-	1	transcript_id "g339.t1"; gene_id "g339";
Scaffold_6	AUGUSTUS	CDS	1412468	1412910	0.34	-	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_6	AUGUSTUS	start_codon	1412908	1412910	.	-	0	transcript_id "g339.t1"; gene_id "g339";
# protein sequence = [MAYVHVQKDKRLHLGSHMEKCVFIGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTP
# KQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDEPIAIRRPEAMHSSEAFKWEEAMNDEISAHLQTTLG
# ISLDLPPGEKQLVNLGIPY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g339
###
# start gene g340
Scaffold_6	AUGUSTUS	gene	1413140	1414908	0.52	-	.	g340
Scaffold_6	AUGUSTUS	transcript	1413140	1414908	0.52	-	.	g340.t1
Scaffold_6	AUGUSTUS	stop_codon	1413140	1413142	.	-	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_6	AUGUSTUS	CDS	1413140	1413693	0.73	-	2	transcript_id "g340.t1"; gene_id "g340";
Scaffold_6	AUGUSTUS	CDS	1413832	1413841	0.55	-	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_6	AUGUSTUS	CDS	1413921	1414144	0.55	-	2	transcript_id "g340.t1"; gene_id "g340";
Scaffold_6	AUGUSTUS	CDS	1414224	1414908	0.99	-	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_6	AUGUSTUS	start_codon	1414906	1414908	.	-	0	transcript_id "g340.t1"; gene_id "g340";
# protein sequence = [MTGREHEASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQVPIKAHQEDPIRMWSILEQQH
# VSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALIRALPEEYRHLSSNLLMQDNLD
# KEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYSNKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTG
# ATSHMTPHRNWIRNYTPHRVPIRLADHTVSLTFGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLESSAKPDP
# VCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKILRHDKGGE
# YISKEFEKFYKMKDRSTTHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g340
###
# start gene g341
Scaffold_6	AUGUSTUS	gene	1420813	1422596	0.27	+	.	g341
Scaffold_6	AUGUSTUS	transcript	1420813	1422596	0.27	+	.	g341.t1
Scaffold_6	AUGUSTUS	start_codon	1420813	1420815	.	+	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_6	AUGUSTUS	CDS	1420813	1421094	0.29	+	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_6	AUGUSTUS	CDS	1421502	1422596	0.85	+	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_6	AUGUSTUS	stop_codon	1422594	1422596	.	+	0	transcript_id "g341.t1"; gene_id "g341";
# protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE
# LSDRLGNLEAHRKMMSDVSSIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVR
# PRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHS
# DHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPF
# QVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDSEKATGEHDSKGNFHSSMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g341
###
# start gene g342
Scaffold_6	AUGUSTUS	gene	1424547	1426102	0.26	-	.	g342
Scaffold_6	AUGUSTUS	transcript	1424547	1426102	0.26	-	.	g342.t1
Scaffold_6	AUGUSTUS	stop_codon	1424547	1424549	.	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_6	AUGUSTUS	CDS	1424547	1424900	0.31	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_6	AUGUSTUS	CDS	1425831	1425862	0.73	-	2	transcript_id "g342.t1"; gene_id "g342";
Scaffold_6	AUGUSTUS	CDS	1425929	1425932	0.73	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_6	AUGUSTUS	CDS	1426085	1426102	0.73	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_6	AUGUSTUS	start_codon	1426100	1426102	.	-	0	transcript_id "g342.t1"; gene_id "g342";
# protein sequence = [MTRVNILMITRSDEALCNKSLRDWRKVIKRSTLKFEAGRAGYHLPYHKGDPFYQGTDILFCSQQVADPVTLLKEYATA
# RDKLHGARPALFILEDGNVPTRGWFDSMFFAVLSKEFGGHSGVLGALLSMQDSDFKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g342
###
# start gene g343
Scaffold_6	AUGUSTUS	gene	1426412	1427263	0.92	+	.	g343
Scaffold_6	AUGUSTUS	transcript	1426412	1427263	0.92	+	.	g343.t1
Scaffold_6	AUGUSTUS	start_codon	1426412	1426414	.	+	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_6	AUGUSTUS	CDS	1426412	1427263	0.92	+	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_6	AUGUSTUS	stop_codon	1427261	1427263	.	+	0	transcript_id "g343.t1"; gene_id "g343";
# protein sequence = [MSSSTTISTTPSFKVLNKDNYNDWKGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQ
# QVPIKAHQEDPIRMWSILEQQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMAL
# SSVLYQREYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPTTKG
# KAFKPIKLK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g343
###
# start gene g344
Scaffold_6	AUGUSTUS	gene	1427643	1428290	0.85	+	.	g344
Scaffold_6	AUGUSTUS	transcript	1427643	1428290	0.85	+	.	g344.t1
Scaffold_6	AUGUSTUS	start_codon	1427643	1427645	.	+	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_6	AUGUSTUS	CDS	1427643	1428290	0.85	+	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_6	AUGUSTUS	stop_codon	1428288	1428290	.	+	0	transcript_id "g344.t1"; gene_id "g344";
# protein sequence = [MEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYGDVSKLSKNKMVEGFKLE
# SSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFKRFKAWAEKVTGLKVKIL
# RHDKGGEYISKEFEKFLQDEGSKYKYTHGQKSTSAKWSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g344
###
# start gene g345
Scaffold_6	AUGUSTUS	gene	1428328	1429002	0.25	+	.	g345
Scaffold_6	AUGUSTUS	transcript	1428328	1429002	0.25	+	.	g345.t1
Scaffold_6	AUGUSTUS	start_codon	1428328	1428330	.	+	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_6	AUGUSTUS	CDS	1428328	1429002	0.25	+	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_6	AUGUSTUS	stop_codon	1429000	1429002	.	+	0	transcript_id "g345.t1"; gene_id "g345";
# protein sequence = [MLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVF
# IGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNS
# PRLEHTPGPDIPVTEDESDEPIAIRRPYELGNLRVNGGKPNHPSRVPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g345
###
# start gene g346
Scaffold_6	AUGUSTUS	gene	1431177	1432145	0.63	-	.	g346
Scaffold_6	AUGUSTUS	transcript	1431177	1432145	0.63	-	.	g346.t1
Scaffold_6	AUGUSTUS	stop_codon	1431177	1431179	.	-	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_6	AUGUSTUS	CDS	1431177	1432145	0.63	-	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_6	AUGUSTUS	start_codon	1432143	1432145	.	-	0	transcript_id "g346.t1"; gene_id "g346";
# protein sequence = [MDHTGSGLNDNIPKAEGKVKYDDMHTFGQVLNDILKEHPDEELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIV
# RRLVFGTRTSPRCWCSLSSLMCWFGSEKLGIIGLHVYMDDFYGWDFKRNLLLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKIIGFWVDIVK
# GSISLSSESIQGLVADITSFLSSPKRQAALRDWQHLAGSLNWSLNVLPWARPALTEMYRKMSGKTLQFRAIPINGEVYRDLTWFSDLLQTAIGIRFVD
# AQRWHDSEADFVGWTDASNIGLSYVYAGNGFCYQLHPTEGSVEGDCTC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g346
###
# start gene g347
Scaffold_6	AUGUSTUS	gene	1432696	1434397	0.42	-	.	g347
Scaffold_6	AUGUSTUS	transcript	1432696	1434397	0.42	-	.	g347.t1
Scaffold_6	AUGUSTUS	stop_codon	1432696	1432698	.	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_6	AUGUSTUS	CDS	1432696	1433806	0.43	-	1	transcript_id "g347.t1"; gene_id "g347";
Scaffold_6	AUGUSTUS	CDS	1433928	1434397	0.99	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_6	AUGUSTUS	start_codon	1434395	1434397	.	-	0	transcript_id "g347.t1"; gene_id "g347";
# protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSSTQISLDKGKGRAQPAQSTSYIASRPSPELR
# SVRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPLQDRISAAPRLLILEQVRLTAEALGQVVEQASRERVAAAKAARVAAAAA
# SKSRISDGPLVSTEKAVNEAAWALMERELAENALQLASAEAEADQMEQDAHSGQKQLFATSSSQTCWSNSELLLSWYILWTPSQSSGGSSSSLCTHSS
# DILSPTVSETWKLRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFEKIHASITSYTSIFDDSTTFGSEYKLVKKEHSIRSLPVTSEAQ
# WLRVFDAWLAPVLKIYPHRQSELSAYKASIMEFFRAAPSDPSIAFRVDREARQKASNTPFDLGNAENFRLLLLKELLSARKRPSSSPSTSSASKRQDT
# PCILWNEGKCTSPCPNRRKHGFCSVCGEPHKAVDSQSCYEKLKHSRSEGKNRSGRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g347
###
# start gene g348
Scaffold_6	AUGUSTUS	gene	1436730	1437746	0.74	+	.	g348
Scaffold_6	AUGUSTUS	transcript	1436730	1437746	0.74	+	.	g348.t1
Scaffold_6	AUGUSTUS	start_codon	1436730	1436732	.	+	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_6	AUGUSTUS	CDS	1436730	1437746	0.74	+	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_6	AUGUSTUS	stop_codon	1437744	1437746	.	+	0	transcript_id "g348.t1"; gene_id "g348";
# protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAALLTKLTSNVPFEWNEKCDKAMDELKDGIGDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPN
# ATINHWIEHVRNYHFTLIHVKGATHGSDGLSRITPGGWQTKRPEVNPDDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEANDI
# ELDVQEALDEERSYEIRRNHMLESKNATCEVFSRNLFPTFDEEFVKTIHTQKHIDLLRVIDWTT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g348
###
# start gene g349
Scaffold_6	AUGUSTUS	gene	1440044	1441499	0.22	-	.	g349
Scaffold_6	AUGUSTUS	transcript	1440044	1441499	0.22	-	.	g349.t1
Scaffold_6	AUGUSTUS	stop_codon	1440044	1440046	.	-	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_6	AUGUSTUS	CDS	1440044	1440471	1	-	2	transcript_id "g349.t1"; gene_id "g349";
Scaffold_6	AUGUSTUS	CDS	1441101	1441272	0.22	-	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_6	AUGUSTUS	CDS	1441332	1441499	0.6	-	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_6	AUGUSTUS	start_codon	1441497	1441499	.	-	0	transcript_id "g349.t1"; gene_id "g349";
# protein sequence = [MPVHHKKDLDVARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLCSHVRQISNLTARQSI
# IDTLCLGHKLFPDIVSDSHFEQHLKFMAFANDARVLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRACIAK
# VIADKACSILKSRQDSGSDSSGSDASFATAQSIPTTGSEDTVVTPTEIAVPVLKTVERATTPFTHGVTPMMEDKGHISA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g349
###
# start gene g350
Scaffold_6	AUGUSTUS	gene	1447067	1449168	0.31	-	.	g350
Scaffold_6	AUGUSTUS	transcript	1447067	1449168	0.31	-	.	g350.t1
Scaffold_6	AUGUSTUS	stop_codon	1447067	1447069	.	-	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_6	AUGUSTUS	CDS	1447067	1447825	0.49	-	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_6	AUGUSTUS	CDS	1447942	1449168	0.62	-	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_6	AUGUSTUS	start_codon	1449166	1449168	.	-	0	transcript_id "g350.t1"; gene_id "g350";
# protein sequence = [MTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLH
# AAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIG
# YAQVNPHNFVLSLLTNNSLRLFELPSGRPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVL
# RYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQ
# AIFIPTHDTITSEQLAELFVIHVFSKHGVLIMLLPIVTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKS
# DLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRFTGFP
# RLTAGAGYAESFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g350
###
# start gene g351
Scaffold_6	AUGUSTUS	gene	1451462	1451986	0.89	-	.	g351
Scaffold_6	AUGUSTUS	transcript	1451462	1451986	0.89	-	.	g351.t1
Scaffold_6	AUGUSTUS	stop_codon	1451462	1451464	.	-	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_6	AUGUSTUS	CDS	1451462	1451986	0.89	-	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_6	AUGUSTUS	start_codon	1451984	1451986	.	-	0	transcript_id "g351.t1"; gene_id "g351";
# protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS
# YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAEH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g351
###
# start gene g352
Scaffold_6	AUGUSTUS	gene	1453652	1455781	0.99	-	.	g352
Scaffold_6	AUGUSTUS	transcript	1453652	1455781	0.99	-	.	g352.t1
Scaffold_6	AUGUSTUS	stop_codon	1453652	1453654	.	-	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_6	AUGUSTUS	CDS	1453652	1455781	0.99	-	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_6	AUGUSTUS	start_codon	1455779	1455781	.	-	0	transcript_id "g352.t1"; gene_id "g352";
# protein sequence = [MPLRCGSARKWREVFNKGFGAALAEGPATVLEESGQQEILSSPPQGCAVLEEREGPLSGVIVKALTPLSRGVEDLNHV
# QQEQDTNDTSQLVPPIKAPQHCRRPQVEDVLDEDPGRPWNTGESVLPIGNEEWQLTEDELDGWFREEQRLRREEAIKWQKELEIWRESRRVAWEEEEA
# QREMEWKDWLRRQRAEPGLRRWFFWRNRLKVPQPPKRLSVESPGGSSAPPLREVPAGHTSGDKCDIDPLTTDPRNHHGTCRPTGRAPEEASVTLDKVE
# GNSVEGKVDTLPEGPRVDSVGGFEVPPLRGVSVDVLLADLQNADCENIVPIQVLQTEHFSSTEPLGPDFFPDALGQSDDVNLFTRNDGKQGAFCPERV
# KEILRKVKIGPDLSDDQRTRVKRLLSEYADCFALSVGEVRPVKDAVHRLNIPEGATFPKKVRQRSLTPPQREYLHAKVDELLEAGVIERCNPEDVKCV
# SPLTLAQKAHEGMGLMVEELMHKLNDECMAAGLPTAFDLPTRPQPSDPTERAELTKPAKWRICQNFMAVNKLTEIAPMPQGNIRSKQQSLSGHNYICL
# FDFASGFYACEVERDSRPYTAFYVEGKGYFWCAKLPFGLTGAPSTFANMTARHLDDLIADGTIELFVDDGGSADDDFESMFGKLTRILERVRERDLSL
# SAAKSEFFMSEGIFAGGKVSKEGVTADPAKLTAIVEWNDLLMP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g352
###
# start gene g353
Scaffold_6	AUGUSTUS	gene	1482728	1483270	0.61	-	.	g353
Scaffold_6	AUGUSTUS	transcript	1482728	1483270	0.61	-	.	g353.t1
Scaffold_6	AUGUSTUS	stop_codon	1482728	1482730	.	-	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_6	AUGUSTUS	CDS	1482728	1483270	0.61	-	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_6	AUGUSTUS	start_codon	1483268	1483270	.	-	0	transcript_id "g353.t1"; gene_id "g353";
# protein sequence = [MSIAQTPLLGEENTPMHTNTSGGTGFESATPRHQVAFTPNPLATPLRSGTGDVSATPRDMSVGSTPLRTPLRDNLSIN
# PDGFPSIGDTPREQRLQAHSAKRALQTGFMNLPKPENNFELLVPEEEENEGGDGEDRGLVLSEEDAEERDAKLRRARGRRGGEDFVKKNSGCSTWSSS
# TCQR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g353
###
# start gene g354
Scaffold_6	AUGUSTUS	gene	1483353	1483718	0.96	-	.	g354
Scaffold_6	AUGUSTUS	transcript	1483353	1483718	0.96	-	.	g354.t1
Scaffold_6	AUGUSTUS	stop_codon	1483353	1483355	.	-	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_6	AUGUSTUS	CDS	1483353	1483718	0.96	-	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_6	AUGUSTUS	start_codon	1483716	1483718	.	-	0	transcript_id "g354.t1"; gene_id "g354";
# protein sequence = [MENKRKPDAEEAERKKRQRKNGKEGEGPGHQTKFIPARDAQIQKLKEAESISRRRKLMLPSAQVGEAELEEIVKIGQA
# GENAKALVGGGSDASGRLLSDYEGLENARMARTPRTAPQGTRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g354
###
# start gene g355
Scaffold_6	AUGUSTUS	gene	1485680	1486540	1	+	.	g355
Scaffold_6	AUGUSTUS	transcript	1485680	1486540	1	+	.	g355.t1
Scaffold_6	AUGUSTUS	start_codon	1485680	1485682	.	+	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_6	AUGUSTUS	CDS	1485680	1486540	1	+	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_6	AUGUSTUS	stop_codon	1486538	1486540	.	+	0	transcript_id "g355.t1"; gene_id "g355";
# protein sequence = [MLRRLEKGLNSAKSKAFSIDARHSSSYRDSHPSLGEPDDRYTNGVRSHPYSPPNGQFVSNLPPLNLPSYPDAASEYTA
# SSTSSRTLDANDDEDDSASDRAEDNIFPANFIQRERRRNSFFRTILNPEDAPASGPSSVRGSETYSPPQSPAAPAGLNDPVSAGIVDEEHAKVLFDLI
# FLRLNPFINLFDPSLHTVSYVRNKSPFLFTVLIMAGCKFFRPELFKQCQKLADEYAVQAFREGLKGVEVVQAFACLTYWKGHDDNVSTFQACYSSPVL
# TMLPSVRVPGPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g355
###
# start gene g356
Scaffold_6	AUGUSTUS	gene	1487862	1488218	1	-	.	g356
Scaffold_6	AUGUSTUS	transcript	1487862	1488218	1	-	.	g356.t1
Scaffold_6	AUGUSTUS	stop_codon	1487862	1487864	.	-	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_6	AUGUSTUS	CDS	1487862	1488218	1	-	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_6	AUGUSTUS	start_codon	1488216	1488218	.	-	0	transcript_id "g356.t1"; gene_id "g356";
# protein sequence = [MDKSTQINAHDFNKYLECLQTELAILMELPKDITSPLVSVPPCHPGLSKSSASIADPAPKNASVQQAYEPHPHELEEK
# KVKMITQAILNIHFHDTRKNAKEEEMPEIGQKGNGKPEIG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g356
###
# start gene g357
Scaffold_6	AUGUSTUS	gene	1491333	1491695	0.46	-	.	g357
Scaffold_6	AUGUSTUS	transcript	1491333	1491695	0.46	-	.	g357.t1
Scaffold_6	AUGUSTUS	stop_codon	1491333	1491335	.	-	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_6	AUGUSTUS	CDS	1491333	1491695	0.46	-	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_6	AUGUSTUS	start_codon	1491693	1491695	.	-	0	transcript_id "g357.t1"; gene_id "g357";
# protein sequence = [MPGIERFKIAAKQNSNKWYNGYAKLLPVASLGVVQLYDPDAKEFISHPDADEYNPVVDLYGPFAYFLSTVNVDRLEPA
# FRITPLAKDIPFANDATCDLVAIRPFSNPTVSIDTPEARDIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g357
###
# start gene g358
Scaffold_6	AUGUSTUS	gene	1496129	1496662	0.53	+	.	g358
Scaffold_6	AUGUSTUS	transcript	1496129	1496662	0.53	+	.	g358.t1
Scaffold_6	AUGUSTUS	start_codon	1496129	1496131	.	+	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_6	AUGUSTUS	CDS	1496129	1496662	0.53	+	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_6	AUGUSTUS	stop_codon	1496660	1496662	.	+	0	transcript_id "g358.t1"; gene_id "g358";
# protein sequence = [MQQSTEHLGILNHGERKRQVKRRDRLAKLEEEENNPMKVLENRTTDSKREMDILDALQDIRARNARNERVGNSADLLA
# KLDMEEIENEEDLERKRLEEEDEKLVREVFSKIPSMSADSPSEIVTVKRKADAIEPSVHSLLSESSRSLLDLKANVQHNTAKKVKKNTLGIKVVKKQK
# T]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g358
###
# start gene g359
Scaffold_6	AUGUSTUS	gene	1496900	1497550	0.49	-	.	g359
Scaffold_6	AUGUSTUS	transcript	1496900	1497550	0.49	-	.	g359.t1
Scaffold_6	AUGUSTUS	stop_codon	1496900	1496902	.	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_6	AUGUSTUS	CDS	1496900	1497550	0.49	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_6	AUGUSTUS	start_codon	1497548	1497550	.	-	0	transcript_id "g359.t1"; gene_id "g359";
# protein sequence = [MAKETLEHGIEKVEQSAHNAKEMVKEVVAEGPVVASSGHDSSELPLDQVTNTAHEFAVEDEESEDEGWASDADAALTD
# ITAAKKQRSKSPRSKTLKTGGRRRNSIRRGLMGRVMKSTDTSSSSKPSAVDELDERGRNLGHPSSVQPHSSPGSSLRHNRIDSLRTVHSQKSREQSPA
# RSIRFFDEAPSSRPGSGTTTPRHESFNLRSTLETQPNEQE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g359
###
# start gene g360
Scaffold_6	AUGUSTUS	gene	1502876	1504642	0.47	+	.	g360
Scaffold_6	AUGUSTUS	transcript	1502876	1504642	0.47	+	.	g360.t1
Scaffold_6	AUGUSTUS	start_codon	1502876	1502878	.	+	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_6	AUGUSTUS	CDS	1502876	1503465	0.47	+	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_6	AUGUSTUS	CDS	1503566	1503995	0.74	+	1	transcript_id "g360.t1"; gene_id "g360";
Scaffold_6	AUGUSTUS	CDS	1504052	1504642	0.96	+	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_6	AUGUSTUS	stop_codon	1504640	1504642	.	+	0	transcript_id "g360.t1"; gene_id "g360";
# protein sequence = [MPVPSTSRIRKTTHTTTSNIRKHAIHPRPLPSPISDPDTLATQLAETLNIEDLTKRKGKQKALCTPEQRLEAMRKINS
# ASQQLSAIAQSGWKKSLDAEHQSKSQSTTALEASSTAARCLALLRSASKGDLNVERAAMSIMVKLVALELVRPSFSYLLNNSNTREIVVRFSISSPYK
# FTLPDMWSHGGACNSLTLNTALCKDLPNYSSLIEWIPVFSSSGLSDKQLDSTLTKVYSVLMKVSASDIPPNDLFQIRMYALRCLAHTSVGTIENPESL
# WDQTCKVASALTGSLNQYSVSDAAYTVSSAFLALYTICEARADKDAFVSGNGFTSYCENWIGYASKTNDVRILQKIGQVMGQSSPPSASTDSHHTLCE
# DRDMIRQGTRLCAAFAQLLAVLEQSKQNDDSVILLFRDVRNALFPSEAGAIDPLITNLFALSMQDGVCNKDILRIAGKANRALGRVRRASLDVLAEQS
# TGKEVREECSRLLEVVIGLYENVIRTVSELYSHIFYGLRLINGIDRFPSRFRLSNTHVGYNLRTFP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g360
###
# start gene g361
Scaffold_6	AUGUSTUS	gene	1506877	1507449	0.93	+	.	g361
Scaffold_6	AUGUSTUS	transcript	1506877	1507449	0.93	+	.	g361.t1
Scaffold_6	AUGUSTUS	start_codon	1506877	1506879	.	+	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_6	AUGUSTUS	CDS	1506877	1507449	0.93	+	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_6	AUGUSTUS	stop_codon	1507447	1507449	.	+	0	transcript_id "g361.t1"; gene_id "g361";
# protein sequence = [MKNALSKSGTPLHSISSQTQPPSTSRRIGDFSQRRILSTGLEWRIGEGLLNALFSLFHAYLERGSPREAQYFAEQAKE
# LAASVNAPSGMCRAMVKNVEAKIFQGLIAEGSGQFKEIELCVINGDGDVHADLAELHRLKGDLDQRDSMVIEAQKHYEDAIKVIERVDQTFRLLDGVE
# FGYYDDSTYANFSC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g361
###
# start gene g362
Scaffold_6	AUGUSTUS	gene	1507795	1508145	0.6	+	.	g362
Scaffold_6	AUGUSTUS	transcript	1507795	1508145	0.6	+	.	g362.t1
Scaffold_6	AUGUSTUS	start_codon	1507795	1507797	.	+	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_6	AUGUSTUS	CDS	1507795	1508145	0.6	+	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_6	AUGUSTUS	stop_codon	1508143	1508145	.	+	0	transcript_id "g362.t1"; gene_id "g362";
# protein sequence = [MFLSSIGETSGCHFQFHAIAGKLTPISAIALSAGSNNLSVSVSPTSVDIAKNLEHAEKLFWSYLGALGQKGYAPDIRE
# SAMSIAIIKTFQASLGKFDAKTPLLAAGLLGKLCGVAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g362
###
# start gene g363
Scaffold_6	AUGUSTUS	gene	1508200	1509610	0.83	+	.	g363
Scaffold_6	AUGUSTUS	transcript	1508200	1509610	0.83	+	.	g363.t1
Scaffold_6	AUGUSTUS	start_codon	1508200	1508202	.	+	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_6	AUGUSTUS	CDS	1508200	1508772	0.83	+	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_6	AUGUSTUS	CDS	1508825	1509610	1	+	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_6	AUGUSTUS	stop_codon	1509608	1509610	.	+	0	transcript_id "g363.t1"; gene_id "g363";
# protein sequence = [MLEAIVNKFPLIPRHEELAWPKLSDSGVPLLNEPKTALNDSDELDEISLRDYWESVRKRHQSYSMNEETFASSMVSEL
# PRHWTVVHISVTEDKNTMFISRQRGGCQAEPLVFCIPLKGRREDAADEHLTFEDALKEMNEIVASSNETTKIAASIRHDPAARSKWWKERGALDSRLR
# ELLENIEFCWLGAFKTILSANPHLSPHAISNLRIQFDRVFQRGLRLQDRKTKERAIGHKKMPSESWTPNRVTLDDSLIECFSTLSPDCRDEELEDLVY
# FILDLYQFHGVPVAIAEIDIDQVVVDLRSVMQEHAEKLKSVGHGRTGAFGYNERDHHDEHLFLVLDKNVQGLPWENIPILRGRSVSRIPSISFLLDRV
# QFARLRQSELGSSSNTVDRAVCDPTNAYYIINPSGDLERTEERFKPWLKKMEKAGWQGISGRAPSELQVLNALRTKDLVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g363
###
# start gene g364
Scaffold_6	AUGUSTUS	gene	1511476	1512540	0.49	+	.	g364
Scaffold_6	AUGUSTUS	transcript	1511476	1512540	0.49	+	.	g364.t1
Scaffold_6	AUGUSTUS	start_codon	1511476	1511478	.	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_6	AUGUSTUS	CDS	1511476	1511792	0.89	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_6	AUGUSTUS	CDS	1511837	1512067	0.62	+	1	transcript_id "g364.t1"; gene_id "g364";
Scaffold_6	AUGUSTUS	CDS	1512168	1512540	0.7	+	1	transcript_id "g364.t1"; gene_id "g364";
Scaffold_6	AUGUSTUS	stop_codon	1512538	1512540	.	+	0	transcript_id "g364.t1"; gene_id "g364";
# protein sequence = [MFHTYDDHEIINNFSGAGNDSTLPYPSASDAFQIYNANGNPSPPQSTKSLDHTPYYYDFHYGDVAFFVMDTRRYRSFP
# TDPSEEKTMLGEEQLTRLLDWLGKVRAFTATFKFIVSSVPFTSLWGHDAQYDSWAGFVNEKQTILNAMYSVPNVFVITGDRHEFAAIEFAAPTQSSFA
# VTEFSTSMQSAETFTRKVVKEAPSVDAPIPAPESLPAIPSDEATVVQSDGIPVSTESSVQVPPTSSESANEHNVEKTETEFVIEEVPKERVIKYIPEG
# NYKWSSIEVDTRKPERPTLNLEVVIDGKPSYQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g364
###
# start gene g365
Scaffold_6	AUGUSTUS	gene	1513467	1514807	0.21	-	.	g365
Scaffold_6	AUGUSTUS	transcript	1513467	1514807	0.21	-	.	g365.t1
Scaffold_6	AUGUSTUS	stop_codon	1513467	1513469	.	-	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_6	AUGUSTUS	CDS	1513467	1513981	0.67	-	2	transcript_id "g365.t1"; gene_id "g365";
Scaffold_6	AUGUSTUS	CDS	1514089	1514130	0.48	-	2	transcript_id "g365.t1"; gene_id "g365";
Scaffold_6	AUGUSTUS	CDS	1514246	1514807	0.5	-	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_6	AUGUSTUS	start_codon	1514805	1514807	.	-	0	transcript_id "g365.t1"; gene_id "g365";
# protein sequence = [MPFYSYIQKWLAPKQLRVPSILVALAQSVHALIPPQTLKPVVLKLANEFVHPGVGSEVIAAGINAITEICRRQPLVMG
# PRDEDEDDVMRKQKEHGQKNMDTKDGAENQLEALKLEHLEKEKAEIRKLGIDDADGKRPSDKDVDLRPLLNDLIEYRKSKDKTVIAASRGLLHLYRET
# HPEFLKKRERVPNAAVDIEGLSVRSYSGEDNNEAGWDGWDIESDSDSESDSEDGWQDVSSDSDGDIELSDSENENGEQRERNKNKGKETERQERRREK
# KEKREKQRAKEEAVKSGRGINGEIDNDEVDENEYGFSGDDQDKMDIDTEEKTETRNFDQDASTLATTKVCLQLVTPDCEIEIIFSFLDSHSSRLQIAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g365
###
# start gene g366
Scaffold_6	AUGUSTUS	gene	1522550	1523185	0.47	+	.	g366
Scaffold_6	AUGUSTUS	transcript	1522550	1523185	0.47	+	.	g366.t1
Scaffold_6	AUGUSTUS	start_codon	1522550	1522552	.	+	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_6	AUGUSTUS	CDS	1522550	1523185	0.47	+	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_6	AUGUSTUS	stop_codon	1523183	1523185	.	+	0	transcript_id "g366.t1"; gene_id "g366";
# protein sequence = [MKLFIHEILPASVKKSIYIDTDAIFISDPTLLWTVFSQLKPTTAFVMSYHPDQDSPVWHQASRICSCVMLLDLEKLRK
# LRLMDSSVYREVTDDSYPPALSPPTFRAMYGEPGPDGYKNVKLGDQGYWWAIVDSRKDIFEPLSFDFEVTSCLMDTYSITLGEDGISEVHELPRQSHV
# KGTPQEVRLHPSKGCCHELTKDAQGALIRPKVLHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g366
###
# start gene g367
Scaffold_6	AUGUSTUS	gene	1524113	1524577	0.67	-	.	g367
Scaffold_6	AUGUSTUS	transcript	1524113	1524577	0.67	-	.	g367.t1
Scaffold_6	AUGUSTUS	stop_codon	1524113	1524115	.	-	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_6	AUGUSTUS	CDS	1524113	1524577	0.67	-	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_6	AUGUSTUS	start_codon	1524575	1524577	.	-	0	transcript_id "g367.t1"; gene_id "g367";
# protein sequence = [MPTRLSREEIPRDPNDANTRSSLRSKTNIRGGAFWVWKLQVTGHLSRIVADTESRTVGNPTSNTPKRSLYRTDASPVR
# STPATPFDLLLEHKDMAVPDSPQTPTRKPGLTRIRSEGTQKVVANTSNILKSGKIVSTTVIIISDDEDDSVPAMDP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g367
###
# start gene g368
Scaffold_6	AUGUSTUS	gene	1525389	1526061	0.39	-	.	g368
Scaffold_6	AUGUSTUS	transcript	1525389	1526061	0.39	-	.	g368.t1
Scaffold_6	AUGUSTUS	stop_codon	1525389	1525391	.	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_6	AUGUSTUS	CDS	1525389	1525687	0.87	-	2	transcript_id "g368.t1"; gene_id "g368";
Scaffold_6	AUGUSTUS	CDS	1525740	1525760	0.83	-	2	transcript_id "g368.t1"; gene_id "g368";
Scaffold_6	AUGUSTUS	CDS	1525854	1526061	0.39	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_6	AUGUSTUS	start_codon	1526059	1526061	.	-	0	transcript_id "g368.t1"; gene_id "g368";
# protein sequence = [MPRKIQDFAQQSLIRPILVNVGRAGAANLDVLQVVEYVKQEAKMVYLLECLQKTPPPVIIFSENKNEVDVAIHGSKTQ
# EERQYAIKSFKSGAKDVMVASGVASKGLDFNEIQHVIIFSMPKEIEDYVHQIGRTGRSGKTGIATTFVNMNTPEQTLLDLKYLLMEAGQKWIACYFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g368
###
# start gene g369
Scaffold_6	AUGUSTUS	gene	1535283	1535525	0.83	-	.	g369
Scaffold_6	AUGUSTUS	transcript	1535283	1535525	0.83	-	.	g369.t1
Scaffold_6	AUGUSTUS	stop_codon	1535283	1535285	.	-	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_6	AUGUSTUS	CDS	1535283	1535525	0.83	-	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_6	AUGUSTUS	start_codon	1535523	1535525	.	-	0	transcript_id "g369.t1"; gene_id "g369";
# protein sequence = [MLDGRIDTQGTVADLRASGLLEDITHEAEAEAQKDTQVAVGEVADAEVEAVEGENGNQVTTEKLSKPRKLVEDEKREQ
# GG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g369
###
# start gene g370
Scaffold_6	AUGUSTUS	gene	1539488	1540063	0.88	+	.	g370
Scaffold_6	AUGUSTUS	transcript	1539488	1540063	0.88	+	.	g370.t1
Scaffold_6	AUGUSTUS	start_codon	1539488	1539490	.	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_6	AUGUSTUS	CDS	1539488	1540063	0.88	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_6	AUGUSTUS	stop_codon	1540061	1540063	.	+	0	transcript_id "g370.t1"; gene_id "g370";
# protein sequence = [MAGTSSSRRFAQAATPIPAPSKTKASSLGAGLSQTAAPKIKREEHKLEKDEQDEEIYSDADEGVEIIDMENVGQMDWM
# APDSIIKEKTKRPKKEDPDATGASCSVSLSRVLTYAVQEVNIANALDGDEDEADEKDLETMFDDFNKMNYVRLGELLPLENALSNSGSRMRTTIHNIY
# VSSNFQAHSRRSAHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g370
###
# start gene g371
Scaffold_6	AUGUSTUS	gene	1547919	1548452	0.47	-	.	g371
Scaffold_6	AUGUSTUS	transcript	1547919	1548452	0.47	-	.	g371.t1
Scaffold_6	AUGUSTUS	stop_codon	1547919	1547921	.	-	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_6	AUGUSTUS	CDS	1547919	1548132	0.61	-	1	transcript_id "g371.t1"; gene_id "g371";
Scaffold_6	AUGUSTUS	CDS	1548184	1548452	0.47	-	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_6	AUGUSTUS	start_codon	1548450	1548452	.	-	0	transcript_id "g371.t1"; gene_id "g371";
# protein sequence = [MRARTSDEKIFQAPKHRIPKQNATPIEVTKPGQHNNGNIEVVEPQTVKPLNIQPKVNVDEVLINGRRYRVPERIILLD
# FWNKISKTGGGQDADSRSSSPLTSLSSLEDEEPTHPPSPPTGSSLQSDLEVAQVSKYRCFEHLAYHLILILDALGLQTRSPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g371
###
# start gene g372
Scaffold_6	AUGUSTUS	gene	1551832	1552421	0.47	-	.	g372
Scaffold_6	AUGUSTUS	transcript	1551832	1552421	0.47	-	.	g372.t1
Scaffold_6	AUGUSTUS	stop_codon	1551832	1551834	.	-	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_6	AUGUSTUS	CDS	1551832	1552247	0.47	-	2	transcript_id "g372.t1"; gene_id "g372";
Scaffold_6	AUGUSTUS	CDS	1552298	1552421	0.52	-	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_6	AUGUSTUS	start_codon	1552419	1552421	.	-	0	transcript_id "g372.t1"; gene_id "g372";
# protein sequence = [MLQYIKRQQSHKLQAGATQEELDKLLKFPEPIPPTSPKTPPAVLKSSQDQYLCDFERTEIQDYPNVYYIGARSKKHDA
# SLDHTTNNYGYDDDRGDYLVVNHDHLAYRYEVIDTLGKGSFGQVLHCRDYCTGESVAIKIIRNKKRFHHQALVEIKILDNLRKWVCDITVMAWSTWAC
# SDM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g372
###
# start gene g373
Scaffold_6	AUGUSTUS	gene	1552481	1555892	0.11	-	.	g373
Scaffold_6	AUGUSTUS	transcript	1552481	1555892	0.11	-	.	g373.t1
Scaffold_6	AUGUSTUS	stop_codon	1552481	1552483	.	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_6	AUGUSTUS	CDS	1552481	1553401	1	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_6	AUGUSTUS	CDS	1553482	1553780	0.46	-	2	transcript_id "g373.t1"; gene_id "g373";
Scaffold_6	AUGUSTUS	CDS	1553904	1554390	0.33	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_6	AUGUSTUS	CDS	1554528	1555892	0.36	-	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_6	AUGUSTUS	start_codon	1555890	1555892	.	-	0	transcript_id "g373.t1"; gene_id "g373";
# protein sequence = [MTEESGGEEVLYPRKPSTAVPRLPDLPPADTFSSAFSISSAPVDAVVVNSPPPSAFSQPQQRKARKRSSDEFEMDQTG
# LLVTRRVSSTDRSKEEKPVSRKHRSVTATVSPPSSRDGRGKERRRESSGLTMSSSSMKLKPHSRHASLSSSSSNMGDNKRATTGADYSHLPPSPSTSS
# IQHFLKNTGAGPNTPPLSASKELGHPSPSVAHSLLRGTQEGWSGMGDEATAEALRKLDGLSGKTARARASIGSFGRPHSQSRPGTPASRTGTGTQWEG
# VGSSSDGGVKRRGSSHRESANSVKEKESRSVVGLGLGIMGPNLDVEPIGSANPSSDEQPLKYAPSITVEKTPKKSGTASARSSFTPKRGSTSSATNTS
# TPTTSSRDSVTMSAATSMTSMSSVRHSVSKTRRKSAGSDVSSIHSSDANSLKDRVASIASNGDGNEDDIVPPVPPLPKICQHITSNRRQSQPIAASEP
# PLAVPKTPSKKWSFSNALNLKLTGSPSSKSSGFPVSSQAVAFNSQQSQSHPSQLRKSTSKEQALSPSVVPAKSPWSPRHPDAMGSAASLTSLSSVGSV
# RTPAVASTANTPSLSKTPDRSAVSSRAGTNSSASTSHTYAGLSAPQTYAATSPIDSAVTTHPRTKQTSPMPDYATQSTLVPGSAHKKSSVLSLGSLLK
# SSSRKSLHGDSSKEVARELQKVRDAAKESEREAVRVDKERQKREDKEGRISTLSAADPKKPRSPPALPPMQMSALEPATAQRVARLKAPGTTATAPTA
# SSISRVASTSSRATSQTASSMQKLSDTSLRTRNQLPTIAGSPSVGTITATTKENKEPPPSTLMNTVSGNPKETPTKIPRISSRTSAISPPLKSGNTTR
# RASGLVSSTNPSPTASQSTNEFGVIENGDGPTPKMTSKTASTRNSPSAAANTSTSRVPRQVSISTSTSGSILPRKSNRESISFGLRKASTGSVASMST
# AANTSTTAMNETSTSHHRFSALSPSRGLKLLSPKISLSSARSSHASSSQSVAPAATRHLVGSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g373
###
# start gene g374
Scaffold_6	AUGUSTUS	gene	1555958	1556520	0.75	-	.	g374
Scaffold_6	AUGUSTUS	transcript	1555958	1556520	0.75	-	.	g374.t1
Scaffold_6	AUGUSTUS	stop_codon	1555958	1555960	.	-	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_6	AUGUSTUS	CDS	1555958	1556434	0.88	-	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_6	AUGUSTUS	CDS	1556509	1556520	0.8	-	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_6	AUGUSTUS	start_codon	1556518	1556520	.	-	0	transcript_id "g374.t1"; gene_id "g374";
# protein sequence = [MSSFPSVHVELAPSEEEQPVDSDYPQSRAGSATSSLDPYYFGIQSPSDSPVPPLPTSGAFSIRTPNRSPLQEPYTPAK
# DPSSIDRRGLVGVGELTTPRWTRNEQAERTPASVDDNEDYQIVASGNENDEQDVPDSPWTIEAVDGEMSEKEEVHFPFATSQCT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g374
###
# start gene g375
Scaffold_6	AUGUSTUS	gene	1566157	1566462	0.95	-	.	g375
Scaffold_6	AUGUSTUS	transcript	1566157	1566462	0.95	-	.	g375.t1
Scaffold_6	AUGUSTUS	stop_codon	1566157	1566159	.	-	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_6	AUGUSTUS	CDS	1566157	1566462	0.95	-	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_6	AUGUSTUS	start_codon	1566460	1566462	.	-	0	transcript_id "g375.t1"; gene_id "g375";
# protein sequence = [MLGVKESDTGLASPNLWDLAADRQRMSEEHPLQVARCTKIIPVDPKLAAAKAVNALGALQGQKGADEQDKYVINIRQI
# AKFVVGLGERVAPTDIEEGMRVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g375
###
# start gene g376
Scaffold_6	AUGUSTUS	gene	1568479	1568757	0.63	+	.	g376
Scaffold_6	AUGUSTUS	transcript	1568479	1568757	0.63	+	.	g376.t1
Scaffold_6	AUGUSTUS	start_codon	1568479	1568481	.	+	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_6	AUGUSTUS	CDS	1568479	1568757	0.63	+	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_6	AUGUSTUS	stop_codon	1568755	1568757	.	+	0	transcript_id "g376.t1"; gene_id "g376";
# protein sequence = [MPVAAREASIYTGITLSEYFRDQGTNVAMMADSTSRWAEALREISGRLAEMPADSGYPAYLGTKLASFYERAGKVVCL
# GNPQRQGTVSIVGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g376
###
# start gene g377
Scaffold_6	AUGUSTUS	gene	1576398	1577762	0.93	-	.	g377
Scaffold_6	AUGUSTUS	transcript	1576398	1577762	0.93	-	.	g377.t1
Scaffold_6	AUGUSTUS	stop_codon	1576398	1576400	.	-	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_6	AUGUSTUS	CDS	1576398	1577762	0.93	-	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_6	AUGUSTUS	start_codon	1577760	1577762	.	-	0	transcript_id "g377.t1"; gene_id "g377";
# protein sequence = [MSLLPQIFWCTCATLTTTVEQEFAEALKLLESLLKIVDFDDPFIIEQLLARRPLEWTGSASLQPNLLNGLRSSVTTAR
# TLRILQSLSEFKDAKIIDSSNGRVRDLYTLSLPWCLHSMIAEKTGGDKSTDDALRRFAENIGDLAKQEGRVSIHKIMTSFAKGHFRTKDDFLRQSVAS
# LREHYGVEHWTEIVTLLMGLVLNRERWLRIQSMQILKVLFQQRETRNPVELLGSELLMPLLRLLETDLASQALDVLEEPMAMSGGLAAKHVLRMSMHS
# RTLPNSQEVDSVATVFGVPEESGWSVVKADELRDACRSNLMEVFDTCSMPTRPSRIEFEPEEIEVLAEPSRVEDLGGLVQNLHDLTTFFQDDIKPTSM
# NGAVPNRRLEARVAAILAKSTAHEETVMDIPSTPFVDVFRVAGMSSDEDSDQSSVNSDEELDAFYFDSPTVYRSAPNGSHFP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g377
###
# start gene g378
Scaffold_6	AUGUSTUS	gene	1583068	1584076	0.43	-	.	g378
Scaffold_6	AUGUSTUS	transcript	1583068	1584076	0.43	-	.	g378.t1
Scaffold_6	AUGUSTUS	stop_codon	1583068	1583070	.	-	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_6	AUGUSTUS	CDS	1583068	1583993	0.93	-	2	transcript_id "g378.t1"; gene_id "g378";
Scaffold_6	AUGUSTUS	CDS	1584046	1584076	0.43	-	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_6	AUGUSTUS	start_codon	1584074	1584076	.	-	0	transcript_id "g378.t1"; gene_id "g378";
# protein sequence = [MSEGIQITIPDFDDEDYGSSTIPFGRSAGNAFGANSSGFGSAGGFGGTSSAPDSPTSITPLASALDGTERSFFSSHNR
# GDSITSIESAGSGSTRFPNYPRSATSFSTFTHSAQPSVIASSAGFNKKSSFASFRNAFKSGKSNELPPVPQLDNYVFKNPFNRSTSSLNSSSIGVTAK
# GTITTSTPFGRPPTPGSVDTRYGRAKKSHAQAKSFHSQSGSIFHASDGGSEGHGISSSPPPVPRACRISAVKLRTLKTIRSSWTQKPSDYALHAVFIR
# FASSAESKIDAFLRQPLEQDPLLPELIGPDVDPKLDETLLSLGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g378
###
# start gene g379
Scaffold_6	AUGUSTUS	gene	1598018	1598389	0.77	+	.	g379
Scaffold_6	AUGUSTUS	transcript	1598018	1598389	0.77	+	.	g379.t1
Scaffold_6	AUGUSTUS	start_codon	1598018	1598020	.	+	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_6	AUGUSTUS	CDS	1598018	1598389	0.77	+	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_6	AUGUSTUS	stop_codon	1598387	1598389	.	+	0	transcript_id "g379.t1"; gene_id "g379";
# protein sequence = [MHDLTLSFQAQNNTHIAVATPYDRNTALTNIITCEQWVVGSQGYIDVEYTLGGQAVILHPSTILAENKSPVCAGLVQT
# SQGMDDESATLSNAAFSVVRSNFLWALDSVVTVTSLSMVLCWWWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g379
###
# start gene g380
Scaffold_6	AUGUSTUS	gene	1605042	1607148	0.87	+	.	g380
Scaffold_6	AUGUSTUS	transcript	1605042	1607148	0.87	+	.	g380.t1
Scaffold_6	AUGUSTUS	start_codon	1605042	1605044	.	+	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_6	AUGUSTUS	CDS	1605042	1606101	0.89	+	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_6	AUGUSTUS	CDS	1606934	1607148	0.89	+	2	transcript_id "g380.t1"; gene_id "g380";
Scaffold_6	AUGUSTUS	stop_codon	1607146	1607148	.	+	0	transcript_id "g380.t1"; gene_id "g380";
# protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS
# YLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIK
# DEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSG
# QSGGQRPAFNHLGADGKYFPPKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDRKTIRSSXVAARAADRSSTTPTVPPL
# HPSIPEEYEFADVFDEIAADSLPEHRPYDLKIDLEEALRRLSAVFILCLKRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g380
###
# start gene g381
Scaffold_6	AUGUSTUS	gene	1608931	1609545	0.99	+	.	g381
Scaffold_6	AUGUSTUS	transcript	1608931	1609545	0.99	+	.	g381.t1
Scaffold_6	AUGUSTUS	start_codon	1608931	1608933	.	+	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_6	AUGUSTUS	CDS	1608931	1609545	0.99	+	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_6	AUGUSTUS	stop_codon	1609543	1609545	.	+	0	transcript_id "g381.t1"; gene_id "g381";
# protein sequence = [MVTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGY
# HPEADGQTESVSIRLSNSTSGSIVPTNKMTGPPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILL
# AQSRYKEQADRKRISHPEFPIGSEVCSC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g381
###
# start gene g382
Scaffold_6	AUGUSTUS	gene	1622576	1623256	0.67	-	.	g382
Scaffold_6	AUGUSTUS	transcript	1622576	1623256	0.67	-	.	g382.t1
Scaffold_6	AUGUSTUS	stop_codon	1622576	1622578	.	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_6	AUGUSTUS	CDS	1622576	1623256	0.67	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_6	AUGUSTUS	start_codon	1623254	1623256	.	-	0	transcript_id "g382.t1"; gene_id "g382";
# protein sequence = [MIAYKQQQEREKKRERERNERAREKQREERAMATGGRPTTACIERSSLPLSLQSKQFTNYFALPKYLYERRALSRYAN
# TPQRTIFFCSQLRRGQHDPRSSHLAQSSDQSPSRPEKLLNEARSFDEEPSQPYYTVLGSSKRVVAAEGVKIEDTFSPDFSLSTSNLVEGISSSMGVGL
# GLGQPSSSPQSEIPRPSTQTWERSASVTVGKPSKTSSAFGIGIGKTLSRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g382
###
# start gene g383
Scaffold_6	AUGUSTUS	gene	1628186	1628857	0.62	+	.	g383
Scaffold_6	AUGUSTUS	transcript	1628186	1628857	0.62	+	.	g383.t1
Scaffold_6	AUGUSTUS	start_codon	1628186	1628188	.	+	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_6	AUGUSTUS	CDS	1628186	1628857	0.62	+	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_6	AUGUSTUS	stop_codon	1628855	1628857	.	+	0	transcript_id "g383.t1"; gene_id "g383";
# protein sequence = [MSDSKRKEIDAFFNFFAAFDLTIPVATLADLSDGQALFEVLAVVCVFLNNIFRATCFQYTLLLITLHRDPDYFRPTTR
# FSAQDSANWVLHFSSLKRLYRLMTQYFSDVLQKPTSGLDVPDLQAMAKNADDTATLVMCRLTIAIGVQCEKNKEFIDKIQGLSQVDQHYLMKVIEQVR
# RSQSRSECGLTGTQVMSRISTSNSSDIGEASMTEYIVILTGIHTISE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g383
###
# start gene g384
Scaffold_6	AUGUSTUS	gene	1629615	1630226	0.93	+	.	g384
Scaffold_6	AUGUSTUS	transcript	1629615	1630226	0.93	+	.	g384.t1
Scaffold_6	AUGUSTUS	start_codon	1629615	1629617	.	+	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_6	AUGUSTUS	CDS	1629615	1630226	0.93	+	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_6	AUGUSTUS	stop_codon	1630224	1630226	.	+	0	transcript_id "g384.t1"; gene_id "g384";
# protein sequence = [MESYKGQIVDLENKASTRTQELETLKFELEQALTKLKIVSEERVKESETIELYQERVRELELASDTRLPKAPRTRQDS
# VETTDASGEPLSSAVEDVDDEEDAQAMGLGGELHDAESGTTMTDLKLQIRKLKRELEAVRKNEADASRVLVLENLLDDANRMKSRYEADYLAAHREKL
# VLQRDLEEIRSGKSMGDGYVLRLNGFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g384
###
# start gene g385
Scaffold_6	AUGUSTUS	gene	1632613	1633350	0.97	+	.	g385
Scaffold_6	AUGUSTUS	transcript	1632613	1633350	0.97	+	.	g385.t1
Scaffold_6	AUGUSTUS	start_codon	1632613	1632615	.	+	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_6	AUGUSTUS	CDS	1632613	1633350	0.97	+	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_6	AUGUSTUS	stop_codon	1633348	1633350	.	+	0	transcript_id "g385.t1"; gene_id "g385";
# protein sequence = [MQLGPDITGDADVVRALLARFGVTDAASPQDEQVIDIMSNLSRKATEGAVLCDVAALVRALNSFPNANINWAAIIKSF
# DVPDRHGVDTPTLKLLIAILLNCSRDTNPHAVTGFWSIWSNALYQLRLLDALLSLPGDTFNFVHLPGRRIVTVEDVAVASPTIKSLAANVQGHTWNSL
# DLFEVLVKLADSESTEIRNFVREMLDKAIKISAELVHMGLLQVPVSKWKLTRPLDILYLMCVFPGCPLE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g385
###
# start gene g386
Scaffold_6	AUGUSTUS	gene	1633432	1635618	0.38	+	.	g386
Scaffold_6	AUGUSTUS	transcript	1633432	1635618	0.38	+	.	g386.t1
Scaffold_6	AUGUSTUS	start_codon	1633432	1633434	.	+	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_6	AUGUSTUS	CDS	1633432	1633534	0.51	+	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_6	AUGUSTUS	CDS	1633653	1633863	0.51	+	2	transcript_id "g386.t1"; gene_id "g386";
Scaffold_6	AUGUSTUS	CDS	1633924	1634170	0.87	+	1	transcript_id "g386.t1"; gene_id "g386";
Scaffold_6	AUGUSTUS	CDS	1634299	1635618	0.78	+	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_6	AUGUSTUS	stop_codon	1635616	1635618	.	+	0	transcript_id "g386.t1"; gene_id "g386";
# protein sequence = [MANTTDVFDGCLSRLLSREPPQYYPHPRRGAGSQTSRREYLNLDKWLMDNVSNHGAEFLHSVLMFLEEKMQSEKTIRL
# ADPQPESRTMPLNPNTITIILRMLRNSQSQMADDDKHFWLEVKNHCLQVHPRLMSMMPNSEIEPGYSVINYSTETETEVDGIYKQMYDENTTIDEVID
# MLRRYKIPITPLIDYIPLGIAIRYIVDALNCPPETNLFKFGIQALTRFESRLHEWRPLCETLVQNSNLAEAKPDLVSTLQKDLAATADGITGDVQVPS
# VEITPVFSAIQPDVIHEVVTLPAEEIHDKILFIINNLAPSNFNTKLEEMQGLFKDEYSRWFANYLVDQRISTEPNNHSLYLRFLDSLNREKLSKFILH
# ESFVKSASMLNSERALQFGTERTNLKNVAIWLGLITLARDIPIKHKNISFKDLLIEGYESGRSIISIPFVCKVLEGCAHSKVFKPPNPWLMGVMSLLA
# EIYFFADVKLKYKFEIEVLCTLLDINLDAIEPSTILRTRPESLVGPLLPEYVTDIDSLPIGLYDPTGTGANSVGLGAEGGLVGAGDGQNMLSLGSSSP
# SDPSRALDPHIESILSTLANIAHVNSQLSPLNTQSAFKRAVALAVERAVREVSVLQWQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g386
###
# start gene g387
Scaffold_6	AUGUSTUS	gene	1636366	1637756	0.63	+	.	g387
Scaffold_6	AUGUSTUS	transcript	1636366	1637756	0.63	+	.	g387.t1
Scaffold_6	AUGUSTUS	start_codon	1636366	1636368	.	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_6	AUGUSTUS	CDS	1636366	1636772	0.83	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_6	AUGUSTUS	CDS	1637117	1637756	0.99	+	1	transcript_id "g387.t1"; gene_id "g387";
Scaffold_6	AUGUSTUS	stop_codon	1637754	1637756	.	+	0	transcript_id "g387.t1"; gene_id "g387";
# protein sequence = [MSFSSPAVYPLTPAADSVLGSVPSHQDAMDRFNVMTRDLEALFAQLPVNSLAVLPPNHDVRYLIRNILNAANLGERQR
# TPLQMSQKIVQLLYKTSSSLGREVYVALLQQLCNAFEDVAKEAITWLLYAEDEVSRRLVSKLLDDLRGVRRPPMAALPDSRQPSTKPGIENMREKLLG
# WFQQWINIYQRSHSPEKNFVPFITQLTKAGIVKEDDTSSLFFRVCAEASVNSYLKSVAAGEYDYAFQALDAMSRLIVYMIKYHGDPSGGNVDQAKVHY
# LSKILSIFVLVVANFHEEQGVAFQQKPFFRFFSSLINDLHSMEVHLGTAYFQLLFCIRYVFTIGKLVLDLNFTQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g387
###
# start gene g388
Scaffold_6	AUGUSTUS	gene	1640403	1640810	0.75	+	.	g388
Scaffold_6	AUGUSTUS	transcript	1640403	1640810	0.75	+	.	g388.t1
Scaffold_6	AUGUSTUS	start_codon	1640403	1640405	.	+	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_6	AUGUSTUS	CDS	1640403	1640810	0.75	+	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_6	AUGUSTUS	stop_codon	1640808	1640810	.	+	0	transcript_id "g388.t1"; gene_id "g388";
# protein sequence = [MAAENNTVVNSISSAADRQYSHVILSTKCVPEVIKTPDLLKPLISSPYCDQFQQPVYVLLQNGLNIEVDLYRAIKALG
# KPEEPVIINTGVYVFANLISANVVEHGPFVSANSWRELLMIFDTYPGTQGKVRYRYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g388
###
# start gene g389
Scaffold_6	AUGUSTUS	gene	1640996	1641562	0.84	+	.	g389
Scaffold_6	AUGUSTUS	transcript	1640996	1641562	0.84	+	.	g389.t1
Scaffold_6	AUGUSTUS	start_codon	1640996	1640998	.	+	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_6	AUGUSTUS	CDS	1640996	1641562	0.84	+	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_6	AUGUSTUS	stop_codon	1641560	1641562	.	+	0	transcript_id "g389.t1"; gene_id "g389";
# protein sequence = [MLNIAYAACACLTRCAISPLLYSVGGSLFVRCSLTSLFRPPPTNVPYEPYLDPVTADRVNLYTRKWIKDILDECVRLG
# VSYLSTYTFHRAHATIGRAMGFPDSEDGLPSSIVENSMKTSEKNYSGPDSNHNPSTLLDIEKGAPIEVEVIWGETVRLAKERNVDVPVSVYASCSAFL
# QLFLYTPQYQAH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g389
###
# start gene g390
Scaffold_6	AUGUSTUS	gene	1641974	1642776	0.53	-	.	g390
Scaffold_6	AUGUSTUS	transcript	1641974	1642776	0.53	-	.	g390.t1
Scaffold_6	AUGUSTUS	stop_codon	1641974	1641976	.	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_6	AUGUSTUS	CDS	1641974	1642405	0.97	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_6	AUGUSTUS	CDS	1642507	1642776	0.54	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_6	AUGUSTUS	start_codon	1642774	1642776	.	-	0	transcript_id "g390.t1"; gene_id "g390";
# protein sequence = [MQGWHIEKLSIPGRLGRVSVHVIEQSSSSAMLVNAKTTNILEFSVDPKLFGVFEKDMQLYIDGKQVVLDSRILEMAQV
# IYFKAVGPKLWKTVLSSPNSVDHSEFMGPAPLVFVVPDAVLDLESGPTETPSHAMSIALRLSHDLLVYHRLDSEIMINSEVNIALLKPEFASAFSKGN
# VIVVGNEAALELQTALHQGKTNFVTENNFIDVKEFMTRVHVDGFSPNGPELQPGQGM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g390
###
# start gene g391
Scaffold_6	AUGUSTUS	gene	1646148	1646498	0.73	+	.	g391
Scaffold_6	AUGUSTUS	transcript	1646148	1646498	0.73	+	.	g391.t1
Scaffold_6	AUGUSTUS	start_codon	1646148	1646150	.	+	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_6	AUGUSTUS	CDS	1646148	1646498	0.73	+	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_6	AUGUSTUS	stop_codon	1646496	1646498	.	+	0	transcript_id "g391.t1"; gene_id "g391";
# protein sequence = [MHSDSRLGQSQQTISIPASTIQLPMLGPLQGLPPNNQSQQSQQQQQQQQQQQQQQPGQNNIPPPPPLNGQDYTLSSVL
# HFLQTEWRRYERDRNEWEIERAEMRVFLFFSTLTPQSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g391
###
# start gene g392
Scaffold_6	AUGUSTUS	gene	1647157	1648611	0.53	+	.	g392
Scaffold_6	AUGUSTUS	transcript	1647157	1648611	0.53	+	.	g392.t1
Scaffold_6	AUGUSTUS	start_codon	1647157	1647159	.	+	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_6	AUGUSTUS	CDS	1647157	1647791	0.57	+	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_6	AUGUSTUS	CDS	1648065	1648611	0.64	+	1	transcript_id "g392.t1"; gene_id "g392";
Scaffold_6	AUGUSTUS	stop_codon	1648609	1648611	.	+	0	transcript_id "g392.t1"; gene_id "g392";
# protein sequence = [MNPLPNRPLINHSTVPLSLPNVPSFEQMAYNGRPRKVLPEAGSSLLNGINLISGPSSAPATGPLERSNPLASGMMQQH
# IQLQQVQQQQQAQQQQQQPPSTQQQSNGNQSQPILPGTSQLDNKGSESEPRQLTMIFRPDDSGEWKDKLRQAHEASEQLRLSRESQAAGGSWEGRREF
# EDELKEDEGEVDDDDSSVVSEGDGSKVWKARRTLRNSRVTTEIEPQITLRGHSAAITRLIHAPSKRLLYSASLDSSIRVWALPSPSHTTYAPYDDSTF
# RGHLVGHTDAVWDLALARDESTLISCGAEGAVKVWDVGGPSPGALKLTWGWLGVDGISDAPTDDNRDAPGATSIEAIKSDLKKVAVAYQNAVVKIFDI
# ETGKELSRLGSDMSYGTLIHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g392
###
# start gene g393
Scaffold_6	AUGUSTUS	gene	1651879	1653172	0.37	-	.	g393
Scaffold_6	AUGUSTUS	transcript	1651879	1653172	0.37	-	.	g393.t1
Scaffold_6	AUGUSTUS	stop_codon	1651879	1651881	.	-	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_6	AUGUSTUS	CDS	1651879	1652316	0.75	-	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_6	AUGUSTUS	CDS	1652387	1652718	0.57	-	2	transcript_id "g393.t1"; gene_id "g393";
Scaffold_6	AUGUSTUS	CDS	1652800	1653172	0.9	-	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_6	AUGUSTUS	start_codon	1653170	1653172	.	-	0	transcript_id "g393.t1"; gene_id "g393";
# protein sequence = [MYNKFTQSKHAVLFATDIAARGLDFPSVDWVLQLDAPEDADTYIHRVGRTARYESRGKGLLFLMPSEEEGMLAALKAK
# GIEVQKIKVKPSKQQDIQNQLQKLAFQEPEIKYLGQRVKISFLRVPFAELPANEFAESLGLPGAPKIKFLSKEVAKQKKNTDRRVNAAKQQALEEKQN
# SADENEEESDDGDIHPSSDEEDGSGNESEAAVTEEPPSKSTKVRSANSLGFFVELITPNHYSKLIDQDVASDEDDFITLRRADHDLVDVPLREVALEN
# LSKRKNKLGKAKRTILLNAPITKKIVFDDSGVGREAGEVADAEDWVKETGGVEGVVKEGNKYAEAERGKMKIADVQDKHDAREKKKEKKRKRKEREKI
# AVRSHFDF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g393
###
# start gene g394
Scaffold_6	AUGUSTUS	gene	1654961	1656132	0.74	+	.	g394
Scaffold_6	AUGUSTUS	transcript	1654961	1656132	0.74	+	.	g394.t1
Scaffold_6	AUGUSTUS	start_codon	1654961	1654963	.	+	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_6	AUGUSTUS	CDS	1654961	1655899	0.76	+	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_6	AUGUSTUS	CDS	1655953	1656132	0.75	+	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_6	AUGUSTUS	stop_codon	1656130	1656132	.	+	0	transcript_id "g394.t1"; gene_id "g394";
# protein sequence = [MTTTPPDEIIDVEATNSPDSSSVAQFSGTVSSSSIISTPVDPIVSPSYYAHPPQLPPLLVPSPSAPSISLKDSISPSL
# HYNIVPSMASFMHTANSDPINSSISVTAADPEPLLASTTPQPPAKPPASSLPERLQSDESISAVAKPRKKKRKKLNLSEMLDLDQADQVESPTGPISI
# VSSEGHDLKVEAMALDPAVKSSEPDFPTPDMQGSSTVGIKRARSNSSSRMPGSHSPNFLDRVLKWESPIDRTEHEHRPLSIEPHESAAAHITSALVED
# KDKDSPDAEDAMEVDIEPAQDNGPEDEIMMDVINNNLQTVEASLTTSDKLESVKAVEVLPPTPDEANDASSTTMALTDAPQPIIIKTPHKVSLPEFCV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g394
###
# start gene g395
Scaffold_6	AUGUSTUS	gene	1657501	1658490	0.36	-	.	g395
Scaffold_6	AUGUSTUS	transcript	1657501	1658490	0.36	-	.	g395.t1
Scaffold_6	AUGUSTUS	stop_codon	1657501	1657503	.	-	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_6	AUGUSTUS	CDS	1657501	1657980	0.92	-	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_6	AUGUSTUS	CDS	1658038	1658490	0.39	-	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_6	AUGUSTUS	start_codon	1658488	1658490	.	-	0	transcript_id "g395.t1"; gene_id "g395";
# protein sequence = [MQLEKEQITPGYEDYGNVLSSTTFSPQRSFSSGSYQQQQSQYSPPHISTMPSPYSLASAPAAPQSFPPAPLSDKGSAN
# ELDLNDPSTLEIYSRILLFKDDRMRDELAFSRMLLPKQRRVVHLIAQKLGVYHYSVGEGDERYAVVTRIDPQRAQRAPTLSRAPSAYLTPTGSTISAA
# PGSLRMKKSMPDLKTLHSQAPRLTTRASNGNIREGYATIASPSRRSSGFGSLFANGGAFGNSGVPPVPNLPTGLQSAGTMNSASGNGHESPGGVVRQP
# RGPGVGGFARRDSRVGISEGQPRGVLDARTYEPLEI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g395
###
# start gene g396
Scaffold_6	AUGUSTUS	gene	1658769	1659278	0.36	-	.	g396
Scaffold_6	AUGUSTUS	transcript	1658769	1659278	0.36	-	.	g396.t1
Scaffold_6	AUGUSTUS	stop_codon	1658769	1658771	.	-	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_6	AUGUSTUS	CDS	1658769	1659278	0.36	-	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_6	AUGUSTUS	start_codon	1659276	1659278	.	-	0	transcript_id "g396.t1"; gene_id "g396";
# protein sequence = [MTSSPPDISSLSLTSQQQRLHDSYDYEGSSGNRPQYHFATSPGISIQSQYNPLTTGQSPLKKPVRGGLPSVRCCPFFS
# PYNPPIFTIVAQQWLDNSSDSRSLSPHNNSDFSSAGGSPPMSHLSPPPIAPTTPSQNPDDEIIPTAIVIKNIPFNVKRETLLDIIVSSSHR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g396
###
# start gene g397
Scaffold_6	AUGUSTUS	gene	1662854	1663482	0.2	+	.	g397
Scaffold_6	AUGUSTUS	transcript	1662854	1663482	0.2	+	.	g397.t1
Scaffold_6	AUGUSTUS	start_codon	1662854	1662856	.	+	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_6	AUGUSTUS	CDS	1662854	1663096	0.23	+	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_6	AUGUSTUS	CDS	1663204	1663482	0.56	+	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_6	AUGUSTUS	stop_codon	1663480	1663482	.	+	0	transcript_id "g397.t1"; gene_id "g397";
# protein sequence = [MTSYFRYGSVSSLFTYSLLECPNISKNHRNVADTQDRGALDSTDFAIGMYLIQGVTSGQISIIPTSLPQDCTSKPLAA
# LLRMLQSQGTGGAVSKKPLVSPTIPARKTTNPSAIGNSAFGAQARWDVTAAEKASSDGYFDTLDTTKAGYIEDEVAVPFMLESKLPGDACSDLVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g397
###
# start gene g398
Scaffold_6	AUGUSTUS	gene	1664335	1666607	0.43	+	.	g398
Scaffold_6	AUGUSTUS	transcript	1664335	1666607	0.43	+	.	g398.t1
Scaffold_6	AUGUSTUS	start_codon	1664335	1664337	.	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_6	AUGUSTUS	CDS	1664335	1665210	0.43	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_6	AUGUSTUS	CDS	1665291	1666607	0.93	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_6	AUGUSTUS	stop_codon	1666605	1666607	.	+	0	transcript_id "g398.t1"; gene_id "g398";
# protein sequence = [MRVEKAEIEGSFLRDKEEVRDLNRRAFEAGHQIETLKAEIEKAKKEAKQQKGLLAIAKKQLSSKEAERVKVEKELAEA
# QAATVAATQEKEEVDAALEKVTSLIPATAPTVAEPVVAGFPHAERTTSEDSLSFAAAHALPSTPEIGSPSSGKSNNPFERLAKSDPSTPRSQSPFLPF
# NNATVPSPSVLNGNANQTAEASLDDPFGFAQAFETPDKAPEPVVGEAIAPTPAEDNVGTPKPTIVSLDDHEESPATPTTAHTEEFATPPSTADGILKP
# MRKSTEDIISSKFPDLDDRAFISHPETDLGASLNEIEPEDSDSSDDEDEVPLATLKAKTDSLETEPKSAIVSATNGQSVTASFDDIFSAPSSNGQAVP
# TETKDAFGIPIETQSNSPFGSTSDSHVASSAEAGVNAFDEAMGKIAPTTSNNTAQFSFENAFDDTFDFGSAKGADTSSSFPPAPANGASPAKVKESDG
# FESLFVTPPSNGVTASVARPVSSFLPNVVASSPPPSTPSSAQDPPVAAGPSFDEVFAGFDSSPSIQLGTPNTAASAPAPIPAPSPIPVATTKTPGSPT
# QKPFPATNTSPSQSSVTRSISPPPHRRSPPLRTGSPKPRPSTASSSKEGHEKEKNPPPPRHSKLSVSFNTAYMIIYLTIISQIRLPFGKKKKQEAVPP
# PPPSQFLTPPTEEPEQIGTPAVGDDVEAVKQLTAMGFSRSQAVGALEKYAYDVPRALNSLLGQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g398
###
# start gene g399
Scaffold_6	AUGUSTUS	gene	1668724	1669233	1	-	.	g399
Scaffold_6	AUGUSTUS	transcript	1668724	1669233	1	-	.	g399.t1
Scaffold_6	AUGUSTUS	stop_codon	1668724	1668726	.	-	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_6	AUGUSTUS	CDS	1668724	1669233	1	-	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_6	AUGUSTUS	start_codon	1669231	1669233	.	-	0	transcript_id "g399.t1"; gene_id "g399";
# protein sequence = [MLLLSAFVSVALGSQIGFALVPGKASSFAGSTSTFQFPPADVTATASLINSFFPDASEVGFAGPTPSTYFLIRITEIS
# QAQHLFTQAGDEAESIATAPALSPVKGYFPLVRPETSDKKGKAFDVVDSWANLSPMQSVKSFGLDNATERIPEGCKINQVFSPPSWCKVPN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g399
###
# start gene g400
Scaffold_6	AUGUSTUS	gene	1673135	1673671	0.92	-	.	g400
Scaffold_6	AUGUSTUS	transcript	1673135	1673671	0.92	-	.	g400.t1
Scaffold_6	AUGUSTUS	stop_codon	1673135	1673137	.	-	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_6	AUGUSTUS	CDS	1673135	1673671	0.92	-	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_6	AUGUSTUS	start_codon	1673669	1673671	.	-	0	transcript_id "g400.t1"; gene_id "g400";
# protein sequence = [MCKFSKAPECFDSEFYFLQSCRFYYPPGTTGNELGASDPVFMGKYGDELKNDSGKWIDSSVWHGKAHTWEKMPWLIKQ
# VGNIRRLDCIIPIISAFFRVSQWKRISGGRPFVIKGIQSAEDALKAYEIGCEGIVVTNHAGRQVDGAVGSLEVLPEIVDAVGDSKDILVSLKYPFPLT
# VS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g400
###
# start gene g401
Scaffold_6	AUGUSTUS	gene	1677149	1678124	0.83	+	.	g401
Scaffold_6	AUGUSTUS	transcript	1677149	1678124	0.83	+	.	g401.t1
Scaffold_6	AUGUSTUS	start_codon	1677149	1677151	.	+	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_6	AUGUSTUS	CDS	1677149	1677175	0.98	+	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_6	AUGUSTUS	CDS	1677272	1677290	0.99	+	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_6	AUGUSTUS	CDS	1677388	1678124	0.84	+	2	transcript_id "g401.t1"; gene_id "g401";
Scaffold_6	AUGUSTUS	stop_codon	1678122	1678124	.	+	0	transcript_id "g401.t1"; gene_id "g401";
# protein sequence = [MEIKEDGGKTTFAGPSFSSGRRTLATVRETSTTYIPSSQVPISHQTHQKPIPKPKLLTSIILNRAPILTPTPTPFERA
# YYAYQARLRRALSNPFPYDFYFKQGSILETRFTLEERKRERIAFGREFGIADDLDKEKAAANRAAVEQLAEQEGESEEMMARVHPSDEARDYKSLDRK
# GKRNLYLLLQENEGTWRFPEGNVKKGELLHQAAQRDLLAECGEYMDTWIVSRNPIGHYRPPRKAPLAGKPQPEVRAHFESDTLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g401
###
# start gene g402
Scaffold_6	AUGUSTUS	gene	1685836	1687236	0.8	-	.	g402
Scaffold_6	AUGUSTUS	transcript	1685836	1687236	0.8	-	.	g402.t1
Scaffold_6	AUGUSTUS	stop_codon	1685836	1685838	.	-	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_6	AUGUSTUS	CDS	1685836	1687236	0.8	-	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_6	AUGUSTUS	start_codon	1687234	1687236	.	-	0	transcript_id "g402.t1"; gene_id "g402";
# protein sequence = [MVPSERDKVFLEVHIQNLTPESIWFERMHFEAAESWDARDANLINVNGEQRSLYMGSTALMQPQDMRQYIYILSPKSI
# HLEPVVYSPGAVIPLGRLDISWRSSYGEPGRLLTSMLTRRIPLVPQPVQPQPASALPPYLKRQSTSATPPTRPRSPQLVQSRPSSPTPRSNSPVPYRA
# RASSVISGFSQIPLSPQPPASVIPTTTIEAHLLVRDVAHGTIAVGKNFKVALSLVLSSLLVSDRQRQKLQLSLVIQHIGFPPTSGFAGLSVPKPAQLP
# PPDSSSLSPRSLSSLGFSSPSPTYTTFNYPLAHQKLLEASQVQSATRESSIDGPLKPSENMKSLPPPYFEKVDESKRLKMTMVTFSGPSAIVLPPIEL
# VPSSKSYTVESSDSQPGGLRPTSKHLATLDFELDYVALRRGFAMVGGLRLLLVGEKFVDDDADKEDDDGQSLVPKILEIRSLKEWNVVAEVLVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g402
###
# start gene g403
Scaffold_6	AUGUSTUS	gene	1694957	1695361	0.44	-	.	g403
Scaffold_6	AUGUSTUS	transcript	1694957	1695361	0.44	-	.	g403.t1
Scaffold_6	AUGUSTUS	stop_codon	1694957	1694959	.	-	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_6	AUGUSTUS	CDS	1694957	1695361	0.44	-	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_6	AUGUSTUS	start_codon	1695359	1695361	.	-	0	transcript_id "g403.t1"; gene_id "g403";
# protein sequence = [MIAELGKLQSQATSLSASLQASASKTLKDPTAQLPPQVQQRYAELSSVLQAQASSASATYAELSNHLASTVSELRSIM
# TAENVSIQEKATKVTHEVSVRVQPLLEVLSRNAQQAISARGESQSPTVNGVNGHAN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g403
###
# start gene g404
Scaffold_6	AUGUSTUS	gene	1695778	1696260	0.33	-	.	g404
Scaffold_6	AUGUSTUS	transcript	1695778	1696260	0.33	-	.	g404.t1
Scaffold_6	AUGUSTUS	stop_codon	1695778	1695780	.	-	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_6	AUGUSTUS	CDS	1695778	1696260	0.33	-	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_6	AUGUSTUS	start_codon	1696258	1696260	.	-	0	transcript_id "g404.t1"; gene_id "g404";
# protein sequence = [MKVSLNKCGETDNIFLSTTMSSTETETSSIPMPSSSPSTHPPELTVISRISSIPLISSSLEIVNDTLSTNTYTRSPYS
# TALGLSNSAYKLTEPLQTHLAPLIVRADSYANLAVDVVQKRYPSAFTTTPEDVMGYVQNRQKDVGEYVRERRESAGVIAHDI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g404
###
# start gene g405
Scaffold_6	AUGUSTUS	gene	1698624	1699031	0.71	-	.	g405
Scaffold_6	AUGUSTUS	transcript	1698624	1699031	0.71	-	.	g405.t1
Scaffold_6	AUGUSTUS	stop_codon	1698624	1698626	.	-	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_6	AUGUSTUS	CDS	1698624	1699031	0.71	-	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_6	AUGUSTUS	start_codon	1699029	1699031	.	-	0	transcript_id "g405.t1"; gene_id "g405";
# protein sequence = [MYCVLEKTLNDLVVGDVLYKYMGAYNKGIYLLLEDYEVKGVKHGKDTLIIKVIGGLRNPKSVVDNKVWGEVKALKDVG
# LYVDSGMANVDNGKYPVIVMKLVKGVMIKDTTEYENARLDLRLKWLEEAKPLVEEES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g405
###
# start gene g406
Scaffold_6	AUGUSTUS	gene	1704298	1704711	0.6	-	.	g406
Scaffold_6	AUGUSTUS	transcript	1704298	1704711	0.6	-	.	g406.t1
Scaffold_6	AUGUSTUS	stop_codon	1704298	1704300	.	-	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_6	AUGUSTUS	CDS	1704298	1704711	0.6	-	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_6	AUGUSTUS	start_codon	1704709	1704711	.	-	0	transcript_id "g406.t1"; gene_id "g406";
# protein sequence = [MVYEDAEKLYAEVAKDGKSLIEEAFQVLFSHSVLLSPETRLQPNTSLNQIIGYNTTFLDRREIVKIPLDGASAGLKTA
# VAQVDNNNNEVGYAIMDNGVLDASIANGLDLHASGESTVHSLMLMISLVHPSQSIHQRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g406
###
# start gene g407
Scaffold_6	AUGUSTUS	gene	1710274	1711008	0.53	-	.	g407
Scaffold_6	AUGUSTUS	transcript	1710274	1711008	0.53	-	.	g407.t1
Scaffold_6	AUGUSTUS	stop_codon	1710274	1710276	.	-	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_6	AUGUSTUS	CDS	1710274	1711008	0.53	-	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_6	AUGUSTUS	start_codon	1711006	1711008	.	-	0	transcript_id "g407.t1"; gene_id "g407";
# protein sequence = [MFKRLDSLIGIWALEFFEKNRTKGVTLDIECIDISSAQFPSTHPSEVHFSVNSVVNLPNPDWTDTFSFAHQRLLVAAM
# NDTLWRSAVAELFRVVKPGGWVELVEIEAQDFSTWSVGPNSTKLASLINALYGGKGVIGDLSVYLPVILKEAGFVNVQCDPRRVTIGGEVDATPHKIT
# EVKGYGSDMWRDLWMGMKGPVIEAGGYGAVDTVEEYEALVQGTEVELKNSKEAYTTFFAILARKPENT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g407
###
# start gene g408
Scaffold_6	AUGUSTUS	gene	1715982	1716434	0.63	-	.	g408
Scaffold_6	AUGUSTUS	transcript	1715982	1716434	0.63	-	.	g408.t1
Scaffold_6	AUGUSTUS	stop_codon	1715982	1715984	.	-	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_6	AUGUSTUS	CDS	1715982	1716434	0.63	-	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_6	AUGUSTUS	start_codon	1716432	1716434	.	-	0	transcript_id "g408.t1"; gene_id "g408";
# protein sequence = [MFYFHISPQIFITPLFFSSVAGHGEHPQSRDAAAIMVHSGAYYNMFLNSIEKAPFTTFEIESNAVMDGSEDVGTLEIK
# EHATSMSANDVSPSVPSTSTSAAATLTPSDPVTPTTSGITDDSAMSPVITPTLVPAKKASGFMKPGKSTSVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g408
###
# start gene g409
Scaffold_6	AUGUSTUS	gene	1718103	1718465	0.98	+	.	g409
Scaffold_6	AUGUSTUS	transcript	1718103	1718465	0.98	+	.	g409.t1
Scaffold_6	AUGUSTUS	start_codon	1718103	1718105	.	+	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_6	AUGUSTUS	CDS	1718103	1718465	0.98	+	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_6	AUGUSTUS	stop_codon	1718463	1718465	.	+	0	transcript_id "g409.t1"; gene_id "g409";
# protein sequence = [MFLKIVLPGLDKSESVSSIRIKASDWEGVPDPSETAIQSETAKGGAHPNAKGGARYRYEQEFWIMLPPIEQEHEEKHY
# LGTISWDSDERRISGDIRDADDNTKVLVEVKDGVLSGPKVRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g409
###
# start gene g410
Scaffold_6	AUGUSTUS	gene	1719307	1720256	0.49	-	.	g410
Scaffold_6	AUGUSTUS	transcript	1719307	1720256	0.49	-	.	g410.t1
Scaffold_6	AUGUSTUS	stop_codon	1719307	1719309	.	-	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_6	AUGUSTUS	CDS	1719307	1719862	0.85	-	1	transcript_id "g410.t1"; gene_id "g410";
Scaffold_6	AUGUSTUS	CDS	1719994	1720256	0.5	-	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_6	AUGUSTUS	start_codon	1720254	1720256	.	-	0	transcript_id "g410.t1"; gene_id "g410";
# protein sequence = [MSNSSEATGFTFGSSSAPSTSAGVGSTKSPFTFGSGVSSTNVTSSAPFTFGVTPARPVTPPNQDREVSMEESPTRDVQ
# VNKPAETRPSSKPVETKPFGTSTTQGGNATSSSFSFGRTPENEPPRPSTTGSFSFGTPAFRYKYRAWAHLLFGAPSNNSAHSNPFSAVQGGSTPNSPS
# TFGPSSSFSFGSTPNAGSSSANPFSFGSQPASPATPSAGIPSSGFGAMTSNSFGPQLLVQDLVLLRLHLQVGLFTIGAAPSDSNRQIKRLPNRKKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g410
###
# start gene g411
Scaffold_6	AUGUSTUS	gene	1720666	1722073	0.88	-	.	g411
Scaffold_6	AUGUSTUS	transcript	1720666	1722073	0.88	-	.	g411.t1
Scaffold_6	AUGUSTUS	stop_codon	1720666	1720668	.	-	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_6	AUGUSTUS	CDS	1720666	1721448	0.9	-	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_6	AUGUSTUS	CDS	1721501	1722073	0.97	-	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_6	AUGUSTUS	start_codon	1722071	1722073	.	-	0	transcript_id "g411.t1"; gene_id "g411";
# protein sequence = [MPSSLGASASSSNITDMFARKHTLVLMGDHDRPTKRDKKTKGKGRSKETNETKPYAGTTGIKKRLAKVKAPNHDVKGK
# SASNEVSIPEQAAVSSPKEAIVPELPVPPPKEKDTFNVAAFPPSTSPAQQSSLRVGRAARSHLSRPIKKFSASYDDEDDKVGDDSKKDLEMLTEAAKK
# VPTFEIPPGFSFAKELPPMQPAAAAKEPPISMLPFSLTSSAASPAPSAQTLSGEIDLGSSPSAGSPYGASLGPSCPIEDNGGASNSTVMADAAVKVPN
# FFATSKTLAPQISASPATSQMPSASGLRSAFAFAPTTVSVAKELVPPPSNEDRKGPEAASSLFDVPAITSPPSFSFSSGGESTPALASFSAPVIDRSK
# KDESQPLPLSFGPPVIPPPQATSQSSSVSFGGPVGNTTSSVSNAQFSFGTLATTATSAAATVAPSLTQPPFHSGLRHQI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g411
###
# start gene g412
Scaffold_6	AUGUSTUS	gene	1724046	1724483	0.77	+	.	g412
Scaffold_6	AUGUSTUS	transcript	1724046	1724483	0.77	+	.	g412.t1
Scaffold_6	AUGUSTUS	start_codon	1724046	1724048	.	+	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_6	AUGUSTUS	CDS	1724046	1724483	0.77	+	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_6	AUGUSTUS	stop_codon	1724481	1724483	.	+	0	transcript_id "g412.t1"; gene_id "g412";
# protein sequence = [MFAKLCLIVFESLGKVPVPDPIISHIRKCTETYGKVKLVLKHNKYFVESSHPDILQKLLRDAVIQDARVISVQTDNSI
# KGNTFTTSKAPVKGNLVIPGTNKEVDKSNDGVAKGKRDNADLFTSVVGVEGGALSLLGCSNFTNERL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g412
###
# start gene g413
Scaffold_6	AUGUSTUS	gene	1726138	1726584	0.53	+	.	g413
Scaffold_6	AUGUSTUS	transcript	1726138	1726584	0.53	+	.	g413.t1
Scaffold_6	AUGUSTUS	start_codon	1726138	1726140	.	+	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_6	AUGUSTUS	CDS	1726138	1726584	0.53	+	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_6	AUGUSTUS	stop_codon	1726582	1726584	.	+	0	transcript_id "g413.t1"; gene_id "g413";
# protein sequence = [MFYSTKRQQFLIDQGYAFKVITSLDGQKDFPGLVYRTREEQIELLQSVLIANEADAEPGSDVRASEGDLAGTITSKDF
# GQPSRFPGAQRMTSSLTSLSGAQHMSYIEQNKSMNKTLAKSAAGSASRHKLFQKRDRDKTAARKEAKKAA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g413
###
# start gene g414
Scaffold_6	AUGUSTUS	gene	1731675	1732618	0.3	-	.	g414
Scaffold_6	AUGUSTUS	transcript	1731675	1732618	0.3	-	.	g414.t1
Scaffold_6	AUGUSTUS	stop_codon	1731675	1731677	.	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_6	AUGUSTUS	CDS	1731675	1732091	0.4	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_6	AUGUSTUS	CDS	1732187	1732206	0.68	-	2	transcript_id "g414.t1"; gene_id "g414";
Scaffold_6	AUGUSTUS	CDS	1732402	1732618	0.67	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_6	AUGUSTUS	start_codon	1732616	1732618	.	-	0	transcript_id "g414.t1"; gene_id "g414";
# protein sequence = [MGVLQGLGATSACNNGTFDASLTGNGQFNLQHNNAMFNTMSASSEPPAFNTIGVMNRLHDGRYIEPVAIGGNLDATAY
# TGQLHTGHAHRQQLNGQQFDFENSLSSAINLARLQQLSQSHTDMHSHRAEYNPSFNIHDLRSPFHLKSKSLDSAVDQHFMAQELEYMNDMSPPSPIGT
# YHVHPSQATATTLLMYFDSDVTTDEPKIHRDAEIQLGRCRC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g414
###
# start gene g415
Scaffold_6	AUGUSTUS	gene	1734319	1735309	0.42	+	.	g415
Scaffold_6	AUGUSTUS	transcript	1734319	1735309	0.42	+	.	g415.t1
Scaffold_6	AUGUSTUS	start_codon	1734319	1734321	.	+	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_6	AUGUSTUS	CDS	1734319	1734348	0.42	+	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_6	AUGUSTUS	CDS	1734428	1735309	0.96	+	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_6	AUGUSTUS	stop_codon	1735307	1735309	.	+	0	transcript_id "g415.t1"; gene_id "g415";
# protein sequence = [MNQLRWRNEHTVAAVTKGPLYTAPSEEDRRRLVADYIKRTGNAETELLVCCVCAREQLRVEVADNNDLEFPNADLLQP
# ETPHRAHTLHKSMLLYTHSFTNRIPPYTCHDCLRQLHEGQRPRLALANNMWIGAIPFELRILTLPERVLVSRYFAAAYIVKLYPKKQGSRTLPPDMLT
# SGLKGNVSSYFMNTQEIAGMVDNGFLPPRPSILAATIAVTFIGPNKVPLKALAPMLTVRRKRVADALRWLIANNPLYNGIHLSERNLQLLPEDGVPEE
# IWGNVKWTDQVNLLEKEHAAMFLRITTRM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g415
###
# start gene g416
Scaffold_6	AUGUSTUS	gene	1737729	1739959	0.23	+	.	g416
Scaffold_6	AUGUSTUS	transcript	1737729	1739959	0.23	+	.	g416.t1
Scaffold_6	AUGUSTUS	start_codon	1737729	1737731	.	+	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_6	AUGUSTUS	CDS	1737729	1738323	0.23	+	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_6	AUGUSTUS	CDS	1738428	1739959	0.84	+	2	transcript_id "g416.t1"; gene_id "g416";
Scaffold_6	AUGUSTUS	stop_codon	1739957	1739959	.	+	0	transcript_id "g416.t1"; gene_id "g416";
# protein sequence = [MVSPERPRGGWMLYKLMMMAVLKPWRNISDLVNGFRTVDDAWDDFLLQSGGKYETFLQNVQYFYECSDQSSSRREKEY
# ATYEPVHNDHSNNVVDLEDDREGDIVEEEKSWSEEEILAAQQCEKGHEERFGITAMEHAFEVGIFEREYQFDASAPFARRCSSLDKVHYDEWAEQLKD
# YAAKGLTIVGDAVGDIGSVCDAIEDHLRATLAALKPSQLLMILRGPGGTGKTVAINAVTETFKRLGVEAQLAKTATSGVAATLISGRTVHTWAGLSIG
# GARGENWVEGSVKTAQKRIANIGPVEYLIIDEVSMATKDLLANLSDIVTHIRSKLDKPGEGLYFGGMNVILCGDFHQFPPVANGEAALYNTKCTGKHA
# QKGLEIYNCFDKVVTLHQQMRIRDGRWQELLDRLRTGSCSREDIDILHSLRLDIPDNAKTDFNGTDWGNAVLITPRNSARRRWNASAIRRHCAKNNTR
# LYSCPAEDTAKGSPLSNNQRMSVTRKTTKQTGNLAHRVEVAVGMKAMVLLNIATEADLANGTRGVVEGIVLDDREDANPEVVNGVTMLKYPPAVIFFR
# PNGKTNVKIDGVQDGLLPIMPTDTSFTINLSDGSRRTVNRRQVALTPGYAFTDYKGQGQTLEYVIVDLEKPSGGPDISPFSAYVALSRSRGRGTIRLL
# RGFEEKHFVTHPSAALKDEDLRLDFITKHTASWWTNGRRYTM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g416
###
# start gene g417
Scaffold_6	AUGUSTUS	gene	1740954	1742099	1	+	.	g417
Scaffold_6	AUGUSTUS	transcript	1740954	1742099	1	+	.	g417.t1
Scaffold_6	AUGUSTUS	start_codon	1740954	1740956	.	+	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_6	AUGUSTUS	CDS	1740954	1742099	1	+	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_6	AUGUSTUS	stop_codon	1742097	1742099	.	+	0	transcript_id "g417.t1"; gene_id "g417";
# protein sequence = [MFADKNFILIDNCSALSANVLQKIATSLWDPEDLTQDIIPFGHRNVVLFGDFSQHPPIERHWDTLWWPNYEASDIVQH
# VTKRVIVFHQDMTGAPTSWVNLTHRVRNGTLNGTDRVALNKRVVGLYGVPPVEDLSPEWTDGVVIASNAIQRQYWNINMASRVSRGSKKPLYITPSRD
# EYVFGDGERMGVRDLEVLSGKLKQEFSVMQSLYLFEGMPVVILHGDLKNVWAQIINIVIDKREKRMPNAAEYRLAYAVKEVTVRLSAEAIRSGSRELI
# TLTPTMHQFTLPHPSDERRRVLVERTQVPVMPRFALVEYETIGIRFKKIVVDTQNGLYAYQSPYMTITRSDSVYFSNRIQDSETEEDAVSANDLRKKV
# DEIERSDRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g417
###
# start gene g418
Scaffold_6	AUGUSTUS	gene	1746407	1748801	0.41	+	.	g418
Scaffold_6	AUGUSTUS	transcript	1746407	1748801	0.41	+	.	g418.t1
Scaffold_6	AUGUSTUS	start_codon	1746407	1746409	.	+	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_6	AUGUSTUS	CDS	1746407	1746788	0.46	+	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_6	AUGUSTUS	CDS	1746842	1747371	0.59	+	2	transcript_id "g418.t1"; gene_id "g418";
Scaffold_6	AUGUSTUS	CDS	1747515	1748801	0.69	+	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_6	AUGUSTUS	stop_codon	1748799	1748801	.	+	0	transcript_id "g418.t1"; gene_id "g418";
# protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP
# LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFHLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMP
# FGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEW
# PVPRKVKDIQSFLGFANFYRRFIYNYSDIVTDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDV
# VTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFVLSLLTNNSLRLFELPSGRPGFTSLDY
# HGYRSPTPSHSRPSRRPSSVAGLELAKDPSNERWSLGSDKLLRLDDRILCPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDY
# VTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVLIMLLPIV
# VPNLFRRSSGLSVKRSPWNFTIPLDIIRKPMGKLSVSIRLSNSTSGSIVPTNKMTGRLTSDRRVRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g418
###
# start gene g419
Scaffold_6	AUGUSTUS	gene	1765500	1765988	0.81	-	.	g419
Scaffold_6	AUGUSTUS	transcript	1765500	1765988	0.81	-	.	g419.t1
Scaffold_6	AUGUSTUS	stop_codon	1765500	1765502	.	-	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_6	AUGUSTUS	CDS	1765500	1765988	0.81	-	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_6	AUGUSTUS	start_codon	1765986	1765988	.	-	0	transcript_id "g419.t1"; gene_id "g419";
# protein sequence = [MSPVHSLSSSPKQRPPAQSLKLGGSRPFLPSSNSFSPPTTQRNLGLGFDPTVTSSNTTSPFMAALQPSNTFSSPSQPV
# PPLSGGPQPQRPNYDILLPSVTPVHNPTLALSTSASPKPAMTPTLMHNSPMSSSLLTPSKPAQPSWKSSNKPTKDDWGDFDPLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g419
###
# start gene g420
Scaffold_6	AUGUSTUS	gene	1766052	1766546	0.35	-	.	g420
Scaffold_6	AUGUSTUS	transcript	1766052	1766546	0.35	-	.	g420.t1
Scaffold_6	AUGUSTUS	stop_codon	1766052	1766054	.	-	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_6	AUGUSTUS	CDS	1766052	1766546	0.35	-	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_6	AUGUSTUS	start_codon	1766544	1766546	.	-	0	transcript_id "g420.t1"; gene_id "g420";
# protein sequence = [MATLSVQEAMGSKVDREAVATLVLPQLWNMSMGPCELYDAHHFFLSYALINLTVLNVGQFQRFMEVIRKLGDRVEKEH
# NQFLRDSQRLEDRSAVAVDGATVTQSFVGSMDFESLVGGKNGAVQTNATGGSVGSAAGKTSWDDDVWGSIFNDTVSSLPMNNYHSM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g420
###
# start gene g421
Scaffold_6	AUGUSTUS	gene	1769268	1769831	0.97	-	.	g421
Scaffold_6	AUGUSTUS	transcript	1769268	1769831	0.97	-	.	g421.t1
Scaffold_6	AUGUSTUS	stop_codon	1769268	1769270	.	-	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_6	AUGUSTUS	CDS	1769268	1769680	0.99	-	2	transcript_id "g421.t1"; gene_id "g421";
Scaffold_6	AUGUSTUS	CDS	1769753	1769831	0.98	-	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_6	AUGUSTUS	start_codon	1769829	1769831	.	-	0	transcript_id "g421.t1"; gene_id "g421";
# protein sequence = [MALLYASENDNEVETFTASEDTLKSHYQGNDLYYDDTADAEWDGSEYEEVIDGDQGADTTIDTEADGEYEYASAQSSI
# TLWSRHSKRSIHDLDEDEIEIDKSKGLVSVQSSQVNFYVSTTSSGFRVVTSVFRFEKGSYGMRFLRSGLFSGSKIDKYAASRILS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g421
###
# start gene g422
Scaffold_6	AUGUSTUS	gene	1769863	1770564	0.98	-	.	g422
Scaffold_6	AUGUSTUS	transcript	1769863	1770564	0.98	-	.	g422.t1
Scaffold_6	AUGUSTUS	stop_codon	1769863	1769865	.	-	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_6	AUGUSTUS	CDS	1769863	1770564	0.98	-	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_6	AUGUSTUS	start_codon	1770562	1770564	.	-	0	transcript_id "g422.t1"; gene_id "g422";
# protein sequence = [MRLNLADADEEYNAEELNESSLQETTGAVMCSPLDFICLDVSIPEQEHGPDLSEEIVEEYQEQAEETINENHLQSEEN
# TESDSAEVQLDLTNEGDAEHPDELAVSDYDQYPQDTEAAENEEAVEGNTLYDDAQGPEEQDQEDNGEGIVEEPTEPTFIEISETSEILDGTQELKKLR
# RTRKRFANTCLSFKLPDHISDQQIASVTVEDELQKKPSRIQEGSPQSQDESHELGKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g422
###
# start gene g423
Scaffold_6	AUGUSTUS	gene	1770721	1772031	0.95	-	.	g423
Scaffold_6	AUGUSTUS	transcript	1770721	1772031	0.95	-	.	g423.t1
Scaffold_6	AUGUSTUS	stop_codon	1770721	1770723	.	-	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_6	AUGUSTUS	CDS	1770721	1772031	0.95	-	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_6	AUGUSTUS	start_codon	1772029	1772031	.	-	0	transcript_id "g423.t1"; gene_id "g423";
# protein sequence = [MLDKSLEVTKLRGLNFLSGTMATVFEQYDTPMLDYHPDADVQMHGNLDPWFHEEAHMESEDIHLASTRSSDEDLVDVE
# IEMENYLDEDSQNPEYEMLDEVEAPSYFVVADPEDIVVMDASHQSSVLRDSTLESIALSELPSQSLASSVESAASPLDPQNNVAAEPKVPSTESHFHS
# SDFDSVPVNGPSEPEEPITSTVLEEVISPEPLSAYISLEKPSTHAEVSSTEATHVANTITDSAVASNHDDILTKAAVLPAEEAKGSAQTEAEVIHHLP
# VDEGVVDSTEVEAGTVDQSESVISNVAGSVERPVEHVENEEESRVSELDPHEISEGVYIDPPPAVLLSFAFLDYPDVCLFNQPSQYDPSSSTTEPTSC
# SVLLSDQPTLYYEPLSTVFEALRNDNELSSIADLSQVELVLDAYDLELTLFQRFAVNCLCYYGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g423
###
# start gene g424
Scaffold_6	AUGUSTUS	gene	1774512	1775587	0.31	+	.	g424
Scaffold_6	AUGUSTUS	transcript	1774512	1775587	0.31	+	.	g424.t1
Scaffold_6	AUGUSTUS	start_codon	1774512	1774514	.	+	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_6	AUGUSTUS	CDS	1774512	1775112	0.32	+	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_6	AUGUSTUS	CDS	1775205	1775587	0.41	+	2	transcript_id "g424.t1"; gene_id "g424";
Scaffold_6	AUGUSTUS	stop_codon	1775585	1775587	.	+	0	transcript_id "g424.t1"; gene_id "g424";
# protein sequence = [MYVDFYCMFWTTYILYQKIQQGQLEERSLEDRKIDHVRLSNGSEPKTPTSVCTLPPDSKYIPLNPHLQLTKSISTFLA
# QKRANNEASNRAEFLRSLANLRPQDEASSDASNMESPSSCARTDAKAIDRNAQIKYDIVKNEDGPLRRTMRSRDVSGSTTTTVLPSTSTYKGKAKATA
# FKNEKAEATVVKDLSSERHPGLDDLPYAPQSLLDRLRFLEEHIIKLEKDYPPWAAIHFNQPSRNVGSSEFSSPVNLLTLCQWPPPPKQTPIIVPTSMS
# RQPKLDASSYLAPIAGAASYAGGLTRAKNSSLHRAVMEKLEVHNAKLDLTGGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g424
###
# start gene g425
Scaffold_6	AUGUSTUS	gene	1778102	1778449	0.46	+	.	g425
Scaffold_6	AUGUSTUS	transcript	1778102	1778449	0.46	+	.	g425.t1
Scaffold_6	AUGUSTUS	start_codon	1778102	1778104	.	+	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_6	AUGUSTUS	CDS	1778102	1778449	0.46	+	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_6	AUGUSTUS	stop_codon	1778447	1778449	.	+	0	transcript_id "g425.t1"; gene_id "g425";
# protein sequence = [MVEHPSTENLCEGTKDAVHREKAHRQHPQRQPNSKATLQWKHAADLAVRWVRSRAHYQDHLNVATTEHMSSVDIHDGK
# QMRTSSVHENQQKQNIDEDLLVVDPQVDGRFEDVGRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g425
###
# start gene g426
Scaffold_6	AUGUSTUS	gene	1790694	1791503	0.28	-	.	g426
Scaffold_6	AUGUSTUS	transcript	1790694	1791503	0.28	-	.	g426.t1
Scaffold_6	AUGUSTUS	stop_codon	1790694	1790696	.	-	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_6	AUGUSTUS	CDS	1790694	1790902	0.82	-	2	transcript_id "g426.t1"; gene_id "g426";
Scaffold_6	AUGUSTUS	CDS	1791042	1791082	0.82	-	1	transcript_id "g426.t1"; gene_id "g426";
Scaffold_6	AUGUSTUS	CDS	1791134	1791143	0.59	-	2	transcript_id "g426.t1"; gene_id "g426";
Scaffold_6	AUGUSTUS	CDS	1791302	1791345	0.41	-	1	transcript_id "g426.t1"; gene_id "g426";
Scaffold_6	AUGUSTUS	CDS	1791400	1791503	0.42	-	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_6	AUGUSTUS	start_codon	1791501	1791503	.	-	0	transcript_id "g426.t1"; gene_id "g426";
# protein sequence = [MLDQFDKLKRRNAFLEQYKKEKMFENGLEEFDDARATCEELLNEYKSCEMSVLIGRRLEVGSQLLRGAGQERVGSGKG
# KEREATEATLVLRFFDGSEPMHITSHVDSSLLKYAASQFFELQTTRLPCTLKYISLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g426
###
# start gene g427
Scaffold_6	AUGUSTUS	gene	1801496	1802503	0.98	-	.	g427
Scaffold_6	AUGUSTUS	transcript	1801496	1802503	0.98	-	.	g427.t1
Scaffold_6	AUGUSTUS	stop_codon	1801496	1801498	.	-	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_6	AUGUSTUS	CDS	1801496	1802503	0.98	-	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_6	AUGUSTUS	start_codon	1802501	1802503	.	-	0	transcript_id "g427.t1"; gene_id "g427";
# protein sequence = [MQSSSSTDAPTGTPPSTTPSSLYPPLKDPWAPVPHAKNKSGKSNSATHHNAKIAVAPPRSSHLPKSSSPFGHSYRLRE
# QPPYGQGISSSSPLPPSPSLRPASYLAKRYQRPQKNESRCLQHILPGLFIAFESDRIAFGPPTSSLRIPPEEELRTTNGERFTHIIKLSASKDQSESP
# DIQHHVDSYETQVLNLGISPNSPNFFGLRMHILTSEVDEVPFEAAHRLYTDHRDYNNEHSGGIPLLTQKQLLASREFMCGTGYDLHRHQGARILITAP
# RDHCTDMISVLTCYLAYASGNTAAMVLHEIDKHEGFLGIWKNTVSQYAVSIIQEVVDMRLC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g427
###
# start gene g428
Scaffold_6	AUGUSTUS	gene	1807676	1808472	0.23	-	.	g428
Scaffold_6	AUGUSTUS	transcript	1807676	1808472	0.23	-	.	g428.t1
Scaffold_6	AUGUSTUS	stop_codon	1807676	1807678	.	-	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_6	AUGUSTUS	CDS	1807676	1807936	0.96	-	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_6	AUGUSTUS	CDS	1808079	1808217	0.7	-	1	transcript_id "g428.t1"; gene_id "g428";
Scaffold_6	AUGUSTUS	CDS	1808465	1808472	0.32	-	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_6	AUGUSTUS	start_codon	1808470	1808472	.	-	0	transcript_id "g428.t1"; gene_id "g428";
# protein sequence = [MLCVSQDGGYAEYVTLRTEAVLPISKDLDPAEAAPLLCAGITTFNALRHMGFKVVALSQSDAKKDLATKLGADIYLDG
# SKVNQVEELMKLGGAKVILATAPQGDAITTLLGGLKVGGTMLTVASKYEFHVLECVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g428
###
# start gene g429
Scaffold_6	AUGUSTUS	gene	1822284	1822650	0.51	-	.	g429
Scaffold_6	AUGUSTUS	transcript	1822284	1822650	0.51	-	.	g429.t1
Scaffold_6	AUGUSTUS	stop_codon	1822284	1822286	.	-	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_6	AUGUSTUS	CDS	1822284	1822454	0.71	-	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_6	AUGUSTUS	CDS	1822507	1822650	0.51	-	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_6	AUGUSTUS	start_codon	1822648	1822650	.	-	0	transcript_id "g429.t1"; gene_id "g429";
# protein sequence = [MIALIDPLIVRYVPTWFPFTGWKTFALDSTERRKIQVDGAFELVKKAMKEGTAHPSMVSRYLEENENGGDIPEVAIMD
# MASDAYGGEYLEKIDVYETEDDHRWC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g429
###
# start gene g430
Scaffold_6	AUGUSTUS	gene	1832101	1832636	0.31	+	.	g430
Scaffold_6	AUGUSTUS	transcript	1832101	1832636	0.31	+	.	g430.t1
Scaffold_6	AUGUSTUS	start_codon	1832101	1832103	.	+	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_6	AUGUSTUS	CDS	1832101	1832130	0.32	+	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_6	AUGUSTUS	CDS	1832214	1832636	0.59	+	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_6	AUGUSTUS	stop_codon	1832634	1832636	.	+	0	transcript_id "g430.t1"; gene_id "g430";
# protein sequence = [MNSKAVVHDQIAYEPAWIPTGCEDIAPRTAVRLEPGITFNDLYAFGEANNITLPGGSTPSVSATGGYVLGGGHGGLSN
# TAGLGADRALEFTVVVPTGDVLIANACQNQDLFFALRGGGGGTFGVVMETVTLALPRTPIQVCVFCTWIDPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g430
###
# start gene g431
Scaffold_6	AUGUSTUS	gene	1834302	1834861	0.26	-	.	g431
Scaffold_6	AUGUSTUS	transcript	1834302	1834861	0.26	-	.	g431.t1
Scaffold_6	AUGUSTUS	stop_codon	1834302	1834304	.	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_6	AUGUSTUS	CDS	1834302	1834606	0.81	-	2	transcript_id "g431.t1"; gene_id "g431";
Scaffold_6	AUGUSTUS	CDS	1834660	1834861	0.32	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_6	AUGUSTUS	start_codon	1834859	1834861	.	-	0	transcript_id "g431.t1"; gene_id "g431";
# protein sequence = [MRYNSVTQDGAYAEYVTLRTEAVLPVPKELDPAEAAPLLCAGITTFNALRNVPDLKKGDLVAVLGLGGLGHLGIQYAK
# QMGYKVVALSQSDAKKEMAIKLGADIYLDGSKVNQVEELMKLGGAKVILATAPQGEAIATLLGGLKVGGTMLTVASKYKICFSVGNIANL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g431
###
# start gene g432
Scaffold_6	AUGUSTUS	gene	1838712	1839594	0.98	+	.	g432
Scaffold_6	AUGUSTUS	transcript	1838712	1839594	0.98	+	.	g432.t1
Scaffold_6	AUGUSTUS	start_codon	1838712	1838714	.	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_6	AUGUSTUS	CDS	1838712	1839134	0.98	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_6	AUGUSTUS	CDS	1839178	1839594	1	+	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_6	AUGUSTUS	stop_codon	1839592	1839594	.	+	0	transcript_id "g432.t1"; gene_id "g432";
# protein sequence = [MGAWRLDFNLPVERFSKTEIAGVRHLIDLSLAQPLLHTRFIFISSIGSVQNHSSISAVPEQSFSVPSIAGFDGYSQSK
# YTAERIIDVAVSRAGLDAIIIRGGQLSGSSQNGYWNPKEYIPSLFKTSAAIRAFPDHFMVSSPEIRWLPVDIAGKIVVKLSLNATSRGYYHLENPVST
# SWSYLVNLLSSHAQKAAKPTPVEPVPMSEWLRLIVQASQVKSVDEIPAIKLMDFFRGIGENTNGEGANAVVLDVQRTREVAPEIDVGVLSDVVLLSYW
# DTAST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g432
###
# start gene g433
Scaffold_6	AUGUSTUS	gene	1841562	1842084	0.93	+	.	g433
Scaffold_6	AUGUSTUS	transcript	1841562	1842084	0.93	+	.	g433.t1
Scaffold_6	AUGUSTUS	start_codon	1841562	1841564	.	+	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_6	AUGUSTUS	CDS	1841562	1841711	0.99	+	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_6	AUGUSTUS	CDS	1841785	1842084	0.94	+	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_6	AUGUSTUS	stop_codon	1842082	1842084	.	+	0	transcript_id "g433.t1"; gene_id "g433";
# protein sequence = [MVLQDNGDTTGLFNSAASVDPATGNRTYSGRNYLLPNVGRSNLAVLTGAQSGGNATATGVQFTANGTNYTVSSRKEVI
# LSAGSLHTPQLLELSGIGDEARLTALGIPVVVANSDVGENLQVGYPPPVVLPFIYRTTTGSSNIEFRILAQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g433
###
# start gene g434
Scaffold_6	AUGUSTUS	gene	1842822	1843361	0.98	+	.	g434
Scaffold_6	AUGUSTUS	transcript	1842822	1843361	0.98	+	.	g434.t1
Scaffold_6	AUGUSTUS	start_codon	1842822	1842824	.	+	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_6	AUGUSTUS	CDS	1842822	1843361	0.98	+	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_6	AUGUSTUS	stop_codon	1843359	1843361	.	+	0	transcript_id "g434.t1"; gene_id "g434";
# protein sequence = [MSVDQLSTDKEVLVKGAQVTRNLSQIAPLSSFIASPLNPSANVTTDEDFEKYVPTTYDYRNMDHSCDNHSFVIENVGT
# EWHQVGTASLGPFGEGGVVASDLIVYGTSNLRVVDARSVLNFELMQMPITNAPYSIMPMQIGAHIQATVYAIAEKVSVNTDIIFSGFNKVSQAADIIK
# AAQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g434
###
# start gene g435
Scaffold_6	AUGUSTUS	gene	1846568	1847788	0.66	+	.	g435
Scaffold_6	AUGUSTUS	transcript	1846568	1847788	0.66	+	.	g435.t1
Scaffold_6	AUGUSTUS	start_codon	1846568	1846570	.	+	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_6	AUGUSTUS	CDS	1846568	1847788	0.66	+	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_6	AUGUSTUS	stop_codon	1847786	1847788	.	+	0	transcript_id "g435.t1"; gene_id "g435";
# protein sequence = [MGASHSSVAHPGSFQTPVKVQPQLMPNFKSPPLDHQNVGRRASSSIPSSSMSGVGAGTKKGPLIFAAMATVQQPQPPQ
# STSYNISSSAYPSPPAEYGLYASPSPPTSFQKQHTAPSSNSKRHSHVPDHRLSTPYPINTMKAQPPLPPTPSQNPPPHSSTLINSRRKSTSQKPSAKM
# APPSTPPPLQQQPQRNGMVITGPPPSSSSSVTHHRTLTKSRHPLPPATPPKQVQQRPTPPVSPEVPARDKSPSQIVTPRTPTVISNEEFESAERRVAI
# PLDDDPFARTEGVRMLKPTGIGAREDPPSSSSLSSSSLPLESEARPTVLSDERDESPKESQAQTVSLVNSDETTNYDDEQGDTSSSDNDNVTHANESM
# TMAEPEVMNPATADGFFPPSAAHYPIAHANPKTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g435
###
# start gene g436
Scaffold_6	AUGUSTUS	gene	1848270	1848872	0.3	+	.	g436
Scaffold_6	AUGUSTUS	transcript	1848270	1848872	0.3	+	.	g436.t1
Scaffold_6	AUGUSTUS	start_codon	1848270	1848272	.	+	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_6	AUGUSTUS	CDS	1848270	1848872	0.3	+	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_6	AUGUSTUS	stop_codon	1848870	1848872	.	+	0	transcript_id "g436.t1"; gene_id "g436";
# protein sequence = [MVNATRAYNRVVLRLRAQAELMASSPNLSNSNLAHPIGYVASPRSLPSNSRSVSRAPSPSSSFTHGRSVAHGYGSQNG
# HDGPGASNPNVYMNSLTGFRSPLFRTGRAPLLRVFIPSPEGDWLSDASVLECEAELRRAGLLPDKDKRGSENKGINLLRLGDVVWDMAVGDDGNAGRM
# VWDGSYLIVSCLFILIILFVQRLE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g436
###
# start gene g437
Scaffold_6	AUGUSTUS	gene	1861309	1862791	0.5	-	.	g437
Scaffold_6	AUGUSTUS	transcript	1861309	1862791	0.5	-	.	g437.t1
Scaffold_6	AUGUSTUS	stop_codon	1861309	1861311	.	-	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_6	AUGUSTUS	CDS	1861309	1861700	1	-	2	transcript_id "g437.t1"; gene_id "g437";
Scaffold_6	AUGUSTUS	CDS	1861802	1862118	0.83	-	1	transcript_id "g437.t1"; gene_id "g437";
Scaffold_6	AUGUSTUS	CDS	1862235	1862791	0.55	-	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_6	AUGUSTUS	start_codon	1862789	1862791	.	-	0	transcript_id "g437.t1"; gene_id "g437";
# protein sequence = [MEDVPLEMPPLHEDGEQERYSPVPDSPQHMPLLDGDDGAVADDSAAALLPEAHEEPRSRSNDAGRRHSGGSAHTGESS
# SLVRVETNAETENPDPRGDAPAYFEVVDLNDEAQQRPPIPPIPSSEPTPTNSSMTAASSTASRGTSSRRSLRNLFGWSGRSPMTPPGLPSTSAQSHER
# ADSGGALSLVSNHLTSPSSISLASISAPLTHTVVRTEFTYPKAGPTPEQLKLISSREAFARFGVPYGKDAIAFAASTQDLNPPPEFESEAGPSSSSPP
# RSQSQTRVVARESIGRSKPDTPATTVESSSPSQKEPKVSDLTQPSPLVDSTVSSKDIVEIPGTSSETRISSLNHSPKDDVVPPSHSAAPSVSLAQHAP
# LASPSTPTISSKPPPTSFRNHQPQKPLRPVSVPNPALPLSDPLKLPESR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g437
###
# start gene g438
Scaffold_6	AUGUSTUS	gene	1874628	1875542	0.98	-	.	g438
Scaffold_6	AUGUSTUS	transcript	1874628	1875542	0.98	-	.	g438.t1
Scaffold_6	AUGUSTUS	stop_codon	1874628	1874630	.	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_6	AUGUSTUS	CDS	1874628	1875542	0.98	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_6	AUGUSTUS	start_codon	1875540	1875542	.	-	0	transcript_id "g438.t1"; gene_id "g438";
# protein sequence = [MHILRSTYLPSYDALIRPPYSSDPFPSSNSVPLYGTSTSMWNSPYGSSRLFPQHRELQTLDLFIAVLAQEELLYDTSS
# LHLSRHEAYKDIFDLRQPQSRLEDLVAKEGVKAGLVTLGDRDSVPGTPTTPQTPSEAKGKENSPYFMDIDNNSSLLALPRASTSSLSKPLKKAKSTFS
# MFSAFSSKGKGKGKATIAVQRLSQPAERKVSLSPLPFRSLSINFSTRKISLMYAPSYCASSKSSLTVTGTSSSSAYGGSTYGALGVSYNSRGRKRTIV
# EVQRDRDEALEVSVRRVVRGLREWMEEEAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g438
###
# start gene g439
Scaffold_6	AUGUSTUS	gene	1879202	1879948	0.79	-	.	g439
Scaffold_6	AUGUSTUS	transcript	1879202	1879948	0.79	-	.	g439.t1
Scaffold_6	AUGUSTUS	stop_codon	1879202	1879204	.	-	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_6	AUGUSTUS	CDS	1879202	1879948	0.79	-	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_6	AUGUSTUS	start_codon	1879946	1879948	.	-	0	transcript_id "g439.t1"; gene_id "g439";
# protein sequence = [MASRLRISVNVSLIHEEKIMHIMLRLEGCVFGFAATRHSLIRFPISATTVNSEILSQIEGSSGSIQVEIFHQAKAKDP
# PNDALPKFFEIYTSKKRVGILSKETHVGKLVSEWNKLVSEASSKPELVDMSVAVSAFMAQKDQEELVCRSFVIHKKDILIYDQKTIQIASSLTSTLLK
# HHVGPRLETILDKESKISHEMLAAQIEGRLGSGEGSNAKGPDMKVWNKGKGLEKVRLWLILSRTKSKRSFAD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g439
###
# start gene g440
Scaffold_6	AUGUSTUS	gene	1892278	1893369	0.86	-	.	g440
Scaffold_6	AUGUSTUS	transcript	1892278	1893369	0.86	-	.	g440.t1
Scaffold_6	AUGUSTUS	stop_codon	1892278	1892280	.	-	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_6	AUGUSTUS	CDS	1892278	1892729	0.95	-	2	transcript_id "g440.t1"; gene_id "g440";
Scaffold_6	AUGUSTUS	CDS	1892964	1893369	0.87	-	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_6	AUGUSTUS	start_codon	1893367	1893369	.	-	0	transcript_id "g440.t1"; gene_id "g440";
# protein sequence = [MLKDTVASNSSPEEDSLESLLSHDAQGRLQFGDPKKRHKRTMQALTTISAITEATRGLKAQIGAISLSHTSAEINAIL
# CTVEDGSEALRRHISSVTRTAVSEEVKEARAMLDLLDQAVSTWRVEYPDSSPVKIDNRSDSRCYPESIETLEKKFNLDIDCIPYAVCPNAATTSSSYP
# NDASHPVYPTVCSEIKAVSEEPCGTPLLLHGKPLKTFEYYPFFEWFGKFLSLPGIEDYGDRFCDIVGNHQTIPVDKVDETDGRFVHEFCAQDGELFVA
# DRGDEDVGSLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g440
###
# start gene g441
Scaffold_6	AUGUSTUS	gene	1894194	1894508	0.56	+	.	g441
Scaffold_6	AUGUSTUS	transcript	1894194	1894508	0.56	+	.	g441.t1
Scaffold_6	AUGUSTUS	start_codon	1894194	1894196	.	+	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_6	AUGUSTUS	CDS	1894194	1894508	0.56	+	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_6	AUGUSTUS	stop_codon	1894506	1894508	.	+	0	transcript_id "g441.t1"; gene_id "g441";
# protein sequence = [MKLDTSAETAAKMQDAPWNKMVVSFLASVASDRASVDPDYFGTDKGELDWSSLFRERDCIASFSKLQSPKAASETLPM
# RERSMKVEREGCADMYAVVQSFVPSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g441
###
# start gene g442
Scaffold_6	AUGUSTUS	gene	1895605	1896426	0.75	-	.	g442
Scaffold_6	AUGUSTUS	transcript	1895605	1896426	0.75	-	.	g442.t1
Scaffold_6	AUGUSTUS	stop_codon	1895605	1895607	.	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_6	AUGUSTUS	CDS	1895605	1896426	0.75	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_6	AUGUSTUS	start_codon	1896424	1896426	.	-	0	transcript_id "g442.t1"; gene_id "g442";
# protein sequence = [MQSSPLSARSNSIMDPYRNFDLRPLCADHKEMLPPPVVAAAVDHTPIAPSSGPARTSRDTLRVSPYNSPSPEPLQRRP
# HTAALPSSSSSSIESLSSELEYDSDRERIARLRNTQRVSHPYSGNHGVPVHRTPWCAKSPTADNAHAASSTTGKATQGVDDNQAEGESRSRKGVTFST
# EPTRRRSPPALVFEDDSDDDFLIPKPPGEVGRPGRGGYSLFEVLGWPKKKYDKVKVSLCFCDAVCSLRSLFPRNSSTALSRTIWTVSFLWANNRQPM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g442
###
# start gene g443
Scaffold_6	AUGUSTUS	gene	1904625	1905029	0.84	-	.	g443
Scaffold_6	AUGUSTUS	transcript	1904625	1905029	0.84	-	.	g443.t1
Scaffold_6	AUGUSTUS	stop_codon	1904625	1904627	.	-	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_6	AUGUSTUS	CDS	1904625	1904900	0.84	-	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_6	AUGUSTUS	CDS	1905000	1905029	0.84	-	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_6	AUGUSTUS	start_codon	1905027	1905029	.	-	0	transcript_id "g443.t1"; gene_id "g443";
# protein sequence = [MYKIITVNVKDQEFVRIYIYTDKSVQIRVTRMTEMTYLLTALSAALSSNPLRKFLIDTLLPQATRRTSPSTRPPPRFW
# TDWFGGSNLCRLKNTKNLNDFPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g443
###
# start gene g444
Scaffold_6	AUGUSTUS	gene	1906478	1906990	0.86	-	.	g444
Scaffold_6	AUGUSTUS	transcript	1906478	1906990	0.86	-	.	g444.t1
Scaffold_6	AUGUSTUS	stop_codon	1906478	1906480	.	-	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_6	AUGUSTUS	CDS	1906478	1906990	0.86	-	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_6	AUGUSTUS	start_codon	1906988	1906990	.	-	0	transcript_id "g444.t1"; gene_id "g444";
# protein sequence = [MITICRRRRDEAGVAFWSHTLEVTDILQDGSQSDEEDASVDVEIEGVMMKQDVKKVSRLYWRNPDVEDLYIVADRAPG
# VEAGIFHRAGAPRIPRIRTDKVSHREPPRGLPRCFFREEYLSALMPYELEELELANYNVEMYDFKNYDPNTENGEGYVPNAENDDLQDMDTT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g444
###
# start gene g445
Scaffold_6	AUGUSTUS	gene	1909168	1910932	0.17	-	.	g445
Scaffold_6	AUGUSTUS	transcript	1909168	1910932	0.17	-	.	g445.t1
Scaffold_6	AUGUSTUS	stop_codon	1909168	1909170	.	-	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_6	AUGUSTUS	CDS	1909168	1910040	0.48	-	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_6	AUGUSTUS	CDS	1910651	1910932	0.37	-	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_6	AUGUSTUS	start_codon	1910930	1910932	.	-	0	transcript_id "g445.t1"; gene_id "g445";
# protein sequence = [MLVHHSLYEDQSLTYCFTQLRGELALSNQQKTKLEEKLSEASENINHLTEKNNTLSLEVSVVHSKLDEVEEDCQQLSN
# DFNLLKEDHEALGALESLDDAVAANRRIQDAKAALFKQSADVSAESDRRIGELTEENEGLANDAASASRRLKELVHENEVLVQESTEAAALAHQRILE
# LTSEKEKMENDAVSTTQDVQKLADEKSTLIRQLAATDLKNRQLDDEKTSMMENMGSANRRIQELLDQKKTLVQESVDAASTVSRTIRKLTDEKAKLVN
# DAALANQRIQALTDEKGVLTQRVEAAATTARQRIQELVNEKAKLVTDLASAGQTSQDERRKLTLAEAAAVQKNQEYVDEKANLLQQLEQQNVELRRLK
# VIASLSLLSFQC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g445
###
# start gene g446
Scaffold_6	AUGUSTUS	gene	1920386	1921019	0.91	-	.	g446
Scaffold_6	AUGUSTUS	transcript	1920386	1921019	0.91	-	.	g446.t1
Scaffold_6	AUGUSTUS	stop_codon	1920386	1920388	.	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_6	AUGUSTUS	CDS	1920386	1920687	0.93	-	2	transcript_id "g446.t1"; gene_id "g446";
Scaffold_6	AUGUSTUS	CDS	1920755	1921019	0.91	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_6	AUGUSTUS	start_codon	1921017	1921019	.	-	0	transcript_id "g446.t1"; gene_id "g446";
# protein sequence = [MLSSAGSYGALPKVVTEACNELMAWQEENTDFYYRIGFIPPLIGVREQLAQLVGASDVDELVMVPNASTGLGVVLRNF
# LWQCGDTIIRCNTTYATVYKTIQYIHDVTPGLEISEFQLLFPTTRQAILDGWQKHITNVKANAPQGQKIVAVIDSVVANPAAAMPWKEMVKICKDVGI
# WTIIDGTSSALI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g446
###
# start gene g447
Scaffold_6	AUGUSTUS	gene	1933898	1935052	0.51	-	.	g447
Scaffold_6	AUGUSTUS	transcript	1933898	1935052	0.51	-	.	g447.t1
Scaffold_6	AUGUSTUS	stop_codon	1933898	1933900	.	-	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_6	AUGUSTUS	CDS	1933898	1935052	0.51	-	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_6	AUGUSTUS	start_codon	1935050	1935052	.	-	0	transcript_id "g447.t1"; gene_id "g447";
# protein sequence = [MNLVTSVVRQANSVARTIPATFLRGGTSKGIFLQRSHLPQDTSKWNEIFLGLMGSPDAEYGRQLDGMGGGISSLSKIC
# VVQPASLEQLQTLGVDVEYTFVQVGIRDSTIDYSGNCGNLSSMIGVFALDEGMVDNTAQRIQNSRITVRAFNTNTRKIVNTTFPIDPDSGMADLTLPE
# TRIAGVSGEASQIQLDFHKPSGARTGKLLPAEVPMTKLEITEGTFCASLVDATNPTIFVDRAEIVNVSKTEDPGSHEQLRLLEILRREGAIRMGLDPN
# AQAQPKIAMLSPPKATDSDADIEIIALSMGVPHKAVPMTVGLCLGVAANTRGTLPSKFLRRKIVGESKLVKLRHPGGVVEVGALFDTEGKVESASVIR
# TGRRLMKGYVWY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g447
###
# start gene g448
Scaffold_6	AUGUSTUS	gene	1936127	1937236	0.61	+	.	g448
Scaffold_6	AUGUSTUS	transcript	1936127	1937236	0.61	+	.	g448.t1
Scaffold_6	AUGUSTUS	start_codon	1936127	1936129	.	+	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_6	AUGUSTUS	CDS	1936127	1937236	0.61	+	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_6	AUGUSTUS	stop_codon	1937234	1937236	.	+	0	transcript_id "g448.t1"; gene_id "g448";
# protein sequence = [MSFGRLRRDGTFTIEHSFAGKIHCDLVRRRLVVTLVREQTSNVVDGHPAHDTFLSIFNRLSVEDMIPSPIFSYSSSSV
# QAVRRSSSTQESELHLEFSNPAIFEQPHAASFLNRQQSSQRLTVTGLPGCNFMPLVSQNLRIIFSNDDELLQFLTRAHNIQLPPARFIAISTIDVRVY
# NNDRFDELMTFTRTLPFPLGFQLEKSVWDGIIEPSELYEKNMRQAILKVQEDHPEIAAPIFRYFVSTLQIPTFRDPPRSPPRPRSEPSEDSLSKSARR
# RRKQRNRRRELASADNKGLELHEQLAQAAHAYVLDSQRPQRRYASSPNPALYEAYHVSITPSRQVLEGPLPDLSNGILRLYEDFQDCFPPGFLPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g448
###
# start gene g449
Scaffold_6	AUGUSTUS	gene	1937566	1938504	0.69	+	.	g449
Scaffold_6	AUGUSTUS	transcript	1937566	1938504	0.69	+	.	g449.t1
Scaffold_6	AUGUSTUS	start_codon	1937566	1937568	.	+	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_6	AUGUSTUS	CDS	1937566	1938504	0.69	+	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_6	AUGUSTUS	stop_codon	1938502	1938504	.	+	0	transcript_id "g449.t1"; gene_id "g449";
# protein sequence = [MFSASTPSVALSLSQLHKIPDRISSNSNGQNAVFTDGCSTISPALARKVARLVLRSASKIIPSCFQFRLGGAKGVVFQ
# DPFLNDEVLCIRPSQTKFESTDLNLDITLTSAHPLALFLNRPLIALLEHHGVPEHNFIKLQDLAIRDTQRIRSSLTEAATTFAQHGLGSSFQLESLFK
# NIAQILHLEIAQHASERNSSTAQLVILKIAVAHGITHILREIKHRGRIRVPGSYTLLGVSDEWDCLEEGEIFAQVYDPRTQKLTPIEGRVLITRSPQI
# HPGDCQFVEAVRRKELDHLKNVVVFSCKWVKIINKPTA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g449
###
# start gene g450
Scaffold_6	AUGUSTUS	gene	1938869	1939573	0.99	+	.	g450
Scaffold_6	AUGUSTUS	transcript	1938869	1939573	0.99	+	.	g450.t1
Scaffold_6	AUGUSTUS	start_codon	1938869	1938871	.	+	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_6	AUGUSTUS	CDS	1938869	1939573	0.99	+	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_6	AUGUSTUS	stop_codon	1939571	1939573	.	+	0	transcript_id "g450.t1"; gene_id "g450";
# protein sequence = [MYTIIIDRHLKIKSDLVGYISTTHLRISDVNGLDCPDCLRLAKAASHAVDFPKVGTAVDFKTLPKAPEGPRPDYLSGE
# GYRPKPGDNRYYPSVKVLGQLFRRVPTDEYEVEMEDYDDPIEFMKIDNAMGLAARRCLRKLQMGRFGAFSATLEMNPDEDLIDEMHHVFEDYREQLIV
# IAKTHTASKKANTWLSEEELISGAIMERYPDPKRRREVTTAMNLQVIIFPFHLDDSSQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g450
###
# start gene g451
Scaffold_6	AUGUSTUS	gene	1945738	1947194	0.57	+	.	g451
Scaffold_6	AUGUSTUS	transcript	1945738	1947194	0.57	+	.	g451.t1
Scaffold_6	AUGUSTUS	start_codon	1945738	1945740	.	+	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_6	AUGUSTUS	CDS	1945738	1946317	0.71	+	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_6	AUGUSTUS	CDS	1946385	1946720	0.76	+	2	transcript_id "g451.t1"; gene_id "g451";
Scaffold_6	AUGUSTUS	CDS	1946899	1947194	0.75	+	2	transcript_id "g451.t1"; gene_id "g451";
Scaffold_6	AUGUSTUS	stop_codon	1947192	1947194	.	+	0	transcript_id "g451.t1"; gene_id "g451";
# protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPLRASIIMDIEALHQAII
# LALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSATSMIIHFPAISAEEPQLSKLYVVNTPGPRSETLFVTTLPLALSVVA
# ISPAVTALRLVETSAGSAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADG
# QTERVNQTLEQYIRIYCSYQQDDWSPYFRSPTQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDY
# FAEFTGFPRLTAGAGYAESFPESYSISSTSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g451
###
# start gene g452
Scaffold_6	AUGUSTUS	gene	1953134	1953529	0.67	-	.	g452
Scaffold_6	AUGUSTUS	transcript	1953134	1953529	0.67	-	.	g452.t1
Scaffold_6	AUGUSTUS	stop_codon	1953134	1953136	.	-	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_6	AUGUSTUS	CDS	1953134	1953529	0.67	-	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_6	AUGUSTUS	start_codon	1953527	1953529	.	-	0	transcript_id "g452.t1"; gene_id "g452";
# protein sequence = [MTANQRLATAMIRYDAEVKGIEEKNEQTLKEWEASVQEWEKERDIARTERRKPAWTKPSKPTYTSGALVKPPAKPKLA
# DFLSAQRIAPSGNQRNAIRYTEDGCGSESDKGSDSEDDDDEDEGEDEGGGSDA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g452
###
# start gene g453
Scaffold_6	AUGUSTUS	gene	1957622	1958360	0.42	+	.	g453
Scaffold_6	AUGUSTUS	transcript	1957622	1958360	0.42	+	.	g453.t1
Scaffold_6	AUGUSTUS	start_codon	1957622	1957624	.	+	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_6	AUGUSTUS	CDS	1957622	1958196	0.59	+	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_6	AUGUSTUS	CDS	1958318	1958360	0.64	+	1	transcript_id "g453.t1"; gene_id "g453";
Scaffold_6	AUGUSTUS	stop_codon	1958358	1958360	.	+	0	transcript_id "g453.t1"; gene_id "g453";
# protein sequence = [MWGWAMYGSEQDTENHNVGGEEIEGNDGKEAVHIPHNHISAPNPLDVLTSAALSAENPEQAFARLKSDSQETEEEEEK
# LIDVSEVKGVTVPADGDIDMADLVTINRSTVVANGIASPRASTPDSIASSRPSPPNNVPQVAYVSTSRIPAGASTTEDEDDNTDIEENEIEPDEQHKS
# ILTAKSRSKPNLRIDADEFEGEGFSWWSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g453
###
# start gene g454
Scaffold_6	AUGUSTUS	gene	1958633	1959157	0.54	+	.	g454
Scaffold_6	AUGUSTUS	transcript	1958633	1959157	0.54	+	.	g454.t1
Scaffold_6	AUGUSTUS	start_codon	1958633	1958635	.	+	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_6	AUGUSTUS	CDS	1958633	1959157	0.54	+	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_6	AUGUSTUS	stop_codon	1959155	1959157	.	+	0	transcript_id "g454.t1"; gene_id "g454";
# protein sequence = [MLDPDPDPSDKSDAEPEPDVEVDVEPDVDAPSDVSDGEDEKEDDDDEGEGEDEKDDADELEVDEVQDDDKEDDDKDDE
# DKDDEDKEVSDKEDVEKDIDDDDRSEINLEDEEEESDLQPAHRVEALDMLAIVELKFALLKREIVYREDGRISLGRILGSKWYAITFRPVLRSHIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g454
###
# start gene g455
Scaffold_6	AUGUSTUS	gene	1959810	1960646	0.51	+	.	g455
Scaffold_6	AUGUSTUS	transcript	1959810	1960646	0.51	+	.	g455.t1
Scaffold_6	AUGUSTUS	start_codon	1959810	1959812	.	+	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_6	AUGUSTUS	CDS	1959810	1960646	0.51	+	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_6	AUGUSTUS	stop_codon	1960644	1960646	.	+	0	transcript_id "g455.t1"; gene_id "g455";
# protein sequence = [MTGARRSGPGSTQTNTMGMGMNMSVGNNGLNMDMNINLPIYEQGVHGPPVGLGHVYTPGSGTYNVSNPMRERLGPGSS
# SLSHVPGPARRIVSGPGTLSGSSLSSQSTVGMGHVHEPPFVVGGLPPPMGSGGGSESLLPSFGPSRSMGGVGPRSGSTAGLRSGSAGGGVDREREIRS
# VPSGSGGSGGRSSFHNGQSQHLFSDPSTTTNGAFPESEHQRDGDVVVPSSASSSVHGIHGRQVSSSTHFGPPGPGIGGGGPLLHRVHGKDQYHPSDPV
# LASD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g455
###
# start gene g456
Scaffold_6	AUGUSTUS	gene	1960673	1961563	0.59	+	.	g456
Scaffold_6	AUGUSTUS	transcript	1960673	1961563	0.59	+	.	g456.t1
Scaffold_6	AUGUSTUS	start_codon	1960673	1960675	.	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_6	AUGUSTUS	CDS	1960673	1961563	0.59	+	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_6	AUGUSTUS	stop_codon	1961561	1961563	.	+	0	transcript_id "g456.t1"; gene_id "g456";
# protein sequence = [MGPGMGMGGFGTGHRWEAEEHERELERTEHTDAGDIRGQERDRDRERDRDRDRERDQHIAHQHRHIQQEQQHARPQSA
# GALNTPSHVHSYPDQAPHHHHHVRPHHHHIVHHHGPSSVGNNTSLTVVRGPSVSPRMRRGEMLLERERENGNRPPRTIVHRHPPTEVVNLTSSKLTPV
# GHSTSQFSSNRIPDDSPLEYHERQRDGRRMNGGRPSSGSGQRLLDERERERDRDNRDRIVTGIKLAPCHSYQSQLPSTNQRYCDLLVCIVFSSPSWNT
# IDRDDPYRPSSSISHTNLVIDH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g456
###
# start gene g457
Scaffold_6	AUGUSTUS	gene	1966353	1968503	0.51	+	.	g457
Scaffold_6	AUGUSTUS	transcript	1966353	1968503	0.51	+	.	g457.t1
Scaffold_6	AUGUSTUS	start_codon	1966353	1966355	.	+	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_6	AUGUSTUS	CDS	1966353	1967224	0.51	+	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_6	AUGUSTUS	CDS	1967300	1968503	0.82	+	1	transcript_id "g457.t1"; gene_id "g457";
Scaffold_6	AUGUSTUS	stop_codon	1968501	1968503	.	+	0	transcript_id "g457.t1"; gene_id "g457";
# protein sequence = [MPNLLSTAELCASCLLLLRRLTPPCTSLPPLPPLNPPTSALFAGPEWESWLEHDLDQPKADIRLREATLLSLASISLF
# SNDIRRALAEDEDETQSIDSNDTSQLHSSPSSSHQSQSSLSLILAALLSPHTSLRCAACHVVRALTRSVAVIRTNFVDSGLGWIVFAAFMGWPQARPR
# TALGTSGSEEEDIRVVASALRAVCNAVCEFSPLKSIYIEHGLLPRLAEFIHSDHLDADFDYPDAESDVDTEDSLRFNSLWAVKNLVRKSGPATKRQVI
# SVLGWHRQKSTAYPETALLSSHSAKILEQVLNILRNLAEDEDGISIVFNELDIRNPFNFPTSPSPTSSTGFLLLSRLTSILNQTSSPSHSSHPGSLSH
# SPYSSSQDVLIQSTSLLANLVNSSDVNHHRMILTCPGMAHALRRVLAEQGPEVRRPVIRIVLEMVKVDLSASVTSAAAIAEELGPLKDGEESGTNTSA
# IQEGNDEEASGADTMEIGYGTTPFGSSVITDISLNPSSAGAGRTRGHSRNQGLTGARKILSDAGFVGTLRRIVDQHHYHPSLTHPHSHGHPPHPHASV
# AAASSGLGHTGSGIGAHSHPHAHAYGNFGLSSPNSVLLDSPGIGVGARAGGASVGSLIVGNGIVGNAGREDREDLETARTALDWLERGDMYMYVNSYA
# RSTSRSGGGTGSSVSTGDSADVSDH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g457
###
# start gene g458
Scaffold_6	AUGUSTUS	gene	1970893	1971381	0.72	+	.	g458
Scaffold_6	AUGUSTUS	transcript	1970893	1971381	0.72	+	.	g458.t1
Scaffold_6	AUGUSTUS	start_codon	1970893	1970895	.	+	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_6	AUGUSTUS	CDS	1970893	1971381	0.72	+	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_6	AUGUSTUS	stop_codon	1971379	1971381	.	+	0	transcript_id "g458.t1"; gene_id "g458";
# protein sequence = [MEKTTQKTNNHSPSKLHNQQTCLPTRLLQSPGKLCSTQSSMISTPYTDFYSKANGQYNSMMGTAKEAFGNAIGGDSWT
# QAGKEQHVQGEAEYNAAQAKEYANGTIDRAGGKIDSVMGAVTGDKQQQMAGKDVHSSQSIIVLNTNSGNVRHDKGRVQQEANQP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g458
###
# start gene g459
Scaffold_6	AUGUSTUS	gene	1973808	1974152	0.63	-	.	g459
Scaffold_6	AUGUSTUS	transcript	1973808	1974152	0.63	-	.	g459.t1
Scaffold_6	AUGUSTUS	stop_codon	1973808	1973810	.	-	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_6	AUGUSTUS	CDS	1973808	1974152	0.63	-	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_6	AUGUSTUS	start_codon	1974150	1974152	.	-	0	transcript_id "g459.t1"; gene_id "g459";
# protein sequence = [MFTTSLVDGVLTYSDSPLLRAIRFGRVMVVDEADKAPEHVVAVFRSLAGRGELTLSDGRRVRKKGKPGEKEQNEDGRD
# DIIVHKDFRLVLLANRPGYRKLLFSTSISFANIMNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g459
###
# start gene g460
Scaffold_6	AUGUSTUS	gene	1974421	1975323	0.75	-	.	g460
Scaffold_6	AUGUSTUS	transcript	1974421	1975323	0.75	-	.	g460.t1
Scaffold_6	AUGUSTUS	stop_codon	1974421	1974423	.	-	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_6	AUGUSTUS	CDS	1974421	1975323	0.75	-	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_6	AUGUSTUS	start_codon	1975321	1975323	.	-	0	transcript_id "g460.t1"; gene_id "g460";
# protein sequence = [MRRRVLSDRNNTTNSSSTRTTWEPSPLIRGAWSGKLVWLEGIDVITGTGAAGSLSRFVQDREIELWEGRRIVAKKEEE
# EAADLLTTAHPSFRLFVTASKSLQLRDWLSDEHANMFFTIPSRPMSSSEERTVLVNTGCDPAVVDLLLTFAEKYRQRMDIRVSSANVGNGHNSSSAVQ
# RNRKLGTRTLIRISKRLALFPQEASQETLRKIFDHALLSEFLPTTERMVLNGLLEEVGLGSANFEEDNSYSRPPFIDSDAQPAALIFPRPVVLSQAIP
# PSLYQPLLPPQYLFLILLEILLDPCH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g460
###
# start gene g461
Scaffold_6	AUGUSTUS	gene	1985148	1985810	0.57	-	.	g461
Scaffold_6	AUGUSTUS	transcript	1985148	1985810	0.57	-	.	g461.t1
Scaffold_6	AUGUSTUS	stop_codon	1985148	1985150	.	-	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_6	AUGUSTUS	CDS	1985148	1985810	0.57	-	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_6	AUGUSTUS	start_codon	1985808	1985810	.	-	0	transcript_id "g461.t1"; gene_id "g461";
# protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPLCKGRCS
# ATGTFAVGFTDNSGDPSWGLTSLSLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAAR
# AADRSSTTPTVPPLHPSIPEEYASLQTSSTRLLQIHFLNTDLTT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g461
###
# start gene g462
Scaffold_6	AUGUSTUS	gene	1997117	1997821	0.45	+	.	g462
Scaffold_6	AUGUSTUS	transcript	1997117	1997821	0.45	+	.	g462.t1
Scaffold_6	AUGUSTUS	start_codon	1997117	1997119	.	+	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_6	AUGUSTUS	CDS	1997117	1997324	0.56	+	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_6	AUGUSTUS	CDS	1997385	1997821	0.69	+	2	transcript_id "g462.t1"; gene_id "g462";
Scaffold_6	AUGUSTUS	stop_codon	1997819	1997821	.	+	0	transcript_id "g462.t1"; gene_id "g462";
# protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS
# KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE
# DEDEDTAPPPKRLKTTSSISGKIFILHFLSHFINSIRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g462
###
# start gene g463
Scaffold_6	AUGUSTUS	gene	1998419	1998975	0.38	+	.	g463
Scaffold_6	AUGUSTUS	transcript	1998419	1998975	0.38	+	.	g463.t1
Scaffold_6	AUGUSTUS	start_codon	1998419	1998421	.	+	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_6	AUGUSTUS	CDS	1998419	1998467	0.39	+	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_6	AUGUSTUS	CDS	1998530	1998975	0.68	+	2	transcript_id "g463.t1"; gene_id "g463";
Scaffold_6	AUGUSTUS	stop_codon	1998973	1998975	.	+	0	transcript_id "g463.t1"; gene_id "g463";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKESRGGLRTRGPAVQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g463
###
# start gene g464
Scaffold_6	AUGUSTUS	gene	2000082	2001526	0.26	+	.	g464
Scaffold_6	AUGUSTUS	transcript	2000082	2001526	0.26	+	.	g464.t1
Scaffold_6	AUGUSTUS	start_codon	2000082	2000084	.	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_6	AUGUSTUS	CDS	2000082	2000249	0.72	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_6	AUGUSTUS	CDS	2000308	2000328	0.38	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_6	AUGUSTUS	CDS	2000887	2001019	0.58	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_6	AUGUSTUS	CDS	2001101	2001252	0.71	+	2	transcript_id "g464.t1"; gene_id "g464";
Scaffold_6	AUGUSTUS	CDS	2001332	2001526	0.68	+	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_6	AUGUSTUS	stop_codon	2001524	2001526	.	+	0	transcript_id "g464.t1"; gene_id "g464";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTFVNRRSTPYPTGPNKGS
# NKDEKSAVNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLIWLRLFCSDASFATAQSI
# PTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g464
###
# start gene g465
Scaffold_6	AUGUSTUS	gene	2001932	2004252	0.41	-	.	g465
Scaffold_6	AUGUSTUS	transcript	2001932	2004252	0.41	-	.	g465.t1
Scaffold_6	AUGUSTUS	stop_codon	2001932	2001934	.	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_6	AUGUSTUS	CDS	2001932	2003327	0.54	-	1	transcript_id "g465.t1"; gene_id "g465";
Scaffold_6	AUGUSTUS	CDS	2003366	2004252	0.5	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_6	AUGUSTUS	start_codon	2004250	2004252	.	-	0	transcript_id "g465.t1"; gene_id "g465";
# protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP
# NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDNFKDQIDPRSGYLYETAQEADD
# IELDVQEALDEERSYEIRRNHMNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHR
# NTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPS
# NGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIK
# ATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRR
# FERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRLRVALISLLKWMEQYSKRRSEPSEYCRISREMNQLNCQTIFTNLST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g465
###
# start gene g466
Scaffold_6	AUGUSTUS	gene	2004958	2006641	0.27	+	.	g466
Scaffold_6	AUGUSTUS	transcript	2004958	2006641	0.27	+	.	g466.t1
Scaffold_6	AUGUSTUS	start_codon	2004958	2004960	.	+	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_6	AUGUSTUS	CDS	2004958	2005250	0.62	+	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_6	AUGUSTUS	CDS	2005291	2005718	0.45	+	1	transcript_id "g466.t1"; gene_id "g466";
Scaffold_6	AUGUSTUS	CDS	2006313	2006641	0.83	+	2	transcript_id "g466.t1"; gene_id "g466";
Scaffold_6	AUGUSTUS	stop_codon	2006639	2006641	.	+	0	transcript_id "g466.t1"; gene_id "g466";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRRGQPPVVAPARGRPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNMTIWMTIPAVYRVVSLVTPVDLVVLVVPAVP
# AVLVDLVDLVLPSPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDASGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQ
# SGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g466
###
# start gene g467
Scaffold_6	AUGUSTUS	gene	2009451	2010502	0.7	+	.	g467
Scaffold_6	AUGUSTUS	transcript	2009451	2010502	0.7	+	.	g467.t1
Scaffold_6	AUGUSTUS	start_codon	2009451	2009453	.	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_6	AUGUSTUS	CDS	2009451	2009747	0.7	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_6	AUGUSTUS	CDS	2009831	2010502	0.78	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_6	AUGUSTUS	stop_codon	2010500	2010502	.	+	0	transcript_id "g467.t1"; gene_id "g467";
# protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA
# LSMELHYTSGYHPEADGQTERFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPE
# FPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSK
# LDRRYKRCPLRYYIRWAGYEGTDDEFSGLLLMNYMLTNWYPHSTLDTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g467
###
# start gene g468
Scaffold_6	AUGUSTUS	gene	2013070	2013720	0.55	-	.	g468
Scaffold_6	AUGUSTUS	transcript	2013070	2013720	0.55	-	.	g468.t1
Scaffold_6	AUGUSTUS	stop_codon	2013070	2013072	.	-	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_6	AUGUSTUS	CDS	2013070	2013720	0.55	-	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_6	AUGUSTUS	start_codon	2013718	2013720	.	-	0	transcript_id "g468.t1"; gene_id "g468";
# protein sequence = [MNFELKDTFMVIRYWNYLNCRKHPKPFAPTGRYTEERKEIIDKNHPEGFLWERERDLMHEMMCKQEAGFAWEPSEAGT
# FKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARS
# FSGRSCGGTLDLYVGYDEQELDQLSREHDDVSKRRMDHIG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g468
###
# start gene g469
Scaffold_6	AUGUSTUS	gene	2014994	2015887	0.83	-	.	g469
Scaffold_6	AUGUSTUS	transcript	2014994	2015887	0.83	-	.	g469.t1
Scaffold_6	AUGUSTUS	stop_codon	2014994	2014996	.	-	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_6	AUGUSTUS	CDS	2014994	2015887	0.83	-	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_6	AUGUSTUS	start_codon	2015885	2015887	.	-	0	transcript_id "g469.t1"; gene_id "g469";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDD
# ERRNIAIVANQAWHMKTIVIIQW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g469
###
# start gene g470
Scaffold_6	AUGUSTUS	gene	2015917	2016465	0.52	-	.	g470
Scaffold_6	AUGUSTUS	transcript	2015917	2016465	0.52	-	.	g470.t1
Scaffold_6	AUGUSTUS	stop_codon	2015917	2015919	.	-	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_6	AUGUSTUS	CDS	2015917	2016465	0.52	-	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_6	AUGUSTUS	start_codon	2016463	2016465	.	-	0	transcript_id "g470.t1"; gene_id "g470";
# protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP
# EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD
# SSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g470
###
# start gene g471
Scaffold_6	AUGUSTUS	gene	2016549	2018662	0.86	-	.	g471
Scaffold_6	AUGUSTUS	transcript	2016549	2018662	0.86	-	.	g471.t1
Scaffold_6	AUGUSTUS	stop_codon	2016549	2016551	.	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_6	AUGUSTUS	CDS	2016549	2017884	0.92	-	1	transcript_id "g471.t1"; gene_id "g471";
Scaffold_6	AUGUSTUS	CDS	2018646	2018662	0.89	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_6	AUGUSTUS	start_codon	2018660	2018662	.	-	0	transcript_id "g471.t1"; gene_id "g471";
# protein sequence = [MRLYILKTAYFEEFGESRSLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTENNSKWLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g471
###
# start gene g472
Scaffold_6	AUGUSTUS	gene	2032627	2033028	0.9	-	.	g472
Scaffold_6	AUGUSTUS	transcript	2032627	2033028	0.9	-	.	g472.t1
Scaffold_6	AUGUSTUS	stop_codon	2032627	2032629	.	-	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_6	AUGUSTUS	CDS	2032627	2033028	0.9	-	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_6	AUGUSTUS	start_codon	2033026	2033028	.	-	0	transcript_id "g472.t1"; gene_id "g472";
# protein sequence = [MLHECDEHIVPPKEDEKKEGDKEKKEGEEKKDGEEKKEEPSKQDDAFQTFAVIAIALISMGEEIGSQMSMRQFNHLVS
# SFKIFLQRSVFSHPQRRCIMVNPTYGKQYLLPSALLMLQIPTTNPRNTFEVQSRQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g472
###
# start gene g473
Scaffold_6	AUGUSTUS	gene	2035198	2035374	0.97	-	.	g473
Scaffold_6	AUGUSTUS	transcript	2035198	2035374	0.97	-	.	g473.t1
Scaffold_6	AUGUSTUS	stop_codon	2035198	2035200	.	-	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_6	AUGUSTUS	CDS	2035198	2035374	0.97	-	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_6	AUGUSTUS	start_codon	2035372	2035374	.	-	0	transcript_id "g473.t1"; gene_id "g473";
# protein sequence = [MSDPAKFAIPVPSKDPASKKPDQTDKEEGTSKLEVKKDEEKDGDELVLYFPKSELEGY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g473
###
# start gene g474
Scaffold_6	AUGUSTUS	gene	2040846	2041566	0.32	+	.	g474
Scaffold_6	AUGUSTUS	transcript	2040846	2041566	0.32	+	.	g474.t1
Scaffold_6	AUGUSTUS	start_codon	2040846	2040848	.	+	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_6	AUGUSTUS	CDS	2040846	2040902	0.58	+	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_6	AUGUSTUS	CDS	2040997	2041566	0.45	+	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_6	AUGUSTUS	stop_codon	2041564	2041566	.	+	0	transcript_id "g474.t1"; gene_id "g474";
# protein sequence = [MSNPTPAPTTLLPIFMASRDRYKSERIDIAVSYMQGPKVSSWVQNYTDDNFNDDEEEWKVTWKGFKDALNASFLDKGL
# TENAQEKLEHLRQGPNERAEDFFKEFEVIMQDAGYAKDAPYVVRLIETNVKPKLIDQVYGTVMRIEKFDELKQKIININDIWWRVRKCGEIGQADTSG
# MLGKDLVARDGNTKHRLRPLRYPPRIGKTVLE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g474
###
# start gene g475
Scaffold_6	AUGUSTUS	gene	2042393	2042707	1	+	.	g475
Scaffold_6	AUGUSTUS	transcript	2042393	2042707	1	+	.	g475.t1
Scaffold_6	AUGUSTUS	start_codon	2042393	2042395	.	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_6	AUGUSTUS	CDS	2042393	2042707	1	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_6	AUGUSTUS	stop_codon	2042705	2042707	.	+	0	transcript_id "g475.t1"; gene_id "g475";
# protein sequence = [MAVTNLGKTDIFLGIDWLRYHNPSIDWKESTLTFERCPDKCGYLPHYESPEDDGTEEKLSMVKGSSGSIGMDLSDQGH
# IKVQTTTDAAAPYLAEYADVFSKKGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g475
###
# start gene g476
Scaffold_6	AUGUSTUS	gene	2046858	2047563	0.26	+	.	g476
Scaffold_6	AUGUSTUS	transcript	2046858	2047563	0.26	+	.	g476.t1
Scaffold_6	AUGUSTUS	start_codon	2046858	2046860	.	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_6	AUGUSTUS	CDS	2046858	2047068	0.36	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_6	AUGUSTUS	CDS	2047127	2047563	0.78	+	2	transcript_id "g476.t1"; gene_id "g476";
Scaffold_6	AUGUSTUS	stop_codon	2047561	2047563	.	+	0	transcript_id "g476.t1"; gene_id "g476";
# protein sequence = [MMRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSAR
# SKDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESED
# EDEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g476
###
# start gene g477
Scaffold_6	AUGUSTUS	gene	2048475	2048819	0.46	+	.	g477
Scaffold_6	AUGUSTUS	transcript	2048475	2048819	0.46	+	.	g477.t1
Scaffold_6	AUGUSTUS	start_codon	2048475	2048477	.	+	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_6	AUGUSTUS	CDS	2048475	2048819	0.46	+	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_6	AUGUSTUS	stop_codon	2048817	2048819	.	+	0	transcript_id "g477.t1"; gene_id "g477";
# protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS
# SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g477
###
# start gene g478
Scaffold_6	AUGUSTUS	gene	2050727	2051293	0.96	+	.	g478
Scaffold_6	AUGUSTUS	transcript	2050727	2051293	0.96	+	.	g478.t1
Scaffold_6	AUGUSTUS	start_codon	2050727	2050729	.	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_6	AUGUSTUS	CDS	2050727	2050784	0.96	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_6	AUGUSTUS	CDS	2050866	2051293	1	+	2	transcript_id "g478.t1"; gene_id "g478";
Scaffold_6	AUGUSTUS	stop_codon	2051291	2051293	.	+	0	transcript_id "g478.t1"; gene_id "g478";
# protein sequence = [MFLLVSARFIATDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRA
# RIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g478
###
# start gene g479
Scaffold_6	AUGUSTUS	gene	2051552	2054015	0.06	-	.	g479
Scaffold_6	AUGUSTUS	transcript	2051552	2054015	0.06	-	.	g479.t1
Scaffold_6	AUGUSTUS	stop_codon	2051552	2051554	.	-	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_6	AUGUSTUS	CDS	2051552	2052135	0.77	-	2	transcript_id "g479.t1"; gene_id "g479";
Scaffold_6	AUGUSTUS	CDS	2052270	2052667	0.33	-	1	transcript_id "g479.t1"; gene_id "g479";
Scaffold_6	AUGUSTUS	CDS	2052806	2052833	0.26	-	2	transcript_id "g479.t1"; gene_id "g479";
Scaffold_6	AUGUSTUS	CDS	2053086	2053421	0.86	-	2	transcript_id "g479.t1"; gene_id "g479";
Scaffold_6	AUGUSTUS	CDS	2053559	2054015	0.21	-	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_6	AUGUSTUS	start_codon	2054013	2054015	.	-	0	transcript_id "g479.t1"; gene_id "g479";
# protein sequence = [MPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCATHGPDGLSRITPGGWQTKRPEV
# NPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDAHVKSSVGILVEKEKRMHI
# QMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEK
# YGIKGIRISAYNSQANGKIERAHLDIRQALIKATVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWD
# FKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYW
# MTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g479
###
# start gene g480
Scaffold_6	AUGUSTUS	gene	2055083	2055558	0.59	-	.	g480
Scaffold_6	AUGUSTUS	transcript	2055083	2055558	0.59	-	.	g480.t1
Scaffold_6	AUGUSTUS	stop_codon	2055083	2055085	.	-	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_6	AUGUSTUS	CDS	2055083	2055479	0.65	-	1	transcript_id "g480.t1"; gene_id "g480";
Scaffold_6	AUGUSTUS	CDS	2055536	2055558	0.59	-	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_6	AUGUSTUS	start_codon	2055556	2055558	.	-	0	transcript_id "g480.t1"; gene_id "g480";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVLNEPPTNKLEERIKLNQQDRSPINLIDETNKQVIMKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g480
###
# start gene g481
Scaffold_6	AUGUSTUS	gene	2056578	2057315	0.71	-	.	g481
Scaffold_6	AUGUSTUS	transcript	2056578	2057315	0.71	-	.	g481.t1
Scaffold_6	AUGUSTUS	stop_codon	2056578	2056580	.	-	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_6	AUGUSTUS	CDS	2056578	2057315	0.71	-	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_6	AUGUSTUS	start_codon	2057313	2057315	.	-	0	transcript_id "g481.t1"; gene_id "g481";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRICLKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g481
###
# start gene g482
Scaffold_6	AUGUSTUS	gene	2057345	2057953	0.65	-	.	g482
Scaffold_6	AUGUSTUS	transcript	2057345	2057953	0.65	-	.	g482.t1
Scaffold_6	AUGUSTUS	stop_codon	2057345	2057347	.	-	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_6	AUGUSTUS	CDS	2057345	2057953	0.65	-	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_6	AUGUSTUS	start_codon	2057951	2057953	.	-	0	transcript_id "g482.t1"; gene_id "g482";
# protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD
# HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS
# DRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g482
###
# start gene g483
Scaffold_6	AUGUSTUS	gene	2058007	2059029	0.91	-	.	g483
Scaffold_6	AUGUSTUS	transcript	2058007	2059029	0.91	-	.	g483.t1
Scaffold_6	AUGUSTUS	stop_codon	2058007	2058009	.	-	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_6	AUGUSTUS	CDS	2058007	2059029	0.91	-	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_6	AUGUSTUS	start_codon	2059027	2059029	.	-	0	transcript_id "g483.t1"; gene_id "g483";
# protein sequence = [MNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESL
# IPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCK
# STDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIE
# ELSDRLGNLEAHRXNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g483
###
# start gene g484
Scaffold_6	AUGUSTUS	gene	2059063	2061104	0.32	-	.	g484
Scaffold_6	AUGUSTUS	transcript	2059063	2061104	0.32	-	.	g484.t1
Scaffold_6	AUGUSTUS	stop_codon	2059063	2059065	.	-	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_6	AUGUSTUS	CDS	2059063	2060087	0.6	-	2	transcript_id "g484.t1"; gene_id "g484";
Scaffold_6	AUGUSTUS	CDS	2061089	2061104	0.46	-	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_6	AUGUSTUS	start_codon	2061102	2061104	.	-	0	transcript_id "g484.t1"; gene_id "g484";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGCARNSCERCISYFYVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g484
###
# command line:
# augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000004