# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_1/input_1.fa_chunk_0000003 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 1779288, name = Scaffold_11) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 Scaffold_11 AUGUSTUS gene 3606 5081 0.67 + . g1 Scaffold_11 AUGUSTUS transcript 3606 5081 0.67 + . g1.t1 Scaffold_11 AUGUSTUS start_codon 3606 3608 . + 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_11 AUGUSTUS CDS 3606 5081 0.67 + 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_11 AUGUSTUS stop_codon 5079 5081 . + 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGNNPNVLLLNLLVTHLLTSIWT # LVITMIKTLLSTPTIRVPTNNHDDLDDDSGGLPRGEPGDPSGPGGLVDPVLPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKV # KEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGN # LKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKT # GSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGR # AAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 Scaffold_11 AUGUSTUS gene 5412 6116 0.85 + . g2 Scaffold_11 AUGUSTUS transcript 5412 6116 0.85 + . g2.t1 Scaffold_11 AUGUSTUS start_codon 5412 5414 . + 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_11 AUGUSTUS CDS 5412 6116 0.85 + 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_11 AUGUSTUS stop_codon 6114 6116 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLILHRRLCLLLSTRCCKGRCS # ATGTFAVGFTDNSGDPSWGLTSLSALGLTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPIFFVLSTQRSRPAPPTA # PTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGLRRLSAVFTFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 Scaffold_11 AUGUSTUS gene 13292 13732 0.83 + . g3 Scaffold_11 AUGUSTUS transcript 13292 13732 0.83 + . g3.t1 Scaffold_11 AUGUSTUS start_codon 13292 13294 . + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_11 AUGUSTUS CDS 13292 13732 0.83 + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_11 AUGUSTUS stop_codon 13730 13732 . + 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MLLSSATAKVVHQKVPTNSAKGLLTKLEAQIVINYCLEMARRGFPLAHEQLKKEVDSILRSRLGDAFPQSGVGKQWTY # RFVQRYRKELKMFWASTLDEKRGRGVNPYTNKQYFDLLEETLAGKRDHEFDEPNNHGSNDWVDVGGKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 Scaffold_11 AUGUSTUS gene 15983 16546 0.7 + . g4 Scaffold_11 AUGUSTUS transcript 15983 16546 0.7 + . g4.t1 Scaffold_11 AUGUSTUS start_codon 15983 15985 . + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_11 AUGUSTUS CDS 15983 16546 0.7 + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_11 AUGUSTUS stop_codon 16544 16546 . + 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWGTPHLLHFNAENPP # FGGNWEAFLKEFSQRFEPMDPGMEARARSRISGKVKDRQLRNSLRSSRISEIGLKCLILTCGNVSSLHYSRDPTTPHHRKHCPRNCSDSEGGNQTGHI # XKGNVKIMYTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 Scaffold_11 AUGUSTUS gene 16904 18492 0.37 - . g5 Scaffold_11 AUGUSTUS transcript 16904 18492 0.37 - . g5.t1 Scaffold_11 AUGUSTUS stop_codon 16904 16906 . - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_11 AUGUSTUS CDS 16904 16917 0.63 - 2 transcript_id "g5.t1"; gene_id "g5"; Scaffold_11 AUGUSTUS CDS 17430 17772 0.66 - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_11 AUGUSTUS CDS 17856 18244 0.7 - 2 transcript_id "g5.t1"; gene_id "g5"; Scaffold_11 AUGUSTUS CDS 18318 18492 0.66 - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_11 AUGUSTUS start_codon 18490 18492 . - 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPQKLKTFFVNLAPAKEWFVPDILDPDLDSLPAW # TSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIQFNTLAASTNWDSAALKWAYGRGLAERIKDEMAHLPKPVTLADFVKKFFVLTIV # IGNARKLESMRLPSGSSVPFMPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESK # GHAAEVEETPEATIEVVERGIGKLVRSSSPSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 Scaffold_11 AUGUSTUS gene 21264 21977 0.89 + . g6 Scaffold_11 AUGUSTUS transcript 21264 21977 0.89 + . g6.t1 Scaffold_11 AUGUSTUS start_codon 21264 21266 . + 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_11 AUGUSTUS CDS 21264 21977 0.89 + 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_11 AUGUSTUS stop_codon 21975 21977 . + 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MNILLPHEDAIVVTTSDTQRQYWNINFACRFARATRKTLFISPASDVLVFQDGDRLSSDDFDKMKERFKREFTLLRGV # YLFVGMIVTITQSELRHVWGEVTEIVIDDRDVVEEEAHDVRLKYGVAQVTVHVSQKIIAANPGMNELVIIKPVMVPFKVPHPCETRREIVIERTQLPL # VPRYAITEEDTMGQRFNKVVVDTSSGLSRYKSLYQVLTRVTGLGSLVLTSLVQGWAIIAIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 Scaffold_11 AUGUSTUS gene 27135 28821 0.7 + . g7 Scaffold_11 AUGUSTUS transcript 27135 28821 0.7 + . g7.t1 Scaffold_11 AUGUSTUS start_codon 27135 27137 . + 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_11 AUGUSTUS CDS 27135 27404 0.7 + 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_11 AUGUSTUS CDS 27469 28821 0.99 + 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_11 AUGUSTUS stop_codon 28819 28821 . + 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPPAVRGNNPNVAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGG # PRLPSPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSA # KEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARL # PEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQR # PAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 Scaffold_11 AUGUSTUS gene 39509 40781 0.41 + . g8 Scaffold_11 AUGUSTUS transcript 39509 40781 0.41 + . g8.t1 Scaffold_11 AUGUSTUS start_codon 39509 39511 . + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_11 AUGUSTUS CDS 39509 39699 0.5 + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_11 AUGUSTUS CDS 39819 39825 0.63 + 1 transcript_id "g8.t1"; gene_id "g8"; Scaffold_11 AUGUSTUS CDS 39990 40781 1 + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_11 AUGUSTUS stop_codon 40779 40781 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MADRLSQYTMGHNFVPGAAGMHNHHQLSAMQQQQQLQPGQQQQQESSQQPHPGLSGFNDQNRAWPYMADLLRSQKLAQ # MQSQQQRFGLSIGGSGQSQQTTFLDQPNPSQHNMQMGFTGLGQHNPSYQQSMQHRQSMLQTLQGNQQHSRQLELMNLAQNQQNQNSPTNLGTRGVSIN # GAPQGLNPLQSQNDMFPAPNDMRRPSPHPSMPPSLLSGQPANTNGMVQNSRGTVNVQGRTINLGDLTERATTLRSLIQSQEMQMLQLQAQRTNMPDNM # FMARMRSLQSELVGRKESLNKIVTLMNICMQQGNGTNGPMCVEYSIAVFFSDILI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 Scaffold_11 AUGUSTUS gene 41370 43508 0.2 + . g9 Scaffold_11 AUGUSTUS transcript 41370 43508 0.2 + . g9.t1 Scaffold_11 AUGUSTUS start_codon 41370 41372 . + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_11 AUGUSTUS CDS 41370 41961 0.22 + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_11 AUGUSTUS CDS 42012 42175 0.41 + 2 transcript_id "g9.t1"; gene_id "g9"; Scaffold_11 AUGUSTUS CDS 42231 43508 0.42 + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_11 AUGUSTUS stop_codon 43506 43508 . + 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MVNFPGEPPRSGPVAAMHIQNVYKEYLLAFDTVYITSVVDSRRKSIQTPGQFPPQGPSMPFTPEALRSLSPHQLRMII # ACADKSPSELRARGMSDTMISFVETHRSSLQSMSADQENFGNEIRRPQLPQGPMAGNVGHAGNVGQPFPNLGNTNQPFRPPGEPQPTFPPGSSIPRPS # REQLSLAQMTINRNKAEYTARALPLMPGVDIPLESRGEYNSVLELAFRLANELDGKLALYSIVTKNEENTKKLSNGILSVQHQRSLLTSPNPKFIISF # ENLRTYSTQFQYASRYIAHILQNIFRGDSGPTVDQHPSYPGPVGRVVPSGQLPPNLQHSPAPNLPTQSNNSIPPRPPMPLNPPPPPSKNKKQSGAPTP # PASAATPIATAPTPSAAAAASPQTPKSPKPKSAPKKPKSRKPSTPKVNATPTLDHATIPTSSAGVKRPREEELDALQPSTDPSAGSSSNPLPTTVANE # PSPPKRAKTDWEGPISESLQKKNQVVENIKTEEDASQFLEQMTELIKMAGTEDQAALSSDISETLEQILKGYDGGIPDSDTFSTLGLNEVGSLDASAS # TSQILSSNDLTEFFDFSLFPNEDEDESKVGTPDLVSSSSTNPSPESQADADPAHHATALLDVKQEEYDPLRLGTLKEIDGGESAYYQSTDWKWDGHMA # TLEQPWAIFNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 Scaffold_11 AUGUSTUS gene 43907 46451 0.03 - . g10 Scaffold_11 AUGUSTUS transcript 43907 46451 0.03 - . g10.t1 Scaffold_11 AUGUSTUS stop_codon 43907 43909 . - 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_11 AUGUSTUS CDS 43907 44439 0.89 - 2 transcript_id "g10.t1"; gene_id "g10"; Scaffold_11 AUGUSTUS CDS 44601 44634 0.21 - 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_11 AUGUSTUS CDS 46251 46451 0.05 - 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_11 AUGUSTUS start_codon 46449 46451 . - 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MDIERNIQQATKDIDTILATGANQSKSVSHQHLDAPVASWADFRAYFGQWKHLKVLIGTAYSWFALDQYSNFMFSVPL # NTDGNAAPVDPLAALEKTTDAQIHQTKVQIPRLESLMDVSDRYNSDPYSLSLKARKHFREDKKIWKEKEKSDVQVKDRYALPTNFSLAEEDGETIKEA # REQWRKGREEILLRNSKRRKLAVETSIVPSSSGLSSTSSSAVVESLRARVLINTARQSRTSTNSASTFVNGRKSLVRNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 Scaffold_11 AUGUSTUS gene 61370 61714 0.61 - . g11 Scaffold_11 AUGUSTUS transcript 61370 61714 0.61 - . g11.t1 Scaffold_11 AUGUSTUS stop_codon 61370 61372 . - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_11 AUGUSTUS CDS 61370 61714 0.61 - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_11 AUGUSTUS start_codon 61712 61714 . - 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MKATNLFHLPIDEEEDREIEGYQRKYLTWTSDQAVGTSQASSSKAPNLDTRSALSRAEDERNQTVNDILQNEDLYDVL # GVDKSKALDKLALRRAYLVRSKACHPEYVLASNSSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 Scaffold_11 AUGUSTUS gene 63573 65585 0.6 + . g12 Scaffold_11 AUGUSTUS transcript 63573 65585 0.6 + . g12.t1 Scaffold_11 AUGUSTUS start_codon 63573 63575 . + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_11 AUGUSTUS CDS 63573 63618 0.6 + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_11 AUGUSTUS CDS 63712 65585 0.99 + 2 transcript_id "g12.t1"; gene_id "g12"; Scaffold_11 AUGUSTUS stop_codon 65583 65585 . + 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MLHNNYLLLRAAHLRCSVLATGTVSAAPGSSTQLAGLIESLSTALDPSVQSSFTWDQVNLPQGWYEFLVTATDAGDVL # GGVGGIWTTWNASSEPIFIRNSSDVSCLATITTSTSSSSSGSTNTAGQSSPSAGGSLSTTSHVNSGAIAGGVIGGLAALVVIIGACLAYLRGRRYRNG # LNDAGDGTSPRPNFGKWGALGSFDSANGSRSAPKSIVKAEGTDDFDPVTVLNTAANTRPQKSGGFRLGDIGLAAIGLAKPQDSPPSAFTTKSKRVRRT # RQAKDSSGTTESTGAIMSSSFSSSFSPPSSSAHGSYDPYADFPRGYSNTSTRQAEEDFAYSPSEQTGMPMRNLSPSSSPTEEDYSKYQSYVPNTDSLD # SGAPGVGTIPIGYEPSPFVTPPPSEPASRHNSRSYSRSSLAPSGNTQAFYALGISDSSTFDGFRPNRARSQSQNVSPTSTRPMRGPDVPESPKHEFVS # SAQNKRASSPDAFVYTLNPEQTQSSSSAGKAQSRRTPRKPVPSYTPDEALGAFTETVTSPTSPVYTYPGPVPTKPAKAATTRRPAPTIPASESASSST # SSFPATTPTTYQRAMNPYGSHVPALEHKDSAQSLASLRNMEGDLSAYNAVLGNEGAKHMHILIPDMPLTQN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 Scaffold_11 AUGUSTUS gene 66117 66485 0.85 - . g13 Scaffold_11 AUGUSTUS transcript 66117 66485 0.85 - . g13.t1 Scaffold_11 AUGUSTUS stop_codon 66117 66119 . - 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_11 AUGUSTUS CDS 66117 66485 0.85 - 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_11 AUGUSTUS start_codon 66483 66485 . - 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MDHLHTLNDLTPKIRCDARGGVDPSLIFGIDSKLFQNTDAHTQDPSHVDEVQTLTLYRGSTASLPHKHGDDHEHAHEH # SGAANPLTNLPKLIMIDTLEECLTKLGKESGVESEKASFGARSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 Scaffold_11 AUGUSTUS gene 71911 72303 0.75 - . g14 Scaffold_11 AUGUSTUS transcript 71911 72303 0.75 - . g14.t1 Scaffold_11 AUGUSTUS stop_codon 71911 71913 . - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_11 AUGUSTUS CDS 71911 72303 0.75 - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_11 AUGUSTUS start_codon 72301 72303 . - 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MSRSISSNPGCPPKVTYFGFTGSLSESHSSSSRSSLFLLSVAPSISPAALTFEADSTVLALTSDSLTLPADSTSEADL # TVSAEGTLEADFTVEAGSTVEADMTLVEADSGSPMSFGLQGMLGRGHIKPRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 Scaffold_11 AUGUSTUS gene 72858 74614 0.15 - . g15 Scaffold_11 AUGUSTUS transcript 72858 74614 0.15 - . g15.t1 Scaffold_11 AUGUSTUS stop_codon 72858 72860 . - 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_11 AUGUSTUS CDS 72858 73300 0.21 - 2 transcript_id "g15.t1"; gene_id "g15"; Scaffold_11 AUGUSTUS CDS 73405 74614 0.37 - 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_11 AUGUSTUS start_codon 74612 74614 . - 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MDYFTGTAAWSISKRHSLLASLDESTGLTLLKLAISRILLLRALFSSKELEYTERKRALVDAIVQAHNVIAIHTVLVR # YPEVGFFTVQSRCTLLPMVILYGRMSKCDVGIPSLIDGEGSEDGGSNAVRILMEDVWLALDMLPRFRWRWETGSGSSGGTTPLIAKLAEEVMETSLSE # AGLRGLGAPDESDKRGSNDATERGQNGRSRMIAGIGRQGPVGQPVLIPEPEWVEDVTSPNRGKNTGSTPVTASGMWVPTWTETVPSPKSQQTTPTLQA # AYPPSSYPRSSASAPTGVPSHPYPPPIPTSSPTHTDNSYPHPQYTFNPPVFGPQPVNGANEKPPKATSSNAPPSATPTRSNGMQPSLSTHMMEVPHSL # FYPIYPDGVPVPPEGVHRSSTGTPRASNGPLTVQARAHGGQQGAPDIYMNEERGIQPGHAHPSGGGYVALNSHGSYHVHTGTPYLPSHHLGQALNAQS # STAGPPPAAHQHTSSQLHHAAVNSPYPLHHSAHGSMPPPSSSHRLGESWGKCSFGSGLPCPLTCSFFKHTRPAGYASQPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 Scaffold_11 AUGUSTUS gene 75196 76200 0.44 - . g16 Scaffold_11 AUGUSTUS transcript 75196 76200 0.44 - . g16.t1 Scaffold_11 AUGUSTUS stop_codon 75196 75198 . - 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_11 AUGUSTUS CDS 75196 76200 0.44 - 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_11 AUGUSTUS start_codon 76198 76200 . - 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MNPAPPPPPPGYFAHPPPPGVGYYQYPPYMYPAPPPFQLSPLSAPPAHPAATIPGQDPKSNDMSSTHALAKSFGVAPH # IVNNASASPAPLYHYHPPAVVYNSSITPLPSSSTATARLAEEDLAVGSSGLDSGRDRVVQLEMPAPRDTAKWRVVSVFRSQHFSSTPSMDIWIPNDRN # TLLEIVDVYFTQLNPHRPVFFRHQFLESLNQLYDEGASSRPVFDPGFICSLYLVLALGTLSELNRSGYQGEAPIGDSAADHENDDSLLSPPSRPGKGK # RTAKSATTTSETGGSRLPADWPAHDEFFDRALAVKPELRVTLSSLQALILLHWYLYAEAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 Scaffold_11 AUGUSTUS gene 79740 80164 0.85 - . g17 Scaffold_11 AUGUSTUS transcript 79740 80164 0.85 - . g17.t1 Scaffold_11 AUGUSTUS stop_codon 79740 79742 . - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_11 AUGUSTUS CDS 79740 80095 0.85 - 2 transcript_id "g17.t1"; gene_id "g17"; Scaffold_11 AUGUSTUS CDS 80146 80164 0.86 - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_11 AUGUSTUS start_codon 80162 80164 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MADVPGGASGDWADDGVCTTDATLIPAVASATLSAASITAHVSSTASVSSVSVQAASSAAAPTVSVSSAATSSFKTAI # APTVSVSSAVDASVASAKSVIIAASADSETLSATTSAVKRSRFFKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 Scaffold_11 AUGUSTUS gene 89185 89568 0.85 - . g18 Scaffold_11 AUGUSTUS transcript 89185 89568 0.85 - . g18.t1 Scaffold_11 AUGUSTUS stop_codon 89185 89187 . - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_11 AUGUSTUS CDS 89185 89568 0.85 - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_11 AUGUSTUS start_codon 89566 89568 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MAEWNETSTNHAYEYSSTSSSTPSISMPHNSIERTSVVPESSSRHISHNKPAYYQQQEEWNSHSSSAERLNAISNSSS # HPIPHDLPTHHQQQQQWHSRHPTAASSQMLSQSNMPFATSPSPLQSHPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 Scaffold_11 AUGUSTUS gene 89606 89992 0.48 - . g19 Scaffold_11 AUGUSTUS transcript 89606 89992 0.48 - . g19.t1 Scaffold_11 AUGUSTUS stop_codon 89606 89608 . - 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_11 AUGUSTUS CDS 89606 89992 0.48 - 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_11 AUGUSTUS start_codon 89990 89992 . - 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MQYPQAMNMYPSLRSSVPSPYNQVPYGQGLGLDSGAPHISNGYVDAPMTNGSRAYGTTDVRSSQTYMDRSNAGPNSKQ # ILFSHYQPQQHGFVRNEHEQRGPQDLSTAYGHSAHSYNHYGNNNSSNEVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 Scaffold_11 AUGUSTUS gene 90894 92411 0.36 - . g20 Scaffold_11 AUGUSTUS transcript 90894 92411 0.36 - . g20.t1 Scaffold_11 AUGUSTUS stop_codon 90894 90896 . - 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_11 AUGUSTUS CDS 90894 91720 0.98 - 2 transcript_id "g20.t1"; gene_id "g20"; Scaffold_11 AUGUSTUS CDS 91927 92339 0.55 - 1 transcript_id "g20.t1"; gene_id "g20"; Scaffold_11 AUGUSTUS CDS 92392 92411 0.36 - 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_11 AUGUSTUS start_codon 92409 92411 . - 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MTGKSSALNNWQTTLRRQYTKRDPIANPIGPEPIKEDDYARELTSPEPPSTKEGTNEPTDDTVVRSKPSSREHSMFPE # NGKAPMVKPEDDFTTSTTSREKYHPSKAKDNAPEEESKDWLSLNMLKKLDSLHLLTEWQFQSPKRVPDRLWIQRVPPKPPRPPPKHSLKRKRIVDTNQ # TKTKLSSTKRLRLQSTIESDRNVAKSAVEPVPSTSGRHGRAAKDQANLKLDAQAKELAELNRQAALLASHSPGSNRKSSTRGASSAKLSSSPARPTRG # TSSARPLGTRQSARLRGSDDDEWQAIPDEWLQNDEDGDMEEKGKDKRGSPSLRSVSSISELTELSEEEEIPTPAEETRIMEEPVSPDKSQENVSMTQE # FVEWETVSCLNISCRYITMYSYHTLDCCYTLRVGTHSRTLAKRYSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 Scaffold_11 AUGUSTUS gene 94581 95111 0.63 - . g21 Scaffold_11 AUGUSTUS transcript 94581 95111 0.63 - . g21.t1 Scaffold_11 AUGUSTUS stop_codon 94581 94583 . - 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_11 AUGUSTUS CDS 94581 95111 0.63 - 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_11 AUGUSTUS start_codon 95109 95111 . - 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MLPTERSLWTVIRAPFAYKKSQENFERKTHKRMIKAWDADPEVIDRWVKYLEKHAMGGVGIRVTKWKRLPIGIGKTRL # ARVKEAFKAPIPNGVSSVDAKLLEVQQEGDSDANRKQAIQALGEKILKEELQTFKGSQKPPAASLGASGNTLATERVHVSADKPQVKGSPKIHAKGKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 Scaffold_11 AUGUSTUS gene 97660 100428 0.74 - . g22 Scaffold_11 AUGUSTUS transcript 97660 100428 0.74 - . g22.t1 Scaffold_11 AUGUSTUS stop_codon 97660 97662 . - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_11 AUGUSTUS CDS 97660 100428 0.74 - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_11 AUGUSTUS start_codon 100426 100428 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MGDDTWMAVFPDTFNINMTWPYDSFNVEDLHTVDNGVITHLFPLLESNKAPDLIIGHFLGVDHVGHRVGPFHPSMSSK # LQQMNATLSHVVDLLSDDTLLIVLGDHGMDHSGDHGGDGELETSAAVWIYSKGIELFDDHIGSIPSELVPFTTFPNAESPYRHIQQIDLVPTISLLLG # LPIPFNNLGSVIPELFWRETGSNPDSQVGESWSWGGIHKSAKLEGGTKPDGHLLTRALQLNALQVHTYLDTYRSSSSGAELDDAWPGLESTWHKTDAR # IPKLGGQNLVDMWNYTRLALSSCRSMWAQFNPYLMILGLISLSISLLSTCVVYIGIRRVASSSPTETNWEDWLSARLWQAVRGFAGGATIGFLASLAL # EIQGKGVDSLNCILFMAPFTSCIMIAVHSLPKNHTVPKALSVVSMSDLIVFIPFVLHVAAFFSNSFTFWEDRIVAFLLPSSLIPHILTGVRAPTARLR # RRILGFAGLTAVCVRLMAVSTICREEQHPYCHVTFYSSTLSTLDNDYTSAVVPPSASSSFAPLFALFGAPLVALALPIALRLFLRQSKSDQGLATVWF # SWVMVPSLSCGTGYWLIEYVETAGVVDESEWGTALRFCRTFLARAAFGWPTIVGGALWWNYPLCISVLAEEASERQSGRQVTILGFANAYGAPYMLFW # TITFSVVWAATQLTGQIILGLSAVALMSILEVLDGVRDVEAVEDAFKSNKLSEILQTGGDEFGVTGPQHDSSTKLKFTEIASLVLLALHAFFRTGHQS # TISSIQWKSAFLLSSTVTYPWSPGTAILNSFGPLWTVGVGAGLAGVWLKSPRSFVLPSVQDKKSEKNDQPTVHTLQTNDQIQASILLCCLCLTMYFLA # ILLTTSLSAAILRRHLMVWKVFAPRWMLGVVGVLVGDVSTISVYIGMWRIQKMVDKTLRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 Scaffold_11 AUGUSTUS gene 101237 102421 0.27 + . g23 Scaffold_11 AUGUSTUS transcript 101237 102421 0.27 + . g23.t1 Scaffold_11 AUGUSTUS start_codon 101237 101239 . + 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_11 AUGUSTUS CDS 101237 101371 0.66 + 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_11 AUGUSTUS CDS 101949 102079 0.74 + 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_11 AUGUSTUS CDS 102133 102421 0.56 + 1 transcript_id "g23.t1"; gene_id "g23"; Scaffold_11 AUGUSTUS stop_codon 102419 102421 . + 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MLMNDAGETTSHLMGFFYRTIRIVENGIKPAYVFDGKPPELKKGVFVDLCILLGCDYLEPIKGVGPKSALKLIREHNG # LRGVVKHLRANGKEKAVAEAAEEEEAEEEDPAPTSDVEQPDGSDIEEAFSSKPKPKAKKKGAKGKGKGGVSMPEEWPWEEAKELFLKPDVTPADELDV # CLLQACVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 Scaffold_11 AUGUSTUS gene 107391 108608 0.83 + . g24 Scaffold_11 AUGUSTUS transcript 107391 108608 0.83 + . g24.t1 Scaffold_11 AUGUSTUS start_codon 107391 107393 . + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_11 AUGUSTUS CDS 107391 108608 0.83 + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_11 AUGUSTUS stop_codon 108606 108608 . + 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MWQSAARTRTSSAFTSFFFNNTQWVSPAIHITRNPHSYGLIAHPTTDLPRSAFKQAEALTPARLTKIYWQLSKSSLTV # LNVLAAMSGVALSPLPTTVPVLLATAVGTALCSASANTLNQVQEVPFDAQMARTRMRPIVRRAISPLHATAFAAVSGITGPVILWTMTNPTTALIGAG # TLVVYAGPYTWMKRKSIANTWLGAVVGAAPPVMGWTACGGQLFPSSSFPVHIFPPSFMSALPETALDPSLINSSLAPLALFALLFSWQFPHFNSLSYV # VRGSYAQAGCHMLSVLDPQKNSLVSLRHALILIPTCSVLIPLSGLTTWWFALSSLLPNIIFLRASWVFWKNGGEKQARTLFRHSLWYLPLILGMMMAH # KQGINWSQWIGLGSDDPEKPKDETHVVATTQSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 Scaffold_11 AUGUSTUS gene 109116 109907 0.54 - . g25 Scaffold_11 AUGUSTUS transcript 109116 109907 0.54 - . g25.t1 Scaffold_11 AUGUSTUS stop_codon 109116 109118 . - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_11 AUGUSTUS CDS 109116 109907 0.54 - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_11 AUGUSTUS start_codon 109905 109907 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MEIPFDRIIATEFNHTSPGIAHAVFTVSEPPHFYLEHRMAPRPDGRMKLSWRQCNDWTEGAQATHVLRHSLLGSAPQL # SHLVQRLKLYRSHRNISLLSTPYKGDDSLPSPLEIPAPPMAGLLRPHLSPYSDASPDTGINSDSDQVTCNSDGYNPQLRNAPVSTSAYSEEQYPRLFG # RYSTPDISSYHQSSAGATLVAPVSRLSTARPYTVTQETFPSMYSDDVSIAQSLQSARRHTWTNVQDHVSPSLPLLGTSFHPAADFIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 Scaffold_11 AUGUSTUS gene 115268 115864 0.88 + . g26 Scaffold_11 AUGUSTUS transcript 115268 115864 0.88 + . g26.t1 Scaffold_11 AUGUSTUS start_codon 115268 115270 . + 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_11 AUGUSTUS CDS 115268 115864 0.88 + 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_11 AUGUSTUS stop_codon 115862 115864 . + 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MQDEETTSDTAMKKPRLNEGPNGFPVDFFSDPSRAIPLGGGSSDNEEEEDQPASAAEDAPVATAKAPLDLEWERFQRE # VVNAPDFKETYENATVFAEPVLAPEVPEGFPVPETSSEPTEPSKTEEEEARRQKELDERELIMDRLLEEERAQEEADMKVVAMKNKLELLRKKKRLQK # LQRCLHLQHDTGPYCFPKPQSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 Scaffold_11 AUGUSTUS gene 120771 123606 0.35 - . g27 Scaffold_11 AUGUSTUS transcript 120771 123606 0.35 - . g27.t1 Scaffold_11 AUGUSTUS stop_codon 120771 120773 . - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_11 AUGUSTUS CDS 120771 121359 0.94 - 1 transcript_id "g27.t1"; gene_id "g27"; Scaffold_11 AUGUSTUS CDS 122729 123606 0.37 - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_11 AUGUSTUS start_codon 123604 123606 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MKTTVVIYIQYRDQIQSLAKFLKKRDPRYKKHIARQAEATQMHASGSSTPNSRKIFTPDAAYIEQDWQKIDSRVGEHD # LEWAVAEGDDPEEWECVACNKSFRSEAAWDSHERSKKHLREVERLRREMLDEGEMLGLDQAPQLEVEETAPSIEDHLDSFLDEPPRSPSPPPSEQEIH # TYAATPEASREENGEEKNLRHLPKGKKGREKAQPLATSKEPRTKSEKKMQGLDHAFFEEAGSSNIGSIEQGKDSARPDSGEKLELSKREQRRARQAKK # AELSGATHSVSKFFFRMRLDERCTFASIEAYSSISSWDTRNYWIFPGRLEFEHEIDHEAEDLVKDLEFGVVMQYGGDQIPEDENDLDVKARLRWEDER # RNGGTSGKKGVFAGKSAGKGLSNGIVNGYHSSPSLVPKEVTAPSNSGNEEGNEEDVEELTQPPPIETEDSLAFKFTLMEMYFQRIEKRLESKSIIYDR # GLLEYKRYGPLQKFLTHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 Scaffold_11 AUGUSTUS gene 128505 129681 0.97 - . g28 Scaffold_11 AUGUSTUS transcript 128505 129681 0.97 - . g28.t1 Scaffold_11 AUGUSTUS stop_codon 128505 128507 . - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_11 AUGUSTUS CDS 128505 129508 0.97 - 2 transcript_id "g28.t1"; gene_id "g28"; Scaffold_11 AUGUSTUS CDS 129660 129681 1 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_11 AUGUSTUS start_codon 129679 129681 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MINQKDSEAREYLISELHLKFPELFYPAKERSGFGGNDDSKFDNPWRKRRTSTRRLIIARFLTSQIRWTSSRPSSECF # RGRQRLAFKSTSGSFAGARNSHWIHEKKPIGFGSDNSGAADRDEVWSKGSKFKPAEERETRSDHRFGSGRGRGDMGPPRDPVPEESDWRSSSRARPAR # DNTSRELIFQLRREKESSVYLYTATGSTPPTPQMGRRKLELLPRSGNGSNVPSPLSSPKIGPTPPTSGSRSNPFGTAKYVQLYLQCVSLLNVRLRPVD # VTAKDIEITQKLEKDRELNRISMSRTSSRTSIERPISRNHTPPASAGSHSQPPSSPPAPTSKVIPRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 Scaffold_11 AUGUSTUS gene 132370 133081 0.6 + . g29 Scaffold_11 AUGUSTUS transcript 132370 133081 0.6 + . g29.t1 Scaffold_11 AUGUSTUS start_codon 132370 132372 . + 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_11 AUGUSTUS CDS 132370 132392 0.65 + 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_11 AUGUSTUS CDS 132481 133081 0.65 + 1 transcript_id "g29.t1"; gene_id "g29"; Scaffold_11 AUGUSTUS stop_codon 133079 133081 . + 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MWDEVLKALKVFIGFNCTEEENTYSLAALRRRAWQALRSKIDEQTADSVFVGRLRAHFEERFRYDEQGVPRVWKPEDD # IDGVYRKAKEQTLELIPLYSKIVPLDSSVAYVLPPDAISLSDSGSSLEEAFDFESSLVVFSETKALDLAAKFRKDADLAYVEAKRSTVSSVAQIPFWM # YGVLVLGWNEFMMVLFNPIYFMFLLMAAAAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 Scaffold_11 AUGUSTUS gene 133614 134021 0.74 - . g30 Scaffold_11 AUGUSTUS transcript 133614 134021 0.74 - . g30.t1 Scaffold_11 AUGUSTUS stop_codon 133614 133616 . - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_11 AUGUSTUS CDS 133614 134021 0.74 - 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_11 AUGUSTUS start_codon 134019 134021 . - 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MAGVVVDMFEEKQSKTNSASSSNVDSRVEPEDIEDTLLQIMADEFEVHVEDGSAETLGKDIVQLWDAIINSASPSSTT # ITHSEGEKKVQEWESRVESAKGRKIQAHYQEAAEEDGDWEDDDSEGDDEDGDHPMDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 Scaffold_11 AUGUSTUS gene 138163 138900 0.96 + . g31 Scaffold_11 AUGUSTUS transcript 138163 138900 0.96 + . g31.t1 Scaffold_11 AUGUSTUS start_codon 138163 138165 . + 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_11 AUGUSTUS CDS 138163 138900 0.96 + 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_11 AUGUSTUS stop_codon 138898 138900 . + 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRSFSPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQCCAASESPRDPPPHFDLDTGDHDDQDPPVDPGDPGANNDNDNLDDNSGGLPRGEPG # GPGGPGGPHSPISPDIPNKQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVSNSSDPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 Scaffold_11 AUGUSTUS gene 140277 141359 0.07 + . g32 Scaffold_11 AUGUSTUS transcript 140277 141359 0.07 + . g32.t1 Scaffold_11 AUGUSTUS start_codon 140277 140279 . + 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_11 AUGUSTUS CDS 140277 140299 0.11 + 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_11 AUGUSTUS CDS 140562 140947 0.5 + 1 transcript_id "g32.t1"; gene_id "g32"; Scaffold_11 AUGUSTUS CDS 141016 141359 0.8 + 2 transcript_id "g32.t1"; gene_id "g32"; Scaffold_11 AUGUSTUS stop_codon 141357 141359 . + 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MGKLTNLCGSAKEWFVPDILDLDLDSLPAWTSSFKALVKELQDNFGVYEAEDSLSNLKMKETENIRKYNIWFNTLAAS # TNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYCQEVLRIDNCYWKCEETRKCEAANNFQPSGSSAPFMPKPKPFSGGKPNSNGKPQNSSNSGQS # SGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKQKAQESKGRAAEVEETPKATIEVVEEELEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 Scaffold_11 AUGUSTUS gene 145388 146725 0.61 + . g33 Scaffold_11 AUGUSTUS transcript 145388 146725 0.61 + . g33.t1 Scaffold_11 AUGUSTUS start_codon 145388 145390 . + 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_11 AUGUSTUS CDS 145388 146725 0.61 + 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_11 AUGUSTUS stop_codon 146723 146725 . + 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MDIKALHQAIILALPKDPSSIVGLELAKDPSNERWSLGSNGLLRLDVPNHGNLCLQVLRYFHDHLLSGHFGQNQTLEA # VCRQYTWPKVRDFVCDYITSCTTCGRNKPQRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDQSSKQAIFISTFDTITSQQLAELFV # IHVFSKHGVPNHVTSDRGSEFVSVFFQALSKVLSMELHYTSGYHPEADGQTEQYIRIYCSYQQDDWSHLLPIAEFAYNNAPNASTGITPFYANKGYHP # NITIWPKVDMKSDLARDFVVNLDELHVFLREEILLAQSHYKEQADRKRILHPEFPIGSEVFVLAKHIRSTHPTEKFSEKYLGPFKVISRPGTLSYELK # LPDYLRWIHPVFHVSQLEPVTLNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKCCPLRYCHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 Scaffold_11 AUGUSTUS gene 149227 150891 0.6 - . g34 Scaffold_11 AUGUSTUS transcript 149227 150891 0.6 - . g34.t1 Scaffold_11 AUGUSTUS stop_codon 149227 149229 . - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_11 AUGUSTUS CDS 149227 150891 0.6 - 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_11 AUGUSTUS start_codon 150889 150891 . - 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 Scaffold_11 AUGUSTUS gene 151061 152114 0.17 - . g35 Scaffold_11 AUGUSTUS transcript 151061 152114 0.17 - . g35.t1 Scaffold_11 AUGUSTUS stop_codon 151061 151063 . - 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_11 AUGUSTUS CDS 151061 151342 0.29 - 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_11 AUGUSTUS CDS 151494 152114 0.49 - 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_11 AUGUSTUS start_codon 152112 152114 . - 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISLACEDDASAAVPKVMSSKTAHTEKPPAATVDVEDIWKQSAKTNSWDSDETEADASNLDANDATISAR # DPRHSPYSQTNPSKSRPRPQHLLLHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 Scaffold_11 AUGUSTUS gene 169867 170331 0.89 - . g36 Scaffold_11 AUGUSTUS transcript 169867 170331 0.89 - . g36.t1 Scaffold_11 AUGUSTUS stop_codon 169867 169869 . - 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_11 AUGUSTUS CDS 169867 170331 0.89 - 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_11 AUGUSTUS start_codon 170329 170331 . - 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MLARSSNQILPPSVLGSIGYSLDNKLASGKVTWSPRSPFQHPADEEYHMGQTQDEDEDDGFTHIPPADSIPSNATTTA # PAGSNPFSDSNRYSGAPSGTPAYSSYAAPSYIPPVSRPSMDAYGAFSDPPPSGFGPAAAAPARPSPAVAAAPPSLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 Scaffold_11 AUGUSTUS gene 171771 172530 0.88 - . g37 Scaffold_11 AUGUSTUS transcript 171771 172530 0.88 - . g37.t1 Scaffold_11 AUGUSTUS stop_codon 171771 171773 . - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_11 AUGUSTUS CDS 171771 171877 0.97 - 2 transcript_id "g37.t1"; gene_id "g37"; Scaffold_11 AUGUSTUS CDS 171933 172530 0.9 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_11 AUGUSTUS start_codon 172528 172530 . - 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MLYIVFGTLYNRYVLQLRGFDQIPQFSIEAMKYHGREALGWFRDIMGQLYEGGQGSGWGSNVPRTWGGRTNPNTGFGV # GSQLPPGRVNPRANTRSGATTNSFSHQAQVDIGGGGESTNVVDVPGGGVGGFMRPNSGTNTTNKQNQTKSTQPPAPLPISPAPVMVKKYEPGSSTAEE # RTFMLGDDEEEEDVIATPMTAAAPPAHPSEDHTNPPAASESAAQPRGRDLGEEGTIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 Scaffold_11 AUGUSTUS gene 173632 174494 0.83 - . g38 Scaffold_11 AUGUSTUS transcript 173632 174494 0.83 - . g38.t1 Scaffold_11 AUGUSTUS stop_codon 173632 173634 . - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_11 AUGUSTUS CDS 173632 174104 0.83 - 2 transcript_id "g38.t1"; gene_id "g38"; Scaffold_11 AUGUSTUS CDS 174218 174494 0.83 - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_11 AUGUSTUS start_codon 174492 174494 . - 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MTATNFEADALLAHVVSQVQQNVEFLVSHDYLAQSDASAFLSKLGNVRAGAALGPAMPTPTPSPFARRSPAVISPQPV # MAKAIWGYNEDGAVNWWTGKINGRQALFPSSYVEKVVAHAPTAAAMPTPIPSTGGRSLPPAFNGAKEKPVYKPFGAAHQSANAPPPPDAGVNNVGLQE # DAGQEKKKSKFGKYGNTMAHSAAGGVGFGAGKLVISVTHFQSLIDSSQVPLLVVVSSEQYFDLPVLFSSAPRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 Scaffold_11 AUGUSTUS gene 177177 178562 1 - . g39 Scaffold_11 AUGUSTUS transcript 177177 178562 1 - . g39.t1 Scaffold_11 AUGUSTUS stop_codon 177177 177179 . - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_11 AUGUSTUS CDS 177177 178562 1 - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_11 AUGUSTUS start_codon 178560 178562 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MKYIELPSLTALASSLSHQGSECNVSVRLEAYSCKNIKRDKRLFRDLEKVYWDDMGVLETMKFDPGEEHSKSSPAEGS # SSHALPHSYLAQAHSSLSTPFGPLGSPQSRKTLYLLISTLNVAFPDYIFDSVKPSSFVHLESGAQILNALSTTLLASQTSVRSRTSRHNSGYASMAYG # AYPAAQGLGFGVAQGSPGSPYEFVKESPCAPSSVISGTHPEVYALLDDVIGPLDECEVFEYVPEPEEDPNAGEGEEDGDEDFEDEFEGYSPDEVHVFT # LDEDINTQSDNQPHSTLSTPVTPRDAVLSTSANPISPFDESYRPLSPTRLTLRTPSRSSSSILPSSYPPMHPTSSSGGNTLLWSSHWFFLNRKQKRIL # YVTVWARKRSMDSMPETPVDEELFVYGSEPTHQLYASVARRNRRIRKFSESDESDVSPVSMRFPTAGKERFLGWEGAAGAGARALGLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 Scaffold_11 AUGUSTUS gene 179363 180571 0.99 + . g40 Scaffold_11 AUGUSTUS transcript 179363 180571 0.99 + . g40.t1 Scaffold_11 AUGUSTUS start_codon 179363 179365 . + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_11 AUGUSTUS CDS 179363 180571 0.99 + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_11 AUGUSTUS stop_codon 180569 180571 . + 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MFAHDIPTLPVIQHVFDYLLARPPIALVYLTGAVILARRDELLALEEDEDGDLGMLHSLLGTLPQVSDEAIPEEVAAE # FRQEHQAEAGDAENCRGPSPDPSPSASGAEMEMEKSSCNSVVADDDDTDTIAESEYYEDTETVLNSDVDADEEPLKLLDFVASFSSSPGRSGILSLPP # SSPRPASASDLLPLDSQSLPQSNPPLQSVSSSPSSSSFSIHTPSSSSHATTLPTRDNLSGSPSFETQSHVDDFDSSKKAKKLPIPLSVLLRDADRLLA # AYPPYQGYLQELTNMSSSVSLSNSPNVTPNNSSSPINSSDSSLAPVLSSIMGPSSVVYTWSEDPAKLPSDTDAELMVRDTSRIVYPWDPSSNEDETGK # MMVKVKRIFPVIPRSEEQGSGTVGCYVVLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 Scaffold_11 AUGUSTUS gene 182959 183608 0.63 + . g41 Scaffold_11 AUGUSTUS transcript 182959 183608 0.63 + . g41.t1 Scaffold_11 AUGUSTUS start_codon 182959 182961 . + 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_11 AUGUSTUS CDS 182959 183059 0.63 + 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_11 AUGUSTUS CDS 183110 183608 0.66 + 1 transcript_id "g41.t1"; gene_id "g41"; Scaffold_11 AUGUSTUS stop_codon 183606 183608 . + 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MRSQTYHDRANVNIEVCIAAFSASERRKRGRGDKRILELSQTLKSTFEPVIQTSLYPRSQIDIYIQVLQQDGGLLQAC # VNATTLALANAGIPMYDFVCAVTGGVHSTSPLLDLTLLEENDLPNVTVAVMPRSGKITLVSMETRLHVDRFEEIFRLAGEAGTVIHREMRRAVKDRTE # QLVASMQSVGRPSTGADVGDNEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 Scaffold_11 AUGUSTUS gene 185548 186152 0.93 + . g42 Scaffold_11 AUGUSTUS transcript 185548 186152 0.93 + . g42.t1 Scaffold_11 AUGUSTUS start_codon 185548 185550 . + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_11 AUGUSTUS CDS 185548 185550 0.93 + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_11 AUGUSTUS CDS 185622 186152 1 + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_11 AUGUSTUS stop_codon 186150 186152 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MGKLPAVDPSKDYSQNLATLLGFGDNENFVELLRLYITIHSDHEGGNVSAHTGKLVGSALSDPFLAFGASLNGLAGPL # HGLANQEVLLWLRKMQSKIGENASDEAVKEYVWSTLKGGQVVPGYGHAVLRKTDPRYTAQREFALKHLPEDPMFKLVGQIYNIVPGILLEVGDVCVFK # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 Scaffold_11 AUGUSTUS gene 190156 190641 0.35 + . g43 Scaffold_11 AUGUSTUS transcript 190156 190641 0.35 + . g43.t1 Scaffold_11 AUGUSTUS start_codon 190156 190158 . + 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_11 AUGUSTUS CDS 190156 190641 0.35 + 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_11 AUGUSTUS stop_codon 190639 190641 . + 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MGTGKVSVLLSGLVSYFVASRVKALQTLNISLLSPPPSTLPTSSIRRHPHSTTIISTVSSDGKINVYDLGHLHEFNAG # KISIQEIQPVATYDTKGTRLTCVTLGEGEIGTDNVTGKRNRDRQEVEEDDDDESAEDEEWGGVGADEDEEEEEGEEDEEEESD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 Scaffold_11 AUGUSTUS gene 196933 197235 0.73 - . g44 Scaffold_11 AUGUSTUS transcript 196933 197235 0.73 - . g44.t1 Scaffold_11 AUGUSTUS stop_codon 196933 196935 . - 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_11 AUGUSTUS CDS 196933 197235 0.73 - 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_11 AUGUSTUS start_codon 197233 197235 . - 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MSFGSDPESFLEYALSLPAPVGPGPETSDSSDQSSPSDHNSEQESVQSGTNSDPDQSSYDSEFPGPFDYNYLHKSSDF # DSDHPGPYDLRYLHSYPSSSVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 Scaffold_11 AUGUSTUS gene 202072 203082 0.76 - . g45 Scaffold_11 AUGUSTUS transcript 202072 203082 0.76 - . g45.t1 Scaffold_11 AUGUSTUS stop_codon 202072 202074 . - 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_11 AUGUSTUS CDS 202072 202722 0.83 - 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_11 AUGUSTUS CDS 202777 203082 0.76 - 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_11 AUGUSTUS start_codon 203080 203082 . - 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MLSAKSKHKGSPGHQDEGDSQRHGSGSNQGPQPSNDRDSAAKPSDGGAAGSATNRNNGNGDGEDGDDEGDSNDNPFFR # YARKKQPARSGGVKHRPAEELKIKETMRKWLNEIMEGQDQLKETVSQDEADEFTLLFKTNPLARPCSVDDFRYWIAGGPKSAWNKGASYVFVEILEKR # KLIATPDVQTRDGIREAFLLRLKTLHASWMERQKMLEDNKNPRSLFSKRWQRRVTFYCLNTQTHTQKLFHRRREVIITFHSLESFLSFFDELGVAGMS # SDDEDPGMKKPQVQYIIKGRNGEASNSEFTQVVGLLPSGRSMYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 Scaffold_11 AUGUSTUS gene 215156 216319 0.66 + . g46 Scaffold_11 AUGUSTUS transcript 215156 216319 0.66 + . g46.t1 Scaffold_11 AUGUSTUS start_codon 215156 215158 . + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_11 AUGUSTUS CDS 215156 216319 0.66 + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_11 AUGUSTUS stop_codon 216317 216319 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MRSRLAFIPLIACTSFFLHLLYHLESDWVDLVISALEHNARLPSISPFLSKRQQEYEKLRRGPFPTKWEWKEKLQQQT # SISSEWLEYFHQILDLPMVGAFVDVHTSGCLPWIPVFLKAKIPLMLYWGSINNWSIPTTLDHLICTPNSSIINTLISEQRPYPPPPLPTEGHIPREVP # TNKPRLRLPRIDGGSLPRPNESLFDFIQRREVYRLKVIASESPTERQSRLQREENARKDRPPGRKGARVYYWDLVEGTRVRTAVGRSNYEDIWERYGS # HQRRYDSVADEWEVCTDFDPNDAPDDYGPDSDDDSDCFITVRAHIDEETHHNDGAVSSQAYLARLQSPNKLTHSSIEFHEAIEDVAYHRLGFSSNLSQ # KIVTLYSNRKSGKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 Scaffold_11 AUGUSTUS gene 219992 220225 0.84 - . g47 Scaffold_11 AUGUSTUS transcript 219992 220225 0.84 - . g47.t1 Scaffold_11 AUGUSTUS stop_codon 219992 219994 . - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_11 AUGUSTUS CDS 219992 220225 0.84 - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_11 AUGUSTUS start_codon 220223 220225 . - 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MPTKVPRDQMDQIDSHGYTPAYKTRNEVSRPGVEEDIAKKIFDAKVDLSTEELAAYLLFERLLCARYTFEESDQGLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 Scaffold_11 AUGUSTUS gene 223046 223594 0.97 - . g48 Scaffold_11 AUGUSTUS transcript 223046 223594 0.97 - . g48.t1 Scaffold_11 AUGUSTUS stop_codon 223046 223048 . - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_11 AUGUSTUS CDS 223046 223594 0.97 - 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_11 AUGUSTUS start_codon 223592 223594 . - 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MNSTFSFERKILLAQSRYKEQADRKRISHLEFPIGSKVFVLAKHICSTRPTKKFSQKYLGPFKVISRPGTLSYELKLP # DYLRRIHLVFHISQLEPVTLNPFPNRTQSPPPPIEVDGEEKYNIAEILDSKLDRRYKRCPLRYYIWWAGYEGTDDEFSWVAADELHADGLVPAFHARY # PLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 Scaffold_11 AUGUSTUS gene 228893 229904 0.37 - . g49 Scaffold_11 AUGUSTUS transcript 228893 229904 0.37 - . g49.t1 Scaffold_11 AUGUSTUS stop_codon 228893 228895 . - 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_11 AUGUSTUS CDS 228893 229369 0.79 - 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_11 AUGUSTUS CDS 229533 229904 0.37 - 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_11 AUGUSTUS start_codon 229902 229904 . - 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MERVLLEALGGQSRRNGPSVHPPMDLNKLDDLVLFLQSHAIEQSTKNNYSTGARDYVRFCTSHNLSLDPTPSTLSRYI # AFTSRHKASGPKYLTGARHYLKDVYPHFDESRSHPLVQATIRGSKKKSLRDWRKVIKRSTLKFEAGRAGYHLPYHKGDPFYQGTDILFCSQQVADPVT # LLKEYATARDKLHGARPALFILEDGNVPTRGWFDSMFFAVLSKEFGGHSGRAGGATFYAGLGLQEMIIMALGRWSSSAWKIYIRDNPAVRAELELAAI # RRHQSSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 Scaffold_11 AUGUSTUS gene 234396 235407 0.76 - . g50 Scaffold_11 AUGUSTUS transcript 234396 235407 0.76 - . g50.t1 Scaffold_11 AUGUSTUS stop_codon 234396 234398 . - 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_11 AUGUSTUS CDS 234396 234872 1 - 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_11 AUGUSTUS CDS 234982 235407 0.76 - 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_11 AUGUSTUS start_codon 235405 235407 . - 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MERVLLEALGGQSRRNGPSVHPPMDLNKLDDLVLFLQSHAIEQSTKNNYSTGARDYVRFCTSHNLPLDPTPSTLSRYI # AFTSRHKASGPKYLTGARHYLKDVYPHFDESRSHPLVQATIRGSKKVRADPVKRKPHSALHTFTKSLRDWRKVIKRSTLKFEAGRAGYHLPYHKGDPF # YQGTDILFCSQQVADPVTLLKEYATARDKLHGARPALFILEDGNVPTRGWFDSMFFAVLSKEFGGHSGRAGGATFYAGLGLQEMIIMALGRWSSSAWK # IYIRDNPAVRAELELAAIRRHQSSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 Scaffold_11 AUGUSTUS gene 236183 236941 0.93 - . g51 Scaffold_11 AUGUSTUS transcript 236183 236941 0.93 - . g51.t1 Scaffold_11 AUGUSTUS stop_codon 236183 236185 . - 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_11 AUGUSTUS CDS 236183 236941 0.93 - 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_11 AUGUSTUS start_codon 236939 236941 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MRSLREGFWPFYEAEWEVESKQKLDNYVSEPQDFAALRAHRDQEVAAGRWSEALPEDFVLLPGMKVSPMFVVWQKGKP # RVVMDHTGSGLNDNIPKAEGKVKYDDMHTFGQVLNDILKEHPDEELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIVRRLVFGTRTSPRCWCSL # SSLMCWFGSEKLGIIGLHVYMDDFYGWDFKRNLLLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKILDSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 Scaffold_11 AUGUSTUS gene 237251 238934 0.85 - . g52 Scaffold_11 AUGUSTUS transcript 237251 238934 0.85 - . g52.t1 Scaffold_11 AUGUSTUS stop_codon 237251 237253 . - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_11 AUGUSTUS CDS 237251 238504 0.97 - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_11 AUGUSTUS CDS 238644 238934 0.85 - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_11 AUGUSTUS start_codon 238932 238934 . - 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSSLRSPLIRVKVVPSLLNLPPTSLLDPPLNSD # LSGSGLEPFRSAYKSSQKLVRLTAEALGQVVEQYRNNELSPNDAFRALRSLTDDPTVVRDFIGQIQEIQRDHLRASRERAVAAAAASKSRISDGPLVS # TEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSNSLQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTVSETWK # LRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFEKIHASITSYTSIFDDSTTFGSEYKLVKKEHSIRSLPVTSEAQWLRVFDAWLAPV # LKIYPHRQSELSAYKASIMEFFRAAPSDPSIAFRVDREARQKASNTPFDLGNAENFRLLLLKELLSARKRPSSSPSTSSASKRQDTPCILWNEGKCTS # PCPNRRKHGFCSVCGEPHKAVDSQSCYEKLKHSRSEGKNRSGRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 Scaffold_11 AUGUSTUS gene 239893 241350 0.6 - . g53 Scaffold_11 AUGUSTUS transcript 239893 241350 0.6 - . g53.t1 Scaffold_11 AUGUSTUS stop_codon 239893 239895 . - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_11 AUGUSTUS CDS 239893 241350 0.6 - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_11 AUGUSTUS start_codon 241348 241350 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MASVVSVESPTKQLTAPESNSGSSNSIPRFRRGYLWSTSSSSSEIIPPSIQSTLTAPPLPSPPEHLLNNPQIQSTLKA # MAPYIKVETPFNVDRLENLLASHPNQPFVASVMRSLREGFWPFYEAEWEVESKQKLDNYVSEPQDFAALRAHRDQEVAAGRWSEALPEDFVLLPGMKV # SPMFVVWQKGKPRVVMDHTGSGLNDNIPKAEGKVKYDDMHTFGQVLNDILKEHPDEELILFKSDVSKAFLNLPGHPLWQLCQVVEVDGRYHIVRRLVF # GPRTSPRCWCSLSSLMCWFGSEKLGIIGLHVYMDDFYGWDFKRNLLLFHDQLRPKRQVQLLVFWDMILCPYEDKKQEHGVTLKIIGFWVDIVKGSISL # SSESIQGLVADITSFLSSPKRQAALRDWQHLAGSLNWSLNVLPWARPALTEMYRKMSGKTLQFRAIPINGEVYRDLTWFSDLLQTAIGIRFVDAQRWH # DSEADFVRHEGGIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 Scaffold_11 AUGUSTUS gene 241797 243272 0.23 - . g54 Scaffold_11 AUGUSTUS transcript 241797 243272 0.23 - . g54.t1 Scaffold_11 AUGUSTUS stop_codon 241797 241799 . - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_11 AUGUSTUS CDS 241797 242655 0.37 - 1 transcript_id "g54.t1"; gene_id "g54"; Scaffold_11 AUGUSTUS CDS 243130 243272 0.24 - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_11 AUGUSTUS start_codon 243270 243272 . - 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MQSVCHYLYYCSGSVYFYTPTSTLQFRSFGNLLSDDQGRSWDTSGSHSWYCPQVTGSEHREASIALSTHSHHSSHQIP # LQDRISAAPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSLTDDPTVVRDFIGQIQEIQRDHLRASRERVAAAKAARVAAAAASKSRISD # GPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSNSLQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTV # SETWKLRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFEKIHASITSYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 Scaffold_11 AUGUSTUS gene 247106 247447 0.97 + . g55 Scaffold_11 AUGUSTUS transcript 247106 247447 0.97 + . g55.t1 Scaffold_11 AUGUSTUS start_codon 247106 247108 . + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_11 AUGUSTUS CDS 247106 247447 0.97 + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_11 AUGUSTUS stop_codon 247445 247447 . + 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MSSTTISTTPSFKVLTKDNYNDWQGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQQ # VPIKAHQEDPIRMWSILEKQHVSKKPGAVEGDCTC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 Scaffold_11 AUGUSTUS gene 247795 249471 0.6 + . g56 Scaffold_11 AUGUSTUS transcript 247795 249471 0.6 + . g56.t1 Scaffold_11 AUGUSTUS start_codon 247795 247797 . + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_11 AUGUSTUS CDS 247795 247820 0.6 + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_11 AUGUSTUS CDS 247914 249471 0.88 + 1 transcript_id "g56.t1"; gene_id "g56"; Scaffold_11 AUGUSTUS stop_codon 249469 249471 . + 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MSVSTLYTKFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMALI # RALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRKG # IQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEAR # QVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNYG # DVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAFK # RFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFLQDEGSKYNVQLEIDLNKMESLKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 Scaffold_11 AUGUSTUS gene 249501 250417 0.22 + . g57 Scaffold_11 AUGUSTUS transcript 249501 250417 0.22 + . g57.t1 Scaffold_11 AUGUSTUS start_codon 249501 249503 . + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_11 AUGUSTUS CDS 249501 249867 0.3 + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_11 AUGUSTUS CDS 249981 250417 0.55 + 2 transcript_id "g57.t1"; gene_id "g57"; Scaffold_11 AUGUSTUS stop_codon 250415 250417 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVF # IGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLHSESNSEVDKGNAPNSPRLEHTPGPDIPVTEDESDELPIAIRRPARNRKPPGEW # WKTKPSSSRVPAPNDDSDDSNDDYYGDAELASISTQQVEPRNYREAMHSSEAFKWEEAMNDEISAHLANNTWDIVDLPPGESNWVYLGIPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 Scaffold_11 AUGUSTUS gene 251134 251835 0.58 + . g58 Scaffold_11 AUGUSTUS transcript 251134 251835 0.58 + . g58.t1 Scaffold_11 AUGUSTUS start_codon 251134 251136 . + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_11 AUGUSTUS CDS 251134 251835 0.58 + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_11 AUGUSTUS stop_codon 251833 251835 . + 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MINIPYMSAVGSLLFLAMILRADIAFATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDPTAPDLITAISD # ADLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPEHHGRMKHLD # RTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALVKQKVEKFRTMIGLVKPSTSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 Scaffold_11 AUGUSTUS gene 252698 254938 0.82 - . g59 Scaffold_11 AUGUSTUS transcript 252698 254938 0.82 - . g59.t1 Scaffold_11 AUGUSTUS stop_codon 252698 252700 . - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_11 AUGUSTUS CDS 252698 254938 0.82 - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_11 AUGUSTUS start_codon 254936 254938 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEEPGRGVNGEEIHEGPLQPPHEAPQQPPEAPQPPPEVPQQTPEALRAPRTRVKLEEVKDEEYEASQPGP # HKLFPSDKDLGPDDPILMGINEWLAFANESMEEEVEEILEAGRSTMEKVAPNPAKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDLP # TLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSAT # EGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEY # INEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLWKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSF # EYLVMPFGLTNAPSVFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKV # KAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 Scaffold_11 AUGUSTUS gene 256941 258464 0.63 + . g60 Scaffold_11 AUGUSTUS transcript 256941 258464 0.63 + . g60.t1 Scaffold_11 AUGUSTUS start_codon 256941 256943 . + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_11 AUGUSTUS CDS 256941 258464 0.63 + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_11 AUGUSTUS stop_codon 258462 258464 . + 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MTLRLEDVIRIQECIPEDVAMVLREVLESMGIEKLGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLW # LYNVLLNPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKID # EESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNL # ERALEFRRRLVADNRGTSYMVQCELESIGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNIEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPR # VNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAP # FGTPFVTGAQMNRPGMAFESARSQESVAMIQQTGSGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 Scaffold_11 AUGUSTUS gene 258587 259657 0.95 + . g61 Scaffold_11 AUGUSTUS transcript 258587 259657 0.95 + . g61.t1 Scaffold_11 AUGUSTUS start_codon 258587 258589 . + 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_11 AUGUSTUS CDS 258587 259657 0.95 + 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_11 AUGUSTUS stop_codon 259655 259657 . + 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE # GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG # ELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKD # KCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 Scaffold_11 AUGUSTUS gene 270427 271686 0.89 + . g62 Scaffold_11 AUGUSTUS transcript 270427 271686 0.89 + . g62.t1 Scaffold_11 AUGUSTUS start_codon 270427 270429 . + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_11 AUGUSTUS CDS 270427 271686 0.89 + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_11 AUGUSTUS stop_codon 271684 271686 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD # IKIETEGDAIPPIGKLYNMSEKELKSLKEYINEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLWKAKIFT # KIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSVFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAK # PEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSE # APVLGHYNPDLPVILECDASDLAIAGILSQLDPETGRYILLPSMHDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 Scaffold_11 AUGUSTUS gene 273857 275038 1 - . g63 Scaffold_11 AUGUSTUS transcript 273857 275038 1 - . g63.t1 Scaffold_11 AUGUSTUS stop_codon 273857 273859 . - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_11 AUGUSTUS CDS 273857 275038 1 - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_11 AUGUSTUS start_codon 275036 275038 . - 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MEGDLRDAVRERKVAEEKLSSSTRKSSQLTTTLLYQQGRVDESNALATRQRRLVEELQEEVHRARDRAAFVEQMVKEY # PDEGYYEVVLPPLSQLEGDLNKAREDLRRVATLAHRLHCSDPATVLHHHHRYIGAIIEAVVAFLRRGLESEDPDIATHNLHLALDYMQAARGVHGDLY # IRSISSIQWFFNNAVDEDEGLYRLVLEHSRFDNDSPFLTAAQHAGFAPPPDNSLEPPLHRRMLALSTALPHSDGVGRWDDLVPALPSVDQLTVDWEQL # MLRYIHHITDVPLSGTDTQVPMSSVEPGTESLAEVTVEQLPEAPPLFLPEQESPTSPSPPPTSPTLPPPFASLANLTIDLTGDDDDLYETEESRMARV # SMSREVVDSVAVQSVVKEEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 Scaffold_11 AUGUSTUS gene 282353 283219 0.54 + . g64 Scaffold_11 AUGUSTUS transcript 282353 283219 0.54 + . g64.t1 Scaffold_11 AUGUSTUS start_codon 282353 282355 . + 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_11 AUGUSTUS CDS 282353 283219 0.54 + 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_11 AUGUSTUS stop_codon 283217 283219 . + 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MQSRKNARSMSTPSSTWGDHITIGSVHGPRESEGVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKD # SVWNWTQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCE # GSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALSREGKGTHTSRTTERYHPYERGPP # SESSKGSSKGHDYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 Scaffold_11 AUGUSTUS gene 283720 284718 0.76 + . g65 Scaffold_11 AUGUSTUS transcript 283720 284718 0.76 + . g65.t1 Scaffold_11 AUGUSTUS start_codon 283720 283722 . + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_11 AUGUSTUS CDS 283720 284718 0.76 + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_11 AUGUSTUS stop_codon 284716 284718 . + 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MPADIVSDRGSLFVSQFWKELCRALGIESRLSTAYHPQTDGQTERVNQAVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLELVQGAEVNEYASNLKELHTYLQERIQVANEVYAQYANQKRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKW # TGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGRPEEVEYLVKWEGYSEEFNSWVGW # EGMAGSLELLRSWHEKHPRKRQPSQRHWARLIKDAQEDEEDEREDRGRTGADDDTKER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 Scaffold_11 AUGUSTUS gene 284903 285292 0.29 - . g66 Scaffold_11 AUGUSTUS transcript 284903 285292 0.29 - . g66.t1 Scaffold_11 AUGUSTUS stop_codon 284903 284905 . - 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_11 AUGUSTUS CDS 284903 285292 0.29 - 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_11 AUGUSTUS start_codon 285290 285292 . - 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MLQYIHHITDTPLSGIATQGPMSSVEPANESLPEVLVRQSPETPAALESTSSVGPHPQVPLFLPEQGSLTSPSPTLPP # LFGSVANLVIDLTGDDDELYETEEVGAGRFSVTREVIDLAASQDVVKDESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 Scaffold_11 AUGUSTUS gene 291350 292930 0.4 + . g67 Scaffold_11 AUGUSTUS transcript 291350 292930 0.4 + . g67.t1 Scaffold_11 AUGUSTUS start_codon 291350 291352 . + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_11 AUGUSTUS CDS 291350 291526 0.95 + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_11 AUGUSTUS CDS 291687 292136 0.53 + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_11 AUGUSTUS CDS 292196 292930 0.69 + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_11 AUGUSTUS stop_codon 292928 292930 . + 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MKLFTLPIPIDESESDSDSNSDVDKANQPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPRAMHSSEAFKWEEAMNDEI # SAHLANNTWDIVNLPPGQKQLDQLGYSVLNTMLMVLLNDLKPPLCSGFSQRPGFDYLETYASTLRWSSLRLVLALAAIDDMELRSVDISHAFINSDID # TTIYMKQPEGFKQGGPEKVCRLNKSIYGLKQSPSDPCVYLFQRGDIKVIVPVWVDDITLASKNSDVLNKFVIELSKELKLRDLGETTFLLGIGIRRDR # PNRKLYLNAKQYIIRKLDEFGMQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAV # KHLLRYLKGTIDYELELGPDPTAPDLITAISDSDLGGNEGGRRIPRVGSVSGGLCKPTDPHQQLNLSFSTLEVYRRPPPHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 Scaffold_11 AUGUSTUS gene 300144 302481 0.32 - . g68 Scaffold_11 AUGUSTUS transcript 300144 302481 0.32 - . g68.t1 Scaffold_11 AUGUSTUS stop_codon 300144 300146 . - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_11 AUGUSTUS CDS 300144 301305 0.32 - 1 transcript_id "g68.t1"; gene_id "g68"; Scaffold_11 AUGUSTUS CDS 301436 302481 0.34 - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_11 AUGUSTUS start_codon 302479 302481 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MLLESGLPKTFWVECLAALVYVLNRCPTSAVPDVTPYEVFYKKKPNVENLRVWGCMAYVHVQKDKRLHLGSHMEKCVF # IGYPEGVKGWKFWNPVTKKVIISERADFDERYMYASKSPDKPTLRKDYVPPETTPKQQPLKVTSSAPNELFTLPIPIDESESDSESNSEVDKGNAPNS # PRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKPSTSRVPANNDDSDDSNDDYYGDAELAASTTLQVEPRNYREAMHSSEAFKWEEAMN # DEISAHLANNTWDIVDLPPGAKAIGSTWVFRIKHNADGSIERFKARLCAQGFSQRPGFDYLEPMLPLYAGLHYVSKSLQAKQVHLWFEAVPRLWSEKL # CSVLVKLGFKRLESDPCVYLFQRGDIKVIVPVWVDDITLASKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEF # GMQDSKPVKTPLNPNVTLSKEDSPQTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPD # PTAPDLITAISDSDLGGNKDNGKSTTGYIIKIGSGAVSWSSKLQPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAK # NPEHHGRMKHLDRTFYWLREQVIHGKLAPSYLPTEDNPADLLTKALAIPKVDKFRTMIGLVKPITSDDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 Scaffold_11 AUGUSTUS gene 302519 304390 0.95 - . g69 Scaffold_11 AUGUSTUS transcript 302519 304390 0.95 - . g69.t1 Scaffold_11 AUGUSTUS stop_codon 302519 302521 . - 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_11 AUGUSTUS CDS 302519 304390 0.95 - 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_11 AUGUSTUS start_codon 304388 304390 . - 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MSSSTTISTTPSFKVLNKDNYNDWKGNMKASLMSHGLWRLVSGKEKQPPASDTEKLEKWELKAEKAAGLIYLAVSPAQ # QVPIKAHQEDPIRMWSILEQQHVSKKPGARFNAYNALFTITKSADESLMDMAARVEAAMADIQNLRPPVAPIAVQSNGLPALGFTLDSLDSELQSMAL # IRALPEEYRHLSSNLLMQDNLDKEKILAAFLAEQQNQEHAEQQSVNRAAQAASSSNKKKNNYRAPVRTGEPKDYCKWCGKKAVHWQEDCPSNPHNKRK # GIQANKAKVTEVDDDGVTESAGSATASSLSNVLSASSFADTMEWNTDTGATSHMTPHRNWIRNYTPHRVPIRLADHTVVYSEGMGEVLFTPIVDGKEA # RQVLFSRVLHVPSLNNNLLSVLYLTKHKGFTVQILKDTMEFTLNGSVLFTASVNNKSVGYLNGLTISNGTEDESAHIGGTTLPLNLELWHRRFFHYNY # GDVSKLSKNKMVEGFKLESSAKPDPVCEPCLGGKMHANPFPSTETRASEVLELVFTDVHDTGIISHEGYRYWIPFICDKARFRAVIPMKKKSDAFAAF # KRFKAWAEKVTGLKVKILRHDKGGEYISKEFEKFYKMKDRSTTHSQKSTSAKWSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 Scaffold_11 AUGUSTUS gene 312944 313996 0.53 + . g70 Scaffold_11 AUGUSTUS transcript 312944 313996 0.53 + . g70.t1 Scaffold_11 AUGUSTUS start_codon 312944 312946 . + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_11 AUGUSTUS CDS 312944 312961 0.76 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_11 AUGUSTUS CDS 313114 313117 0.91 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_11 AUGUSTUS CDS 313184 313215 0.81 + 2 transcript_id "g70.t1"; gene_id "g70"; Scaffold_11 AUGUSTUS CDS 313364 313996 0.67 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_11 AUGUSTUS stop_codon 313994 313996 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MTRVNILMITRSDEALCNKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTG # SSISRGRLTSLPRNLKKSNLNPKRKRKGINPIDIEEDIIELIAPESISTSFTSIESTRLIDTLNQTISQASNMIEPVKMTTNNYGMPALSAEAKAEID # KASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 Scaffold_11 AUGUSTUS gene 314084 315064 1 + . g71 Scaffold_11 AUGUSTUS transcript 314084 315064 1 + . g71.t1 Scaffold_11 AUGUSTUS start_codon 314084 314086 . + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_11 AUGUSTUS CDS 314084 315064 1 + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_11 AUGUSTUS stop_codon 315062 315064 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MFPQSAGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLE # TVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGI # KLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWA # CFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 Scaffold_11 AUGUSTUS gene 315313 317551 0.32 + . g72 Scaffold_11 AUGUSTUS transcript 315313 317551 0.32 + . g72.t1 Scaffold_11 AUGUSTUS start_codon 315313 315315 . + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_11 AUGUSTUS CDS 315313 315614 0.6 + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_11 AUGUSTUS CDS 315675 315916 0.47 + 1 transcript_id "g72.t1"; gene_id "g72"; Scaffold_11 AUGUSTUS CDS 316102 316422 0.63 + 2 transcript_id "g72.t1"; gene_id "g72"; Scaffold_11 AUGUSTUS CDS 316821 317551 0.8 + 2 transcript_id "g72.t1"; gene_id "g72"; Scaffold_11 AUGUSTUS stop_codon 317549 317551 . + 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPKKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSTYRPIQINTPTKVPRDQMNQIDSHGYTPAYKIRNEVSRPGVEEDIKKIFDAKVDLSTEELAALSPAIRKIIMRKI # RNRRVLQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFT # IRMQDASGKLNQTLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFL # QNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVIMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 Scaffold_11 AUGUSTUS gene 317827 318480 0.58 + . g73 Scaffold_11 AUGUSTUS transcript 317827 318480 0.58 + . g73.t1 Scaffold_11 AUGUSTUS start_codon 317827 317829 . + 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_11 AUGUSTUS CDS 317827 318480 0.58 + 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_11 AUGUSTUS stop_codon 318478 318480 . + 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPKEVTKHSRESWN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 Scaffold_11 AUGUSTUS gene 328200 329259 0.74 - . g74 Scaffold_11 AUGUSTUS transcript 328200 329259 0.74 - . g74.t1 Scaffold_11 AUGUSTUS stop_codon 328200 328202 . - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_11 AUGUSTUS CDS 328200 328702 0.87 - 2 transcript_id "g74.t1"; gene_id "g74"; Scaffold_11 AUGUSTUS CDS 328881 329259 0.8 - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_11 AUGUSTUS start_codon 329257 329259 . - 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFSGLSVKR # SPWNFTIPLDIIRKPMGKLSVSIRLSSSTSGSIVPTNKMTGRLYFRSPTQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFK # VISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYNVVLYVITFGGPVTKVPTMNSPGLLLM # NYMLTNCTAFHADTLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 Scaffold_11 AUGUSTUS gene 330638 331261 0.43 - . g75 Scaffold_11 AUGUSTUS transcript 330638 331261 0.43 - . g75.t1 Scaffold_11 AUGUSTUS stop_codon 330638 330640 . - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_11 AUGUSTUS CDS 330638 331261 0.43 - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_11 AUGUSTUS start_codon 331259 331261 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLSESLKVTN # GNHLSDPLRLLRMEGHAVRPYERPCGFPAVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 Scaffold_11 AUGUSTUS gene 332339 333768 0.57 - . g76 Scaffold_11 AUGUSTUS transcript 332339 333768 0.57 - . g76.t1 Scaffold_11 AUGUSTUS stop_codon 332339 332341 . - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_11 AUGUSTUS CDS 332339 332894 0.73 - 1 transcript_id "g76.t1"; gene_id "g76"; Scaffold_11 AUGUSTUS CDS 332984 333768 0.57 - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_11 AUGUSTUS start_codon 333766 333768 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSLSAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDWTLVITMIKTLLSTPTIRADNNNDNLDDDSGGLPRGEPGD # PSGPGGPGGPGGPGGPGGPGGPRSPISPDIPTSKLCWNSSRGSRAPLRPLVPFSPLSGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDIL # DPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADY # RQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSANQHNNSQPSGYTAPFTLKPKTFSGGKPKQQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 Scaffold_11 AUGUSTUS gene 337834 338310 0.59 - . g77 Scaffold_11 AUGUSTUS transcript 337834 338310 0.59 - . g77.t1 Scaffold_11 AUGUSTUS stop_codon 337834 337836 . - 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_11 AUGUSTUS CDS 337834 338310 0.59 - 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_11 AUGUSTUS start_codon 338308 338310 . - 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MARVEVENLGLSLEDEDIKYEDEEDIITPCATSSPSVTTLEANVNPSILPTDSTPYASMNPQPRSSKRVKKVAAARRK # CAIAAQRRQANSELKEHAIRVAADATPIELKSFDTSSLPAASNGWTAYSRTRLSPGLQRLWRNLNVLTASDLRLFDWDGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 Scaffold_11 AUGUSTUS gene 339945 342398 0.35 + . g78 Scaffold_11 AUGUSTUS transcript 339945 342398 0.35 + . g78.t1 Scaffold_11 AUGUSTUS start_codon 339945 339947 . + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_11 AUGUSTUS CDS 339945 340526 0.35 + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_11 AUGUSTUS CDS 340620 342398 0.62 + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_11 AUGUSTUS stop_codon 342396 342398 . + 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MALVIGEWCKSSSAVNFEEAGCAVCGQLTLCTELSALKNMKNYLHILEAQSVTRAFRSSPDELISETKGPVLDKSAGD # NICNNCRSSLRAGNVPKLALCRGLWLGVIPDELKGLTFYEKMLIAKVRHTKCFVRVQKGSTNYSKLVSNVIAFENPIPKIYDTLPPPKEEIEEVLAIM # FSGSTKPTQDDYSRALLLSYAEDAPIVAVEYFQKGSNRNAEGVSVHDNLNDDDTEDGDCVFTVHGIVGPSIKNMTRDQMIGIAAMHLDNEGKFMRTSH # AENPESLWNNPQLYPKMFPWLFPFGLGGIGTPKMKAFSESSHIKFLLLYHDKRFQLDPNFPLIAFSHQQIKANSSQSYLLAESKKFNEISDRFLSVDK # SILQNIATRMANGEHVKPANESEIQCFKLLGDLTHAGARTQGSISSKKTMQSEIWSLINHIGGPSWYITVSPCDFKHPICIYYADTKEKFDVPLRTSS # ECRLLISNNPVAGARFFHLLVNLFLKHVVDIESSNGGLFGPTNGYYCTVEQQGRLALHLHGLIFNRKSLSPQEIRDKILDPASLFQSQLVSFLKSVRI # GEFLTGSHAYVKETVAAQTKSNPNYISPEKTLPTPPPPYCDCGISDCHKCSTFIQWFEQFKFTVDDLLLKSNVHDCFRGISPDGSVLNQDKFETSCLD # NVHKKCKARFPRECFQQSLVDPDNGHINLKKLEEWLNDISPGLTYLVRGNTDVSSILSGTAIKSAVIYIADYITKTGLKTHVVFDSIKTIFDKSTEII # DGSFSAKEKSRRLISRIVNLFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 Scaffold_11 AUGUSTUS gene 342719 343747 0.89 + . g79 Scaffold_11 AUGUSTUS transcript 342719 343747 0.89 + . g79.t1 Scaffold_11 AUGUSTUS start_codon 342719 342721 . + 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_11 AUGUSTUS CDS 342719 343747 0.89 + 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_11 AUGUSTUS stop_codon 343745 343747 . + 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MSSRSTKCNKQLLFLPGHPLADTHVVVTRRYSSMTVPNFVGSLPRPDKDDREYYCCTMLTLFCPWRSGEDLKKKDQSW # HEAFEAYVFSDQSLLYMKNMNIRFECLDARDDFRAQLKSGKLDITKLPSSIPIQLHEDLVNKLDSSQLDINSSDMEDTGHSYDQYTQDKKGSFFLKRE # SAMKAMKDILFNIGWVTPLTGNMQSKSIPICTPIQLPKEEPQHWDLILKGMRDHILASRERDRGLPSADNDNNENSVPGKYRPNIVEICDKYYFDKLG # LEYGSIKELTLNIVKCHNLNNEQERAFRIIAQHSACLVSEPLQMYIGGMGGTGKSQVIKALLQFFAER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 Scaffold_11 AUGUSTUS gene 345756 346568 0.8 + . g80 Scaffold_11 AUGUSTUS transcript 345756 346568 0.8 + . g80.t1 Scaffold_11 AUGUSTUS start_codon 345756 345758 . + 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_11 AUGUSTUS CDS 345756 346568 0.8 + 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_11 AUGUSTUS stop_codon 346566 346568 . + 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MRNTGSSQIDISFRLVLDNMRYKSCTKEDILFLNTLVSSKLPNRPFVGKSPWCDAAIIVGENKHKDEINRLGCLHFAA # DTRQKLTHFYSDDLVSGNANQGAPAKSKNKKRSMSSITKDLQQHLWELPTCAHETHAPPVLSLCIGLPIIIRHNIATELSITKGQRGTVMVGMRALGH # SVKSTLDVLFVLLDHSPTPIQVPNLPPNVVPLTRRKTKGIVTLKNDVKISVTRFQVDVLPGFSMTAHSQGQGLNPNATDLNTLTDHHAIYTASI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 Scaffold_11 AUGUSTUS gene 347296 347997 0.53 + . g81 Scaffold_11 AUGUSTUS transcript 347296 347997 0.53 + . g81.t1 Scaffold_11 AUGUSTUS start_codon 347296 347298 . + 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_11 AUGUSTUS CDS 347296 347997 0.53 + 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_11 AUGUSTUS stop_codon 347995 347997 . + 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MDITGDEYTSLPQLIKGFSEYKEGKHTLESVRDDLRISLNSRRPREFNLTGFCSSTAILEEILKMKSPFMTTKLQCEQ # GHLSRRRPHNVKVSLLEEPRLVLPSSTNEWISVNSPASSNIMCNLCNSPFKKLFHIKCAPNILAFACDGRPQLQIDNFVHLQCNNDVHVKGVIYYIPM # REHFISRIVASDNMVYVYDGMFNNGVPILESSDYNELDWAQCQTGSASAVIYTRTDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 Scaffold_11 AUGUSTUS gene 372319 373735 0.22 + . g82 Scaffold_11 AUGUSTUS transcript 372319 373735 0.22 + . g82.t1 Scaffold_11 AUGUSTUS start_codon 372319 372321 . + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_11 AUGUSTUS CDS 372319 372411 0.48 + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_11 AUGUSTUS CDS 372507 373140 0.53 + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_11 AUGUSTUS CDS 373248 373735 0.93 + 2 transcript_id "g82.t1"; gene_id "g82"; Scaffold_11 AUGUSTUS stop_codon 373733 373735 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MPAATANATSPSIPSPASLKAAAAPVEGQVDSAGFQDAVLKALADKKSPASRESAAEAVLAISKNGAVKALEPTFVNS # GIYAALLETFADKMPAVRTAAVEAVREFVAAMNPWATALILPALLHEIKTAGKWQLKTGSLVILNQLVASAPTQTSRLMPEIIPVLSEAIWDTKADVK # KAARDSLTKATALVSNKDIERFIPALIKALINPVEEVPNTIMLLSATTFVSEVDSPTLSLMVPLLSLSSITCPSSSTPRLLFVLSFPKLLPGLIKVET # TIGDPEARGVVGKAIATLRQVGEVPASSDGSDLPAHKQAEEGQLAHSLTAIYKKLGGEVSPGNAALMYASSLAANLVNLKNFDVPEWDTLAPYLAFVT # STPEPISVAREWVVRSATEDTGDEEVPEDEER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 Scaffold_11 AUGUSTUS gene 374772 375833 0.47 + . g83 Scaffold_11 AUGUSTUS transcript 374772 375833 0.47 + . g83.t1 Scaffold_11 AUGUSTUS start_codon 374772 374774 . + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_11 AUGUSTUS CDS 374772 375146 0.53 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_11 AUGUSTUS CDS 375208 375427 0.84 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_11 AUGUSTUS CDS 375481 375833 1 + 2 transcript_id "g83.t1"; gene_id "g83"; Scaffold_11 AUGUSTUS stop_codon 375831 375833 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MEPNKGGEIWKHPNLVIGYVAQHAFHHIDNHLDKTPLEYMLWRYQTGEDLEEMTKANRQISEEEAQKMKEGGVIVIEG # QKRLIDEIVARKKLKQSYEYEVSFKALSSSENIWLPRDELIKRGFEKKVIEVDTREAQRLGLLRPLVRREIEKHFADFGLEPEFVSHNTMRGLSGGQK # VKIVLGAATWRRPHVMCLDEPTNYLDRESLAALIEALKVFEGGVLVITHNRDFSESLCKEVWAMRDGRLEASGHNWVEGQGSGPRIDKNDGDEDVQYD # AMGNKIENKKAKKITSSEARKMKRERMARRKRGEDVTDDEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 Scaffold_11 AUGUSTUS gene 376955 377566 1 - . g84 Scaffold_11 AUGUSTUS transcript 376955 377566 1 - . g84.t1 Scaffold_11 AUGUSTUS stop_codon 376955 376957 . - 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_11 AUGUSTUS CDS 376955 377566 1 - 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_11 AUGUSTUS start_codon 377564 377566 . - 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MSSVLIRRLRLPLHSRTLLYPTRHHYSTSSEPTALKPPSPSHSRRNLLTLILAASASLTAYTVGSIYPPPPLSLLFPS # PAPAPPDPTSLESLEYTTSLEKELLSLPLLQSLRAAPDAKEWYEARPYKNFPEERRVNNLTAGALRGPGKLAVPPVVWVRRDESESFVFIHVGRGLCG # HDGIVHGGMLATLLDETMARTVSFSPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 Scaffold_11 AUGUSTUS gene 385283 385762 0.97 - . g85 Scaffold_11 AUGUSTUS transcript 385283 385762 0.97 - . g85.t1 Scaffold_11 AUGUSTUS stop_codon 385283 385285 . - 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_11 AUGUSTUS CDS 385283 385762 0.97 - 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_11 AUGUSTUS start_codon 385760 385762 . - 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MKRADECEYEDRRQKSRTQKLKEKLAMLEDRIKELEGTEQTTSGDASSSHSGSPDTFDLSGTNTLDDVDQNQISLNNA # WPANSAEPSSNSSSSSLLSASGSPFASAMGMVWGDTSGGGEQAFEISPFTGMSSSMFPDMPHWDPTTPLPFENKKILSVSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 Scaffold_11 AUGUSTUS gene 388181 388939 0.89 + . g86 Scaffold_11 AUGUSTUS transcript 388181 388939 0.89 + . g86.t1 Scaffold_11 AUGUSTUS start_codon 388181 388183 . + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_11 AUGUSTUS CDS 388181 388939 0.89 + 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_11 AUGUSTUS stop_codon 388937 388939 . + 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MASEMFIPPLGTPQPSPRNPPVLPGATNAAPPAWAMSPATGGQYPMFNSPMSGNPFIPPHFTPASAAPPMLPRGTPYS # AAQSLPHPGYSADYTGYPQLAPTPQWGPTPLSSAQPSPWAQPQNLQHWGMPNSAPVMGTPWPGMNNVLPGGPPPPGMPPPGMSPHGAWGMPPMMHQGF # GPPQMHMGPPMMPPAAAPMMGMMGGGSGPWDMSGMGQALPQPSAPLPRATGVLGDRMDVIDEFAAGAHCTFFPFTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 Scaffold_11 AUGUSTUS gene 390452 391074 0.52 - . g87 Scaffold_11 AUGUSTUS transcript 390452 391074 0.52 - . g87.t1 Scaffold_11 AUGUSTUS stop_codon 390452 390454 . - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_11 AUGUSTUS CDS 390452 390500 0.54 - 1 transcript_id "g87.t1"; gene_id "g87"; Scaffold_11 AUGUSTUS CDS 390593 391074 0.52 - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_11 AUGUSTUS start_codon 391072 391074 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MSSHGTHQYRSAATLRVFRADPNPIIPHSAFADASYIPAANYLRPPALEKNFLISPPGSPPVGWEPIKEDPPNAAPLA # GDLMAALQKLQIQERDREGNQGPEILLHPEDGGSGVGVYVEDCDNGAAPVDIEIEDEDWVYGQTAPARSKWKPVTAMPPMRAAPVPNMNEDKVIAFYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 Scaffold_11 AUGUSTUS gene 392603 393200 0.87 - . g88 Scaffold_11 AUGUSTUS transcript 392603 393200 0.87 - . g88.t1 Scaffold_11 AUGUSTUS stop_codon 392603 392605 . - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_11 AUGUSTUS CDS 392603 393058 1 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_11 AUGUSTUS CDS 393105 393200 0.87 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_11 AUGUSTUS start_codon 393198 393200 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MAPKGGNAKKESGRAKKAENEAKKQDAALAEKEKKEAAAWDDGAKAGKDKAAKEEKRKADLARKAENARLLAEEEATP # PPKAKVAPKAGAKKAVKPQPKPAGPGAIAAGGGLVSADDEKSGSKGQGEEPKEIESFSATGIDNALDLLDVVTAKMDKASVGSQAAGIERHPEVMSSV # NGVRTII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 Scaffold_11 AUGUSTUS gene 399600 400534 0.38 - . g89 Scaffold_11 AUGUSTUS transcript 399600 400534 0.38 - . g89.t1 Scaffold_11 AUGUSTUS stop_codon 399600 399602 . - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_11 AUGUSTUS CDS 399600 400057 0.77 - 2 transcript_id "g89.t1"; gene_id "g89"; Scaffold_11 AUGUSTUS CDS 400219 400383 0.39 - 2 transcript_id "g89.t1"; gene_id "g89"; Scaffold_11 AUGUSTUS CDS 400477 400534 0.65 - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_11 AUGUSTUS start_codon 400532 400534 . - 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MSSDSNQPSISPPKSNNPYRAHNFDIYGGEFSHTAGNVYKTIRSDYSTRSNFDNSYGNDFSGSGNLANNHSGAYIVSD # GRGRGQRPVSPRQYERGSNYIREPYPQQGYPYQQQPALDERPITAPSMLESHQAVNQREFDLHAFDRVYNVHREPEENLSYDSRQNLGKSRTTSAESP # SPHPAQEEGPKVQDDIAMDGGDDTEGEGGGGDLTSEREVHRSNTAPISQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 Scaffold_11 AUGUSTUS gene 401619 403535 0.92 + . g90 Scaffold_11 AUGUSTUS transcript 401619 403535 0.92 + . g90.t1 Scaffold_11 AUGUSTUS start_codon 401619 401621 . + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_11 AUGUSTUS CDS 401619 403535 0.92 + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_11 AUGUSTUS stop_codon 403533 403535 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MKLTSNPRATPPRSLTADFFSTSPSLAAAPPKSSPAPRRKFLNLQLNGEEVQHMTPVTLAGAFASTPTPTESRDQFEF # IGDKPSFNSETRSHSSSWSEHLNEPTPKPPPKSPSLVHYHGRGPNGSSFDVQQLPSSVIPTLGAEPDAEVLSTSPSFSHLSSLGLTAAQGLSAYPSRP # TSSHSLHSTISQVSQELNTSMTHSLGEPDLGEGIFYPAGEEELASGMIIRSFLPSQSESKKLSGVMQPLSVSTASSNSSAYSNNMASVPVTLRLSRAL # GQGTFSSVWLAEDLSPTSLLLRSRKSLKDLKRKSTMDLKANLDYNGTSRSNQPADPPVGENKRTNGKLKSSLGSTSSLMRRLRGGVSGTRPGGASASS # SQTSIDDAIHVSIAMGRQGTLMPSPAPPSTSTVPSPNTATNNLSLDLPPALIPGHPSYSMSPPLVSSSRLGLGLPFEQDRISSASSARSVYLEFKDEH # IGLKSPDLYSDRLSIIGLDVPHHNYQNNSVSRASSVSWKSSVSSDEGQDGGAEDGSVCRSSSTRSNLSTRSYQNGGRHGLASRRSSTKSSVRRDRSRL # RSRLVAVKLTSRGVIEERERIPGQVLSRQEKMEEEERARERDRTRVSFVREVEVMKVRSSKSCRFNSLVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 Scaffold_11 AUGUSTUS gene 403961 405109 0.64 + . g91 Scaffold_11 AUGUSTUS transcript 403961 405109 0.64 + . g91.t1 Scaffold_11 AUGUSTUS start_codon 403961 403963 . + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_11 AUGUSTUS CDS 403961 405109 0.64 + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_11 AUGUSTUS stop_codon 405107 405109 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MLTEGNTTASPTNYSFSASSQSTPSSPTSDFHSSSVPPSSATKLPTPPQPLIKLTDFGLSRFIDPANPLLTTRCGSEA # YAAPELVVSGGRAGVASSTKSPWFMEDEAAGYAHETDSESENAGGYDARETDAWACGVVLYALVARRLPFGEGPGETLGAGQITGEGGLIRGFSPMER # RQWLMKIARGEWHWPGMEMNSKAMMSSELHGSDLVRSVGAKRAVAKLLVRDPSRRARIKDFWNDEWVQNFPVDGRDSIDGLPSDSDFYSPYIPDVPSI # PSLHEFTNVSSQFSSGHPNLYSTSLSGLPPQFGRPSVSDNVFASTHEDDDDEFDNDRRENQEVEVNGDDDPGSATADEDDELEEEEDGEGWLVDKDSI # NHIARSEVPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 Scaffold_11 AUGUSTUS gene 406065 407201 0.57 + . g92 Scaffold_11 AUGUSTUS transcript 406065 407201 0.57 + . g92.t1 Scaffold_11 AUGUSTUS start_codon 406065 406067 . + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_11 AUGUSTUS CDS 406065 407201 0.57 + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_11 AUGUSTUS stop_codon 407199 407201 . + 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MSVPAFDNFSRARASRYSYNSPPSKPCAGFDYNGHECCQLASGDGFCFSHKGQKSWSIAGSVSLEERRRHANGGRCNG # VAASTGNLCNRKIWGFTFCHSHRDQQPPAKFFEDVFDYFATPNRGSELATRSATVKENMMAFCLVKEEWSQNGRNARRRAEEEAEKRRNAAEEAQRAW # QRQQEQEAAERRKKAEEEKKKAHAFAEKLRQEYARQKAAEEERQRKYERNREEQKRKEEEKQREAEELAKAKRMKDTKDKQDIVTRYRRSCIEFDKVS # RFSDMRRASFTTIPWPVLRTQDAITPSEISWEFVEKFFHFVKDFLGPAVHRSLLEDARKRYHPNRWAAKNVVNSVVSKVEREQLESAGNTVSQAINSI # FSTSFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 Scaffold_11 AUGUSTUS gene 408627 409052 0.96 + . g93 Scaffold_11 AUGUSTUS transcript 408627 409052 0.96 + . g93.t1 Scaffold_11 AUGUSTUS start_codon 408627 408629 . + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_11 AUGUSTUS CDS 408627 409052 0.96 + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_11 AUGUSTUS stop_codon 409050 409052 . + 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MKLSVFVPILTAATTLADQLRFDTTYDNANQSLSTVACSDGVNGLLTKGFTTFGSLPTFPNIGGASAVTGFNSPNCGS # CWNVTFTNSTTGDSTTLSILAIDVGSGFVVSQEAMDNLTNDNAVALGVVNVDSVQVNASVCGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 Scaffold_11 AUGUSTUS gene 414508 415602 0.22 + . g94 Scaffold_11 AUGUSTUS transcript 414508 415602 0.22 + . g94.t1 Scaffold_11 AUGUSTUS start_codon 414508 414510 . + 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_11 AUGUSTUS CDS 414508 414759 0.36 + 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_11 AUGUSTUS CDS 414954 415137 0.47 + 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_11 AUGUSTUS CDS 415202 415602 0.89 + 2 transcript_id "g94.t1"; gene_id "g94"; Scaffold_11 AUGUSTUS stop_codon 415600 415602 . + 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MAEQKALQLEKAKGSFVISTVPILKPGPGQLSVKVITAALNPADWKLQTLGVFIQKYPAVLGTDIAGDVEDVGEGVEG # FSKGDKIPSNIDYAQAATIPLGFTSAAVGLLREQPGGAGLNPNFDLKVNLSGQSAIVVGGSTSVGQYAIQLLKLLGYSTIIAYASARHTDYLKSIGAT # HVIDRAEVPADSLAEAAKKIANVPIKIAFNAVGDKDSRAACIDAIVEGGQVADVNPQSKDVDPGNGKRIFPIFGVRTIPLTETSIEFCGRPFQSWLKK # ERLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 Scaffold_11 AUGUSTUS gene 416337 417456 0.27 + . g95 Scaffold_11 AUGUSTUS transcript 416337 417456 0.27 + . g95.t1 Scaffold_11 AUGUSTUS start_codon 416337 416339 . + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_11 AUGUSTUS CDS 416337 416590 0.63 + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_11 AUGUSTUS CDS 417000 417456 0.35 + 1 transcript_id "g95.t1"; gene_id "g95"; Scaffold_11 AUGUSTUS stop_codon 417454 417456 . + 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MSQQKALILEKAKGKFIVSTVPILKPGPGQLSIKVIATALNPVDWKIQAWDFIVQKYPAILGVDIAGDVEEVGDGVQG # FSKGDKVVPLCLFSSTAIQFLKLLGYSTIIAYASARHTNMLTSIGATHVIDRAKVPIDSLAESAKNIGSVPITIAYNAVGDKDSRAACADAIVEGGQI # ADVDPEAKNDVPENGKSVPHYGKFAHSQRIWSYSMEKPSKPTSRRKDCGASKKYRCFSLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 Scaffold_11 AUGUSTUS gene 417804 418097 0.95 + . g96 Scaffold_11 AUGUSTUS transcript 417804 418097 0.95 + . g96.t1 Scaffold_11 AUGUSTUS start_codon 417804 417806 . + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_11 AUGUSTUS CDS 417804 418097 0.95 + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_11 AUGUSTUS stop_codon 418095 418097 . + 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MSPQKALILEKAKGSLVVSAAQPILKPGPGQLSVKVIAVALNPVDWKIQAWDVLLKEYPAILGLDIAGDVEEIGEGVE # GFSRGDKVYVHKISPPLIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 Scaffold_11 AUGUSTUS gene 429143 429745 0.39 + . g97 Scaffold_11 AUGUSTUS transcript 429143 429745 0.39 + . g97.t1 Scaffold_11 AUGUSTUS start_codon 429143 429145 . + 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_11 AUGUSTUS CDS 429143 429745 0.39 + 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_11 AUGUSTUS stop_codon 429743 429745 . + 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MTQVQLDLAHLVSLYDEKLAPSLSTVREGKPRLRHRLLGMSQEDISRVKVHLEGQIAEVAWSSLECAGNHLDWSTHLH # SIVDLYGDTFEDLWDIINSTTISLAPANVRAEKNVWAENAFRMIESIVRPFVLHSVSPTGTSPDIAWASSVYKECALSHTSAVSAISLTNSEELLRNA # IEGTTRELCRVMTKMWTDGESAKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 Scaffold_11 AUGUSTUS gene 444617 444871 0.95 - . g98 Scaffold_11 AUGUSTUS transcript 444617 444871 0.95 - . g98.t1 Scaffold_11 AUGUSTUS stop_codon 444617 444619 . - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_11 AUGUSTUS CDS 444617 444871 0.95 - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_11 AUGUSTUS start_codon 444869 444871 . - 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MNDHKLNMESNKDSVMLFGLVFHHHNFELVQDRLISPLKHNTFILESLTEGPFCFVEADEELRNEDDDEKKVEDCSES # RERLPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 Scaffold_11 AUGUSTUS gene 446479 447739 0.42 - . g99 Scaffold_11 AUGUSTUS transcript 446479 447739 0.42 - . g99.t1 Scaffold_11 AUGUSTUS stop_codon 446479 446481 . - 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_11 AUGUSTUS CDS 446479 447573 0.42 - 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_11 AUGUSTUS CDS 447662 447739 0.42 - 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_11 AUGUSTUS start_codon 447737 447739 . - 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MVQQATPPEDDRAAAYTSGNFRILRAIDPTSPTLAVPRAKKGRAPSQPEKPREQTERKSSTSDFGIGAPPLTLSLEGL # PKTLVEFPSVEQSTYKSAPVAPVIVVRKKSGQLVKPSLKTSKSAFKSSLNVTPGGFTKSEPATPTVPKAVKFDSRLEHVKLFLAEQRPLAVSRDGSPT # DDTSGTESDFPSFIFGDRKNKVLKMVVTNMPPSLNENADLVLEEMKLGLDEASIVGRVRVRNLSFQKWIAVRFTFDDWQTTSEVTAKHIESPNSEFDV # FGFLIRLSDLIARIEEKTLVLAIRYNVNGREIWDNNFGRNYIAKFSKELPNKPVDSAMVTTTASDKDTISSGSDISDLHSRLEKVVKKMDADNAAIST # PLYTRPTSIPSDFKQIHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 Scaffold_11 AUGUSTUS gene 457277 457720 0.73 + . g100 Scaffold_11 AUGUSTUS transcript 457277 457720 0.73 + . g100.t1 Scaffold_11 AUGUSTUS start_codon 457277 457279 . + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_11 AUGUSTUS CDS 457277 457720 0.73 + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_11 AUGUSTUS stop_codon 457718 457720 . + 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MGITSENIATKYNISRETQDTFAALSSQKAAAAQKAKLFESEILPIRVKQKSPDGGEQYVLVDHDDGVRDGVTQESLG # KLKPAFKKDGSTTAGNASQVTDGAAAILLARRSVAKKLGLPIMGKFVVAHAVGVPQGLWVLDPHMQFLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 Scaffold_11 AUGUSTUS gene 458511 458960 0.59 + . g101 Scaffold_11 AUGUSTUS transcript 458511 458960 0.59 + . g101.t1 Scaffold_11 AUGUSTUS start_codon 458511 458513 . + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_11 AUGUSTUS CDS 458511 458960 0.59 + 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_11 AUGUSTUS stop_codon 458958 458960 . + 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MTHSTINAMCFNVQRFSFVFHNGTTLSLRIQEKKIVSDESQTHDVGLVQGSDSILDRKRAREDQEDQEYEEDPDDGEE # AVPKRKKKKSKKAASSKSNVALSGQDKQSSGSSTKRQRMPEQFRKVRGRLGLLEKLAKEVPLDVILEVINY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 Scaffold_11 AUGUSTUS gene 472779 473762 0.55 - . g102 Scaffold_11 AUGUSTUS transcript 472779 473762 0.55 - . g102.t1 Scaffold_11 AUGUSTUS stop_codon 472779 472781 . - 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_11 AUGUSTUS CDS 472779 473762 0.55 - 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_11 AUGUSTUS start_codon 473760 473762 . - 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MSINENLRMPADDTLITAFIGFHMGKVSSSCIKNWLSGLRAWHELAGAPWPANSRLIRFARAGARIAGTSRKRPQRNP # ITLAHLLALYSALDFSNSFHCAIWAVASTAFWGCRRLGELTIPSKNKFDPKYHVSRSAAFNFAKNPDHSRKSVSFKIPWTKTTKELGASVVCTAQHHS # LQSLCPYHAIERHMAVNALIPQTYSLFAYLDDQGLPQHMVKTTFLSFCDRIWNAAGLEHVHGHSFRIGGAVELLIAGVTPEVVAAIGGWTSLAFLLYW # RRFEDILPTHVLKAYDSSQISRLKHSLDDFQKANGLSNSLIDACIMGIDITEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 Scaffold_11 AUGUSTUS gene 476972 477583 0.98 - . g103 Scaffold_11 AUGUSTUS transcript 476972 477583 0.98 - . g103.t1 Scaffold_11 AUGUSTUS stop_codon 476972 476974 . - 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_11 AUGUSTUS CDS 476972 477583 0.98 - 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_11 AUGUSTUS start_codon 477581 477583 . - 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MQITRQGPLPNDPSIISANRTRKTHKDAETISRISKLPIESKLRINFNKQTRNASRRERVFEGNDDVSDVSSYLSIPE # EEYDKMLKDQDYFDKVKAWLSAHTISWLVDRRKSLRSRPREGDDASAEASGTQPSKRFRSNDDLNEIDPTSPPNVFFDQAFLDLGLYGYHIPLALFTN # KNIEFLNNNSISFHRTKISHIEGKPQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 Scaffold_11 AUGUSTUS gene 481681 482055 1 + . g104 Scaffold_11 AUGUSTUS transcript 481681 482055 1 + . g104.t1 Scaffold_11 AUGUSTUS start_codon 481681 481683 . + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_11 AUGUSTUS CDS 481681 482055 1 + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_11 AUGUSTUS stop_codon 482053 482055 . + 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MRAQNIKPKRVSAAASEAFEALVREAGVETVAGAWKESIPDEKPMVEDFQKYWSEVLANNERSEDLIESISRLVQAHP # VEGEGQDPPRSDATYIGDMKQFRASLQPSEDLGVMVEWGDLPVSKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 Scaffold_11 AUGUSTUS gene 487838 489206 0.51 + . g105 Scaffold_11 AUGUSTUS transcript 487838 489206 0.51 + . g105.t1 Scaffold_11 AUGUSTUS start_codon 487838 487840 . + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_11 AUGUSTUS CDS 487838 488007 0.51 + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_11 AUGUSTUS CDS 488124 488139 0.77 + 1 transcript_id "g105.t1"; gene_id "g105"; Scaffold_11 AUGUSTUS CDS 488247 489206 0.98 + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_11 AUGUSTUS stop_codon 489204 489206 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MFDQHGDEIVKEENLEPVEFKDIRKSTQKLLPETNQRDQASNAEARTPKKLPNGLYDSICSHTKSKGFQSNFKRTPSK # PKPKPRVKTDQTLDDLDKLHKSTNVQQNLKLSQGHRIKLDPSPSGPSIKRKNRPIPNFDIEFASIATVDTDILDLPASLDDDDDLPAPHEILAFSKDK # KRNYSSEDNYSNSELDALIRDIPSDDIVQDAPKTVARVVAENKEPAKKKFKLDTFPEHKVLSSNRKPLFLADNEGSVLDDDEEIEFVEEPTPGHDYDD # FMLDSQYYNAIPATPDLTTSMRSFEDEEDELDTELISHDNFPDPPSSFTSRKPVNSVQEIERTTNFPESFRPKQQGQNQQLNEEEKLQQEYEDEFAIL # EAWIDEHME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 Scaffold_11 AUGUSTUS gene 506423 507390 0.38 + . g106 Scaffold_11 AUGUSTUS transcript 506423 507390 0.38 + . g106.t1 Scaffold_11 AUGUSTUS start_codon 506423 506425 . + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_11 AUGUSTUS CDS 506423 506564 0.39 + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_11 AUGUSTUS CDS 506615 507390 0.78 + 2 transcript_id "g106.t1"; gene_id "g106"; Scaffold_11 AUGUSTUS stop_codon 507388 507390 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MSSTQIQTYTLSEGIKLSFTDSGAPPNAVNYVTVLFLHGGMFNACEYDQFHKIHSHAHSLNLRTVILHRRDYEGSTPY # SPEELEELEQGSVVFWERLSAQIAEFLEIFIIREKIPKLTRRKLPLSQDRLQFQSMRASSESVGGRSGGVAIFGWSAGCSTVLSFLGASHNPMISQES # YKLLEEYIGNCILYGKKYSSPLYTLINFHEDPTYLCFGYTLPSDNRNYIPWADPTVAPEDIPRAVSEWVSSYYDHPCYDPISGSLPVTATIHDLDGTR # TKSDEITISSWTDEELVKGIEGVPAKNEMLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 Scaffold_11 AUGUSTUS gene 509001 510243 0.44 - . g107 Scaffold_11 AUGUSTUS transcript 509001 510243 0.44 - . g107.t1 Scaffold_11 AUGUSTUS stop_codon 509001 509003 . - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_11 AUGUSTUS CDS 509001 509573 0.96 - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_11 AUGUSTUS CDS 509626 510243 0.45 - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_11 AUGUSTUS start_codon 510241 510243 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MESEATFVAPEGVYTVIEEHKPSVLQTHAAATSPLSFPTRVSVITVKYPVKDKDKGGGGQSLAQLLGGNNYSKKDKEK # TKEKEKEKEDGTSLSSNDTPPDEQQDDYTAPASPTAHHSHSSTAPANTIFSHHAQNSSSAGKNKKPMTPVKWSKPRSNMKTTNSTFITRTQHAEGFPR # SLKDRDGDVTFFFYNQVKTVLWVEAGAKAKEPLSRTMFSAYPTCHSINQFTASPEHLDIIIGFHTGDLIWLDPISSRYHRLNKGGCVTSSACTAVRWV # PASASLFLVSHADGTIVVYDRDHEDGTFVPQEPIGTGGIGGDKWDPVDSIFVTMPPWHPAARHGDTDVSDKSDKSIRNPVSHWRVAPKGKAVVDFVFS # PDVKYVGAISEDGCLRVIDALAEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 Scaffold_11 AUGUSTUS gene 516065 516724 0.78 + . g108 Scaffold_11 AUGUSTUS transcript 516065 516724 0.78 + . g108.t1 Scaffold_11 AUGUSTUS start_codon 516065 516067 . + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_11 AUGUSTUS CDS 516065 516724 0.78 + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_11 AUGUSTUS stop_codon 516722 516724 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MQWLVKDAEPHDSLLFHYSGHGGQRRDRDGDEIDYKDECIFPVDSIPLTDASDEQIMIAHRNVMIDDELHICLVSPLP # VGARLTAIFDSCHSGSVLDLPFMYSAASGKLKEGEFIAELDAQKAGEMQKGRGVLAVEKTEKWRIKEKVFEMKDVLEATKDILHETGEKLFVEKDAKG # ALMDLERLNGVKAHVKQVEKLEKRNESLADIVSCFPCSQITGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 Scaffold_11 AUGUSTUS gene 532553 534205 1 + . g109 Scaffold_11 AUGUSTUS transcript 532553 534205 1 + . g109.t1 Scaffold_11 AUGUSTUS start_codon 532553 532555 . + 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_11 AUGUSTUS CDS 532553 534205 1 + 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_11 AUGUSTUS stop_codon 534203 534205 . + 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MSKNSNHYNLRRGPSNYRRNDKEHSTINNDGHRSAGLANSQTTFQNIATSDEESNAGTVTGDRQENYNADSSESEHEE # NPNPWVKVGPRRRAVSLDSARSQNEYQLRPAQFTAKKQREAKKPPVMTIAQGALIREAEKKLSQAERKAIRHRMKIIGQSPAQGDNGTDSSLSDGERP # SNDKGKGVDPKNWGNINLPNNEVDIDQQRAVLENFVALHEAQQQAKVATEPEPLTKKPKKPSKKSKQSKNRAGSEALTDLIESHVRDIVEQRPRKTRT # LSNRLNKSDPAQYVMRPSDMLAPTNHLSKLLTPAKKKKRAVEHRHRKHHSEPSEPSSSSSSSESSSSESETSSDTDSTSSESDSSDGHGSQKRRKHSK # RRRSHRKSTRMILKPDPPEDYDGATDVGSYIKFVTEGTAYVRDGRVPKNRRVLKLSKYLTGKAYQFYLTTVANSPFDWRLKKFFTELYNYCFPLTFRM # DQRKKLKRCFQNGKPVRDHLSELNEFFNTIGMIDEREKVHKLWSSLDKKIQKGLWSEKLNPEFSSYKEIASKNLSSLLKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 Scaffold_11 AUGUSTUS gene 534268 534759 0.52 + . g110 Scaffold_11 AUGUSTUS transcript 534268 534759 0.52 + . g110.t1 Scaffold_11 AUGUSTUS start_codon 534268 534270 . + 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_11 AUGUSTUS CDS 534268 534759 0.52 + 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_11 AUGUSTUS stop_codon 534757 534759 . + 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MNRNNENRNSGPSLSGKKFGNKSHQKNNSTYRRSNGTNSGETGLQGSKPSNPKPQTQHRELSDKEKDEYRATGQCFRC # GGQGHMARQCPDGKTVPSSSNGPPGFASHHIGLDLDVESLQALAETTEEITELGLGMMNIDSADYESYPGDSNESYQTNPGPECS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 Scaffold_11 AUGUSTUS gene 536397 538331 0.88 + . g111 Scaffold_11 AUGUSTUS transcript 536397 538331 0.88 + . g111.t1 Scaffold_11 AUGUSTUS start_codon 536397 536399 . + 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_11 AUGUSTUS CDS 536397 538331 0.88 + 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_11 AUGUSTUS stop_codon 538329 538331 . + 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MPDIEGIKRRVARAKFRSIIDGKDAYEQIRIIPEHVPRSAVTTPDGNMVSLVIQQGDCNAPATYQALMNYLFSEYVGR # FMDVYLDDIVIYSESLEDHIKHVKLIIDILKREKLYLSEEKLNFMPKEFKVLGCIIDDKGIRMDPHKVDAIVRWPTPTNRDLLRGFLGSVGYLADDIA # QVRIPMGHLSAITGDTVLFCWTYIEQRAFENVKQLANGAKDHHRVPLDYSEGAPPVWMITDGSATGVGGAVCQGPSWQNARAAAFYSAKLNSAQQNYP # VHEIEMLAGVETMLRHRDILQGVDFTWITDHKGLEHLVKQKDLSGRQARWLEKISEFNYKVEYVPGIENVLADALSRLYSNDRPGTVRARSEYTYHDV # VDNDTLLSHNITMPVHVDIEAASAIPELFAMTTRNTGKHVETSWEFARRMKNKRFVLHGPREQRKEGGSIPQTANESPKLDRDSVENMPEKTAQNDLP # ESWPEKEKTPEVSTDTSLIAALAASRSKLDLEFVLRNQYKNDTMFKKIIEKPKEFRNFEIVNGLVYLKMQDQKVLCIPMVTVNGRNVRESIIDEAHSL # LAHLGAKKTIDYLRDYVWWKDLVPDVNTYCKTCRTCKRTKPNNARPYGLLNPLPVPSYPWESIALDFVGPLPESKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 Scaffold_11 AUGUSTUS gene 544392 545078 0.78 - . g112 Scaffold_11 AUGUSTUS transcript 544392 545078 0.78 - . g112.t1 Scaffold_11 AUGUSTUS stop_codon 544392 544394 . - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_11 AUGUSTUS CDS 544392 545078 0.78 - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_11 AUGUSTUS start_codon 545076 545078 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MLATAATYALQGEGDPSEAAAVRDLIFKMETRRASKDRTVASNPSTSPLKSNATPNGVDKNPTAKLPSDPDPSKPIPP # RTTVPTKPPKPIIGKLPENYVPPQERTVGVQPKDDQRNYCYRAPIETEAAVERVIQTGMSSMVSVRQDDLLAIAPEYRKKVKDSITSRRIGVDGGLLE # EAIVLEHVLMLDLDLANRMYSVPVTPESLKKLLHRLWRCEGRGRILCSEGIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 Scaffold_11 AUGUSTUS gene 545237 546945 0.2 - . g113 Scaffold_11 AUGUSTUS transcript 545237 546945 0.2 - . g113.t1 Scaffold_11 AUGUSTUS stop_codon 545237 545239 . - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_11 AUGUSTUS CDS 545237 546518 0.46 - 1 transcript_id "g113.t1"; gene_id "g113"; Scaffold_11 AUGUSTUS CDS 546926 546945 0.2 - 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_11 AUGUSTUS start_codon 546943 546945 . - 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MQCVRLGFLDLAPNQKKNTITTSRRTGLRNRLSVEDEALLAQFHQGHIDFDFEELLSPVDGSEATHNHLTRLEEETGS # REFRNHPATPLSSISPTPPSPLTPLSPSTSLRADSPTVDVYPLPKRDERSAPKFDPKNEALLPNFFEEFERTAKAAGIDEDSDRMKRTVLGYLDAKTM # KFWQSLDTFDDDAKTWEEFKTEILDYYPGATGTAEVTTEELVRVVETFQKKNISTTQELAEYHREFAVVAKALRTQGTLSEILIAQHYVRPFPENIQT # RIDTGLYVHYPTKRVGQAYTINEIRKVITFLLSDASAPVSSGSFHSGDRTAIPRSTTKDTIGVKAEPKDSQDSLTQQVAALTQMMQQFVKDNKDRESG # TREPRPDRGCPWDGCTSKVLKDCPDLADWVAKGKVERNDRGFIQLKGGQDLPKKPSTDAVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 Scaffold_11 AUGUSTUS gene 547731 548656 0.57 + . g114 Scaffold_11 AUGUSTUS transcript 547731 548656 0.57 + . g114.t1 Scaffold_11 AUGUSTUS start_codon 547731 547733 . + 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_11 AUGUSTUS CDS 547731 548248 0.57 + 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_11 AUGUSTUS CDS 548296 548656 1 + 1 transcript_id "g114.t1"; gene_id "g114"; Scaffold_11 AUGUSTUS stop_codon 548654 548656 . + 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MSDTQTNPAIYSPPYIQRVREDKILLRSSIGVNYTTTPKEFVQCLETDIKLRKPNASVRRIDIPMAYSYIAGKLNSDA # NIHPQKMAEFNPASGIITVAGPIIDRRMFHHITSGADAPNAVVEALGLANLAQRDQVLYAELLREWAMRPMSDAPVAITPKKRMDGKENPLTRHIPSS # SSTSSSRSHTPAANLPQVTTTQSDTSILDPASQAGTLHSGPQIVSAPQASSSDMTLAITDDFFKSLSIPYENSAPLTAPTPVNFDILFEAPPIEADSL # PGPSSSVKNANEGDVAMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 Scaffold_11 AUGUSTUS gene 550335 551258 0.51 - . g115 Scaffold_11 AUGUSTUS transcript 550335 551258 0.51 - . g115.t1 Scaffold_11 AUGUSTUS stop_codon 550335 550337 . - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_11 AUGUSTUS CDS 550335 550906 1 - 2 transcript_id "g115.t1"; gene_id "g115"; Scaffold_11 AUGUSTUS CDS 551084 551258 0.51 - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_11 AUGUSTUS start_codon 551256 551258 . - 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MFQTSLKCTSEFSSAHEVAQSKQHKSISASDVLKALEMIELGDLVEPLSAELQGMSRRLYRDQVKPDKSGRGSTASAS # VNGVTPASASTNTKTKGKEKVSTSASAVGAGAAPIVPTIGGTETLPPPFTSAPLVHRGEHVGNVVAPGDHDSISAAINPNAKAAEEEDHRMDVDEEHQ # DVGAIEQGDAEMGDVADEHGDQADGSDPGDEAQEEEEEEEEALQDMVAVEEEEIREDAKGVEQRGAASEHKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 Scaffold_11 AUGUSTUS gene 552139 552678 0.42 - . g116 Scaffold_11 AUGUSTUS transcript 552139 552678 0.42 - . g116.t1 Scaffold_11 AUGUSTUS stop_codon 552139 552141 . - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_11 AUGUSTUS CDS 552139 552678 0.42 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_11 AUGUSTUS start_codon 552676 552678 . - 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MESSGISPFTAHPVNPPSPIPARKTEVSLADRAQEYDRALLQSQHAARRRGVGGGSIMGMSVLNPRAGPSASSIFGPS # VMAGAQTAVLGDSQGSVMPEPAPTRPSIDAEVEESRIGAIPDEEVGPDGEVGSRLGGSYVDGARRPSRPVYEEEDEDSLEDGGVLGLLAQIYGRRDGP # KLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 Scaffold_11 AUGUSTUS gene 565781 566923 0.58 + . g117 Scaffold_11 AUGUSTUS transcript 565781 566923 0.58 + . g117.t1 Scaffold_11 AUGUSTUS start_codon 565781 565783 . + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_11 AUGUSTUS CDS 565781 566923 0.58 + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_11 AUGUSTUS stop_codon 566921 566923 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MSSSNAESRKSDSSLNKTASVEPVEVGPVSYNGEEYVQSSGVTRMEAIHRSASGQSGRFTLWAVSVSVVVCAWAYSLD # QSTTSNYDALATSSFSEHSSGLASLNIATGIISSVCQPFIAKISDIFSRPYTYILVLAFYVVGYIIIATSSTISAYVVGAVFVSVGSSGLSLLNNIIV # ADLTTLEWRGFVNSLLSAPFIINTWYAGKIVNALSTGEKWRWGYGMFAIIMPVALCPAIFTLIYLDRKAHREGIINLSSSGAVRRLALAEGRYKEQAR # WTVRTKQILSEIDAFGLILLGFGWSLLLLPFSLKTYAEGGWHNPSLQAMMVVGGVLLIVYVFYEIYVASVPSTPKRILKNKTFIMAVIIDFVYLSKSN # HIWIGPSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 Scaffold_11 AUGUSTUS gene 568109 569611 0.96 - . g118 Scaffold_11 AUGUSTUS transcript 568109 569611 0.96 - . g118.t1 Scaffold_11 AUGUSTUS stop_codon 568109 568111 . - 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_11 AUGUSTUS CDS 568109 569611 0.96 - 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_11 AUGUSTUS start_codon 569609 569611 . - 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MSSPTAEDQTSQQCAATSNPTETVSRDSTGSNQSGGSISNSGESSTKATIATAPGAPSIHTASSSKHLDPSPALPLVN # PRKQKSTGILNLRRSPSATRQRSGSFSGNIPKPDSMPPLPLKKELEQPPKSILTPSSSSSSLSHSTSTSLSSALSRSPSIQFAPLPQLAPRKRKSSVP # LGIAARSAMMQRRRQVMYGTSAAATFENPQDAADSKPAVEGGGMWTPSEAEAHLARQMRAKEKERERLLKKQDKEMAKEAAKSALKDRHGHDDEVEND # DPLVAFGRLVKGAWRKVGKKDSKSRGNRKADLQTRTQSDFEVNSTATTKNPQEPLPPADPIELSDHIEVNKADMVNSGGLVEYDSDTPTEEDDHNNDD # DVDDFDANIDSNEVDVSMIVPLRAGSPPPLHVPSTSHSHSETSSIAESNDSAGSDSTMTSPPATNPPSPNTLIANTHTRTSSDPSTLERTPSKNPEDL # VATSTVKRSERSAHRLPSLELTPLSPFLVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 Scaffold_11 AUGUSTUS gene 570201 571612 0.96 - . g119 Scaffold_11 AUGUSTUS transcript 570201 571612 0.96 - . g119.t1 Scaffold_11 AUGUSTUS stop_codon 570201 570203 . - 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_11 AUGUSTUS CDS 570201 571074 1 - 1 transcript_id "g119.t1"; gene_id "g119"; Scaffold_11 AUGUSTUS CDS 571149 571612 0.96 - 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_11 AUGUSTUS start_codon 571610 571612 . - 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MINEDDLDWEETSSGRMYSYKYGYGAMDGWAFVQKAKEWKNVGPQAWYHTHSVQLENGAFNASGNFSGGALIPASKAG # IKSSLDITADMLSHSNLDQNRLEHIQVRVWIQHAKRGDVEVEIVSPHGVKSVLGAKRDNDANKDGYPGWIFMSVKHWGENPVGTWTIRVSDQSHSNAQ # SVGSFIGWSMVLWGTALDATKARLYEFPTYEKDSDRWIFPPVEDNNPDDGSEVPSTTRLPTRPTDHLPEDHGTAEGEASKPAFGGGSSNSSSPTSTPT # ADEGYFADLSNLSSNQKWFGGAIAIVVLFGLSAAVYFWQRRRAIKRKMAYESLAGNDEVPMTSMMESSALVGGGAGGGRGNSTASGRVPRSGRTRELY # DAFGDVSDSDEDDEDANEETRLRRSDQGDVERVGRNEVGFHSGFLDDEDAVSPMGSATRLTSGTRPVEGAYRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 Scaffold_11 AUGUSTUS gene 572422 572859 0.85 - . g120 Scaffold_11 AUGUSTUS transcript 572422 572859 0.85 - . g120.t1 Scaffold_11 AUGUSTUS stop_codon 572422 572424 . - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_11 AUGUSTUS CDS 572422 572859 0.85 - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_11 AUGUSTUS start_codon 572857 572859 . - 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MLGVQVIEPAGELEGHWLVRADEMLPELGERSIEERDFVLDTFERLKARARADGLQRRTLDIVARQFASSVKSLERQV # PRQRVKRAPIDIRQDVDSTARVVASRLGIQDPLFPDQWHLINDDFPQHMMNVTGVWEELGLTGKGHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 Scaffold_11 AUGUSTUS gene 579401 580326 0.76 - . g121 Scaffold_11 AUGUSTUS transcript 579401 580326 0.76 - . g121.t1 Scaffold_11 AUGUSTUS stop_codon 579401 579403 . - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_11 AUGUSTUS CDS 579401 579792 0.97 - 2 transcript_id "g121.t1"; gene_id "g121"; Scaffold_11 AUGUSTUS CDS 579843 580326 0.76 - 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_11 AUGUSTUS start_codon 580324 580326 . - 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MKRKTQESNADGSRKRLKTTSPQSHSSGAELFDFPEHQRYIASILHDQDVDGKPGYIAGKVFMKYPESEQNIHFIITT # DDSEIGSKRLRVEVIFGKKCSKLLRRRDINFPLSSVILLSLRGCSADSGNSSHGVTGKLKFADKVLLKILSPGLDDVVVDLWDSNPLIPSRSADSDWF # STPREHPVEGSAVAAETKKISRRDRRLLRAKVHLEKVNDTNKIESDVVSIKAPKDLATASEPVTPKHVPLNPVPAQETKAPLDKVDGPLGLKAGCRSE # KVGFSFAAMNNHLKFHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 Scaffold_11 AUGUSTUS gene 581577 582672 0.4 + . g122 Scaffold_11 AUGUSTUS transcript 581577 582672 0.4 + . g122.t1 Scaffold_11 AUGUSTUS start_codon 581577 581579 . + 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_11 AUGUSTUS CDS 581577 581993 0.4 + 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_11 AUGUSTUS CDS 582049 582672 0.99 + 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_11 AUGUSTUS stop_codon 582670 582672 . + 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MIRRITTETDVSGVHFCTLNLEKSVQRVLESLRWIGYSPQIVPNKLIEVSLLTLNLLGLLTLYFKEPTTENLPSGTIT # PVSAANVATLGLYNMPPTETEVGSGELNKADSWDDFPNGRWGDSKSPAYGVQGPWGNNDAINQVTISHWGNPQSLDDLTALFLKYLHSDIDTTPFSSD # PILDESKLILPHLRKLTERGWWTVGSQPAVDGIDSSDPVVGWGPRNGYVFQKSFVEFFCTEKDVNMIEKKVAEKGDGWVHYYAANSKVRLLCFVYPWY # DVECCLEGDCRTNVPDDGRNAVTWGVFSGQELIQTTIIERQSFLAWKVSSLCLEVPSFLLTQSRRRKHSQSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 Scaffold_11 AUGUSTUS gene 603747 604343 0.92 + . g123 Scaffold_11 AUGUSTUS transcript 603747 604343 0.92 + . g123.t1 Scaffold_11 AUGUSTUS start_codon 603747 603749 . + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_11 AUGUSTUS CDS 603747 603915 0.92 + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_11 AUGUSTUS CDS 603997 604343 0.99 + 2 transcript_id "g123.t1"; gene_id "g123"; Scaffold_11 AUGUSTUS stop_codon 604341 604343 . + 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MFCIHDSFYVVESSQHSYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTP # PAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPPLVLRTPSSLLQRCCSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 Scaffold_11 AUGUSTUS gene 604680 605686 0.54 - . g124 Scaffold_11 AUGUSTUS transcript 604680 605686 0.54 - . g124.t1 Scaffold_11 AUGUSTUS stop_codon 604680 604682 . - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_11 AUGUSTUS CDS 604680 604991 0.78 - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_11 AUGUSTUS CDS 605141 605686 0.66 - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_11 AUGUSTUS start_codon 605684 605686 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQSQLVVEKEKHMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYK # DVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMLIPSNGCKYIIHGRDSLSSWSEARAVKHENARTFLTRDELIGYRAQALSKHNSFI # EKVRRRRTYGRNQTTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTD # SDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 Scaffold_11 AUGUSTUS gene 605747 606657 0.18 - . g125 Scaffold_11 AUGUSTUS transcript 605747 606657 0.18 - . g125.t1 Scaffold_11 AUGUSTUS stop_codon 605747 605749 . - 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_11 AUGUSTUS CDS 605747 606159 0.7 - 2 transcript_id "g125.t1"; gene_id "g125"; Scaffold_11 AUGUSTUS CDS 606253 606283 0.4 - 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_11 AUGUSTUS CDS 606466 606657 0.19 - 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_11 AUGUSTUS start_codon 606655 606657 . - 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIQDCPALRPINFDWDVYLAVDTSYKALKPMQVILKACATH # GPELSRITPGGWHTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKN # ATCEVFNRNLFPTFDEEFVQNNPYPEAHRSSEVID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 Scaffold_11 AUGUSTUS gene 607345 608140 0.12 - . g126 Scaffold_11 AUGUSTUS transcript 607345 608140 0.12 - . g126.t1 Scaffold_11 AUGUSTUS stop_codon 607345 607347 . - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_11 AUGUSTUS CDS 607345 607893 0.41 - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_11 AUGUSTUS CDS 608036 608140 0.19 - 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_11 AUGUSTUS start_codon 608138 608140 . - 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MIIGINLKTLRELRREWFDMKYSKEGLNHFKDLNRQDRPPINLIDETNKQVVNEAIGVEKPINLNTEEVFTKYKPVDK # KVNPIKAMLPDEFRIKRHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVK # VPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGYTNIEC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 Scaffold_11 AUGUSTUS gene 610246 611163 0.35 - . g127 Scaffold_11 AUGUSTUS transcript 610246 611163 0.35 - . g127.t1 Scaffold_11 AUGUSTUS stop_codon 610246 610248 . - 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_11 AUGUSTUS CDS 610246 611163 0.35 - 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_11 AUGUSTUS start_codon 611161 611163 . - 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESF # LRDLSIDDERRNIAIVANQMWHMKTIVIIQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 Scaffold_11 AUGUSTUS gene 611248 611490 0.46 - . g128 Scaffold_11 AUGUSTUS transcript 611248 611490 0.46 - . g128.t1 Scaffold_11 AUGUSTUS stop_codon 611248 611250 . - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_11 AUGUSTUS CDS 611248 611490 0.46 - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_11 AUGUSTUS start_codon 611488 611490 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIRT # IR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 Scaffold_11 AUGUSTUS gene 612083 612568 0.98 - . g129 Scaffold_11 AUGUSTUS transcript 612083 612568 0.98 - . g129.t1 Scaffold_11 AUGUSTUS stop_codon 612083 612085 . - 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_11 AUGUSTUS CDS 612083 612568 0.98 - 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_11 AUGUSTUS start_codon 612566 612568 . - 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPLRLTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 Scaffold_11 AUGUSTUS gene 616324 617217 1 - . g130 Scaffold_11 AUGUSTUS transcript 616324 617217 1 - . g130.t1 Scaffold_11 AUGUSTUS stop_codon 616324 616326 . - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_11 AUGUSTUS CDS 616324 617217 1 - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_11 AUGUSTUS start_codon 617215 617217 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MRGCAQGIHKEEETYCCEHGNESTFDSRGKYERVLKEEMKCVLTSLKPKFKELKKKIEAFEKNEAKARKETVAREKKV # LQAATRERKAAQQRELGRGRSCGRGHGHIRKGRGQEQTQAMADQSEDSSSETSSLNHTDHAPENDNSTDSDSDSEAALTSSIPTAPLRQAHPRPKPRP # ISPSDSNSHSLHPVDSHESFDVPITGDPGTDNAKDSQTSFGEEDNGVSKEDEAVETVIRLILGHKWIGRGLKFMVEWVDDNVTWESLSNIKDCVALDD # YLVHHGLAEPSKLSKKIYLLMRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 Scaffold_11 AUGUSTUS gene 617991 618896 0.37 - . g131 Scaffold_11 AUGUSTUS transcript 617991 618896 0.37 - . g131.t1 Scaffold_11 AUGUSTUS stop_codon 617991 617993 . - 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_11 AUGUSTUS CDS 617991 618896 0.37 - 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_11 AUGUSTUS start_codon 618894 618896 . - 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MYFLSMRIANIIVLGPTAPEFYSPSFRMSNTLDDPDMPELVSSDSDDEGVEGATPPQSKEEAIRSAMQAIESSNGELS # VRKAAKAYGVHPATLQRRVHGGKSRSEAHAHQQNLSPAQEDLLVEWIKVQGQRGVPLLLPMVSAYASDIAEKSMGDNWICRFRTCHPDLALKFTTSLE # ESRACSLTPAAVSTFYDILADTVAQYEIPPENIYNMDKKGVQLGIGQRTAVLVDRNQKSFSSIESGNHNLVTIIETVCADRSTLHPSVIFEGQRRDIH # WGDVNPANARYVSVILCVMDCAHLHFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 Scaffold_11 AUGUSTUS gene 622628 623534 0.57 + . g132 Scaffold_11 AUGUSTUS transcript 622628 623534 0.57 + . g132.t1 Scaffold_11 AUGUSTUS start_codon 622628 622630 . + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_11 AUGUSTUS CDS 622628 622656 0.75 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_11 AUGUSTUS CDS 623267 623534 0.76 + 1 transcript_id "g132.t1"; gene_id "g132"; Scaffold_11 AUGUSTUS stop_codon 623532 623534 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MFLRRLLPFCSSPRSARSKDSDNELLSGFPLVDAVPRASSSTKVPVGKKEPKSKTTVKVVEASKASKPTPTAMVYKRV # RLPPSSGKSHQLLSKVNPDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 Scaffold_11 AUGUSTUS gene 624290 624948 0.27 + . g133 Scaffold_11 AUGUSTUS transcript 624290 624948 0.27 + . g133.t1 Scaffold_11 AUGUSTUS start_codon 624290 624292 . + 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_11 AUGUSTUS CDS 624290 624338 0.27 + 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_11 AUGUSTUS CDS 624401 624948 0.98 + 2 transcript_id "g133.t1"; gene_id "g133"; Scaffold_11 AUGUSTUS stop_codon 624946 624948 . + 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MDALNALHTASSSSTHNLANSLRRAADLNDQLKQLGSLFDTTKELFLRSILDLQNAGTDPIVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLP # AIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 Scaffold_11 AUGUSTUS gene 626078 627522 0.35 + . g134 Scaffold_11 AUGUSTUS transcript 626078 627522 0.35 + . g134.t1 Scaffold_11 AUGUSTUS start_codon 626078 626080 . + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_11 AUGUSTUS CDS 626078 626245 0.62 + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_11 AUGUSTUS CDS 626302 626328 0.39 + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_11 AUGUSTUS CDS 626884 627019 0.9 + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_11 AUGUSTUS CDS 627101 627522 1 + 2 transcript_id "g134.t1"; gene_id "g134"; Scaffold_11 AUGUSTUS stop_codon 627520 627522 . + 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRSHNRRSTPYPTTGSN # KGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEIRINANLVKTYATRARIAKVIA # DEACSIFEKSPRFSDSSVLTQVSLLLRVFPPGSEDTRRTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 Scaffold_11 AUGUSTUS gene 628079 629019 0.85 - . g135 Scaffold_11 AUGUSTUS transcript 628079 629019 0.85 - . g135.t1 Scaffold_11 AUGUSTUS stop_codon 628079 628081 . - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_11 AUGUSTUS CDS 628079 628365 0.88 - 2 transcript_id "g135.t1"; gene_id "g135"; Scaffold_11 AUGUSTUS CDS 628493 628895 0.87 - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_11 AUGUSTUS CDS 629014 629019 0.95 - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_11 AUGUSTUS start_codon 629017 629019 . - 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MITDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGRLESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRR # VDANKVAELRRLNENIDIQLKIGISNQVNWSRLEILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 Scaffold_11 AUGUSTUS gene 629085 630053 1 - . g136 Scaffold_11 AUGUSTUS transcript 629085 630053 1 - . g136.t1 Scaffold_11 AUGUSTUS stop_codon 629085 629087 . - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_11 AUGUSTUS CDS 629085 630053 1 - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_11 AUGUSTUS start_codon 630051 630053 . - 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIM # GDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLD # ELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 Scaffold_11 AUGUSTUS gene 630167 633558 0.22 - . g137 Scaffold_11 AUGUSTUS transcript 630167 633558 0.22 - . g137.t1 Scaffold_11 AUGUSTUS stop_codon 630167 630169 . - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_11 AUGUSTUS CDS 630167 632068 0.59 - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_11 AUGUSTUS CDS 632350 633558 0.31 - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_11 AUGUSTUS start_codon 633556 633558 . - 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDDQAEEIIDCYLNQKTIGDKQVFCVWRDGVL # GEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRY # EILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVF # TKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFK # NEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFS # GRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENP # GIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPHVVIRLRFEHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 Scaffold_11 AUGUSTUS gene 633588 634136 0.63 - . g138 Scaffold_11 AUGUSTUS transcript 633588 634136 0.63 - . g138.t1 Scaffold_11 AUGUSTUS stop_codon 633588 633590 . - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_11 AUGUSTUS CDS 633588 634136 0.63 - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_11 AUGUSTUS start_codon 634134 634136 . - 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 Scaffold_11 AUGUSTUS gene 634220 636332 0.92 - . g139 Scaffold_11 AUGUSTUS transcript 634220 636332 0.92 - . g139.t1 Scaffold_11 AUGUSTUS stop_codon 634220 634222 . - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_11 AUGUSTUS CDS 634220 635555 0.95 - 1 transcript_id "g139.t1"; gene_id "g139"; Scaffold_11 AUGUSTUS CDS 636316 636332 0.96 - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_11 AUGUSTUS start_codon 636330 636332 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MRLYILKTAYFEEFGESRSLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 Scaffold_11 AUGUSTUS gene 637261 638456 0.49 - . g140 Scaffold_11 AUGUSTUS transcript 637261 638456 0.49 - . g140.t1 Scaffold_11 AUGUSTUS stop_codon 637261 637263 . - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_11 AUGUSTUS CDS 637261 638180 0.83 - 2 transcript_id "g140.t1"; gene_id "g140"; Scaffold_11 AUGUSTUS CDS 638279 638456 0.49 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_11 AUGUSTUS start_codon 638454 638456 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MSEGIFAGGKISKEGVTVDPTKLTAIVEWKQPEDALNLASFVGLTGHFRDLIRNYARIKVDPRPHQSIHRAEKSAGLG # TSPESAQWDGSNFIITTDGCKEGFAAVVAQRFEVVQPNGTTTYKTHPVGFASKRTSTSEQNYKPFLLKFAALKFGLDKFSDMIWGFPIEIEMDCQVLR # DVIANDKLNAAHSRWRDGVLAHHIVDVRHIPGKLNVVADGLSRMWEGQDRVIGDGSEWTVSEDWEAVTGLVNNVFGVSIAEGMMEDGEVTDWETLSGR # FRGEPVFMEVIDALRVLESSADDKAKQRAKHKAARYMIAGNRLWKVGGNGGIRERARVECITRREAVKLAKVQHGEAGHWGRDAVTRLNFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 Scaffold_11 AUGUSTUS gene 638627 640810 0.39 - . g141 Scaffold_11 AUGUSTUS transcript 638627 640810 0.39 - . g141.t1 Scaffold_11 AUGUSTUS stop_codon 638627 638629 . - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_11 AUGUSTUS CDS 638627 640810 0.39 - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_11 AUGUSTUS start_codon 640808 640810 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MDIGLKDFGGRRTAVEAMVDDGAMVAAMDTKVYEGLRDEIGGWTMTQRKFRMANGTVVPGEASWAGRISIKGVEVDGE # FEVFDSGGSWKFLFGKPLLERFSAVHDYGKESIVLHGKRGNWKEVFNSGLGAVVTPNTTPMLEGKGQQDIPRPNAIAQAVLEESTEPAGGVTVKALTP # LDREVNELHLVQQSFVTNNAGQYEPKVIPSRRCHTPQIEEVPDEELTRPRDEPGIYETAPDWGADADSKEGWLTEAELEEWLRETRQLRREEAIKRQE # ALEHRQKERRKVWEEEEERREADWVAWLRQQRAEPGLCKWFFWRNRLRNPSPPRRLRVDSLGGGNAPPSREVSTDAGGAVECHIDHVSAECQAHDVTN # PMAETTSGVSSREEVGDNTKNMPDGSRVDSVGGFDVPPSREVLTEDSSADPQHADQSQTVPICILHNEEDYPSQSEMGLDFFPDALDQSEDINLFTRN # NGERGAFRPERVREILRKVKIGLNLSVDQRLRVEQLLSAYADCFALSVGEVRPVKYAVHRLNIPEGTTFPKKVRQKALTPPQREYLHAKIDELLEAGV # IERCNPEDVKCVLPLTLAQKAHEGAGLTVEELMHKLNDECMAAGLPASFDLPTRPVQPPEPTERTGSPKPAKWRICQNFMAVNKVTEIAPMPQGNIRS # KQQSLSGHTYICLFDFASGFYACEVERKSRPYTAFYVEGKGYFWCAKLPLVSPVLHQLLRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 Scaffold_11 AUGUSTUS gene 647463 649631 0.23 - . g142 Scaffold_11 AUGUSTUS transcript 647463 649631 0.23 - . g142.t1 Scaffold_11 AUGUSTUS stop_codon 647463 647465 . - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_11 AUGUSTUS CDS 647463 648020 0.91 - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_11 AUGUSTUS CDS 648501 649631 0.37 - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_11 AUGUSTUS start_codon 649629 649631 . - 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MPGSALRLLNQGRAQGLFTPSTSAAHGSSRFTQVSPAPGQSHSPFSPASATPPPLNTLKRPRSDPESTTPAPPVDVPM # SDGTRPPSTGAQTNGAAASDDGPSPAKRPRKESAPPEPISSFTRAATAITPSNPRPASASSGGAPPATPTTTSEREHIPRFATKPTYPRNLDLSAPLK # DTRRAAVIASILYQGDDPVAVLNLLREIASFPTNGIHGGTTPTPSNNGRTIDVDTILDEQGHNALHLASSLSRVSTVQALLSHGADVHRGNHLGETPL # MRTMLSTHSYNAQSLPTILQTGLHQSILTVDTSRKSVLHHIVSLAGVKGRAMVARYYLDQIFYWIAKEMMGDFGCIVDLQDEHGDTALNIAARVGSRT # LVRTLAIEEEDTWDWTGRSGTTSFDKSDKPDKEISKEAQRPGRPMEEDIDADASADDDDEAMPLDASTNPMSTLSTATSPAFRYRGAASSLTGKSRSS # EQFDIPQNPSSDADQDLPIPMGNDVETLIKLRRMKMWHVRVEELMEERLKSLRGMSAEKEYMCRKIVALCTGMAIDKVEDVSRVCFVSYHHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 Scaffold_11 AUGUSTUS gene 651952 652389 0.39 + . g143 Scaffold_11 AUGUSTUS transcript 651952 652389 0.39 + . g143.t1 Scaffold_11 AUGUSTUS start_codon 651952 651954 . + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_11 AUGUSTUS CDS 651952 652389 0.39 + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_11 AUGUSTUS stop_codon 652387 652389 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MRSLKSLYTIPGHTSNISDVRFFQANDLFFKKPQTPEPTSPDVNGDTGANESAVSSRSDTPKLDKPEAGSPTFTPEEE # WSYRSGLFFASGGYDGYVKLWSADDWQLLRTLTTDSGKVMSVDISSNGHMIAAGTYNRNYQLYSDLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 Scaffold_11 AUGUSTUS gene 652626 653679 0.25 - . g144 Scaffold_11 AUGUSTUS transcript 652626 653679 0.25 - . g144.t1 Scaffold_11 AUGUSTUS stop_codon 652626 652628 . - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_11 AUGUSTUS CDS 652626 653062 0.71 - 2 transcript_id "g144.t1"; gene_id "g144"; Scaffold_11 AUGUSTUS CDS 653134 653264 0.63 - 1 transcript_id "g144.t1"; gene_id "g144"; Scaffold_11 AUGUSTUS CDS 653372 653679 0.25 - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_11 AUGUSTUS start_codon 653677 653679 . - 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MFFSAASLSGAFSGILAFGIINMDGIGNRPGWAWIFILEGLFTVLFGASSYFTLPRSVDTAWFFNAEEKSYVNAKLLE # DNTQKDEERFTWKEVVEATKLPQVCFSPSIIQGLGFTAARAQLMSVPPFAVGFVVAMISSWLSDRYRCQAVVRFNLPDFDIGLGSKSHHVQYGSLFFS # IPGTYTTAPTLSAWSSNNAAPQTRRATAIAIGFIMTNSGGILATWLLGSLSPAPEYTSATITLLVFSAVMALFGGVNLFYLWNQNKKKAEIRRTLTRE # HETSGLGDRSAWFIYNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 Scaffold_11 AUGUSTUS gene 655235 655792 0.9 - . g145 Scaffold_11 AUGUSTUS transcript 655235 655792 0.9 - . g145.t1 Scaffold_11 AUGUSTUS stop_codon 655235 655237 . - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_11 AUGUSTUS CDS 655235 655792 0.9 - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_11 AUGUSTUS start_codon 655790 655792 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MHFSNFTWDLALAKLYTNCLMSTLNARSALVNRSQTSTSGMFINVVDSASQKDNRRQVIVIEYTQLGGDYKVILDFQQ # YYCEVRQQSTWCTWYNFIKDPQCLMQRVYSLYSLRVAPATYTSLKAPRQSRQPMIKTLPITKIILSWKLLLTRSVAWNRLVSISTDYYPKFVERTEDN # IESGNVSAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 Scaffold_11 AUGUSTUS gene 657847 658431 0.32 + . g146 Scaffold_11 AUGUSTUS transcript 657847 658431 0.32 + . g146.t1 Scaffold_11 AUGUSTUS start_codon 657847 657849 . + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_11 AUGUSTUS CDS 657847 658137 0.63 + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_11 AUGUSTUS CDS 658230 658268 0.4 + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_11 AUGUSTUS CDS 658345 658431 0.65 + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_11 AUGUSTUS stop_codon 658429 658431 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MTSSVKNEARKMDQEWSEVQATYSEKLLFGSSGLGGIVGINNSSQVRSTTLKSYSMAKLVLNEFFHEGYELAHRQLER # CGSCAQRVTLRGTVMNEAMFHPLPGRPDSVRDIEIETLLADRHQVFGIHEIVHRAYRNSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 Scaffold_11 AUGUSTUS gene 660630 661950 0.61 - . g147 Scaffold_11 AUGUSTUS transcript 660630 661950 0.61 - . g147.t1 Scaffold_11 AUGUSTUS stop_codon 660630 660632 . - 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_11 AUGUSTUS CDS 660630 661225 0.97 - 2 transcript_id "g147.t1"; gene_id "g147"; Scaffold_11 AUGUSTUS CDS 661395 661950 0.61 - 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_11 AUGUSTUS start_codon 661948 661950 . - 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MPKPHIAHALRARPTILFFHGNAATRAFKVRIQHYTAFSSRLNANVLAVDYRGFADSSGSPSEEGLVRDARAAYEWLI # NSGAKGEDIIIMGHSLGTGVGARLAAQLSKEELAYRGIVLLSPFSSMTELVKTYSVLGALPLVRPLTMIPYAFSKSPFLSFTTGHVLNQWVILDFITW # ALIHKFDTLKNDWDIPYTHSEVLFNAFLEPLLPNVDIPSDPVSTTKEDWSAFTAQIAARKTQRENLVTTTRLPNFGVMEEFVDRGGESLVNGEPVRGA # EYWAAGRPGGGAPWDREVIFVKMLEGNHDNVGIQEGLQDIIGKKFGLLSHTRPNLPLPIMSAPPVSAPASIAPESDVGGSDLSEAGGWSPLPSASERG # EWTGEITKVID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 Scaffold_11 AUGUSTUS gene 668992 669318 0.61 + . g148 Scaffold_11 AUGUSTUS transcript 668992 669318 0.61 + . g148.t1 Scaffold_11 AUGUSTUS start_codon 668992 668994 . + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_11 AUGUSTUS CDS 668992 669318 0.61 + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_11 AUGUSTUS stop_codon 669316 669318 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MALTDKEWEIAIEEKISQLKNTDNNGTVAAHTGGTQTKFITITHPLDPLFPSTIDHTLLKPDATSAQIDVLCYEAISY # GFKVRLYFASACVHSVCGQSLVMLHERSPH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 Scaffold_11 AUGUSTUS gene 678630 679190 0.57 + . g149 Scaffold_11 AUGUSTUS transcript 678630 679190 0.57 + . g149.t1 Scaffold_11 AUGUSTUS start_codon 678630 678632 . + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_11 AUGUSTUS CDS 678630 679190 0.57 + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_11 AUGUSTUS stop_codon 679188 679190 . + 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MSRGMEAAQSFTSPLAQIYQPLVVDDDLPLASDESLDQVPSVPQGGAPLISYGPTTRRRLSSMQGAHRRNTSDVGLLR # QSNNNLGTPNRHLQHVQQQQQRSQQNFPSMQEVMSGADGVISESPPGQSPSSRGGLDIPTAGQIQEEEGSAGGASQWSERLAKLEERQERIENLLEGI # ARDLRDRGKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 Scaffold_11 AUGUSTUS gene 685975 686415 0.85 + . g150 Scaffold_11 AUGUSTUS transcript 685975 686415 0.85 + . g150.t1 Scaffold_11 AUGUSTUS start_codon 685975 685977 . + 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_11 AUGUSTUS CDS 685975 686415 0.85 + 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_11 AUGUSTUS stop_codon 686413 686415 . + 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MAYPPLFSSTVGHLAASPPSAESLGIEIHFVPPASQAFAGIAQCATCDMAYPPLFSSTVGHLAASPPSTESLGIEIHF # VPPASQAVAGMAQCATCDMAYPPLFLSTVGHLAASPPSAESLGIKIHFVPPASQAVAAIALYVTCDMT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 Scaffold_11 AUGUSTUS gene 691404 692383 0.43 - . g151 Scaffold_11 AUGUSTUS transcript 691404 692383 0.43 - . g151.t1 Scaffold_11 AUGUSTUS stop_codon 691404 691406 . - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_11 AUGUSTUS CDS 691404 692050 0.8 - 2 transcript_id "g151.t1"; gene_id "g151"; Scaffold_11 AUGUSTUS CDS 692245 692383 0.43 - 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_11 AUGUSTUS start_codon 692381 692383 . - 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MFEELLDNAAGSSGLSLDIKKAEVAMSDLIVLVKYSDLTNKDVLSRFRHSILASNNHALAIIHSGPISTSSSSLSSQA # LIPSNSVFSQDTFFPHVFAGSLGTLSTIIQHLILLAEVSLADLEKLEEHLSLIHEMVYREDSLITSAKIELLGQIWTWLGGNRLKLRGHDDCLELLQG # IGRHRNLALAHVVSSLQILRALSNDMEDMRARMMMPEHLRSQIPLEVQVSSIQHSLERLRESKVLAKKREEVSIRKMWLDDKGAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 Scaffold_11 AUGUSTUS gene 694107 694742 0.2 - . g152 Scaffold_11 AUGUSTUS transcript 694107 694742 0.2 - . g152.t1 Scaffold_11 AUGUSTUS stop_codon 694107 694109 . - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_11 AUGUSTUS CDS 694107 694742 0.2 - 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_11 AUGUSTUS start_codon 694740 694742 . - 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MATISKAQLSSPSFGSEVVAYVFPDSTVEKVVLRTFAEAMQTLSTVVERLILLAEVELANLERLEEHLSVLYEIVVRE # NFTISSTKAELFGDIWTWLGGNRSILKGYDEHLTLLSGVADYRKRALIQVISSLQALRALSNDMEGLREQMSKPTLSGQTIPVEIHTKSIELGVRRLK # SSRASAKEKGDAARQSFLEDGTTQNIFASLEEYTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 Scaffold_11 AUGUSTUS gene 694951 695553 0.21 - . g153 Scaffold_11 AUGUSTUS transcript 694951 695553 0.21 - . g153.t1 Scaffold_11 AUGUSTUS stop_codon 694951 694953 . - 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_11 AUGUSTUS CDS 694951 695553 0.21 - 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_11 AUGUSTUS start_codon 695551 695553 . - 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MSTNISCESDTDTEQPHLYKRSPKEMERKGIHTQDTEQNILGNSPIPVDVSESLPQSEHGFTKEIHPLVMETAMGQVS # AFLYDILMVSMSLWREPLCLTVLLHLALPIVTPLFSTSLCGIPWVHDLSVCRDPTLDATFPQWADFPRLMDAQITTFEQLLDTSVGSSALSLDIKKAE # MAVLDLAVLVRSSTLTSRDVLGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 Scaffold_11 AUGUSTUS gene 698158 699816 0.09 - . g154 Scaffold_11 AUGUSTUS transcript 698158 699816 0.09 - . g154.t1 Scaffold_11 AUGUSTUS stop_codon 698158 698160 . - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_11 AUGUSTUS CDS 698158 699147 0.82 - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_11 AUGUSTUS CDS 699306 699331 0.76 - 2 transcript_id "g154.t1"; gene_id "g154"; Scaffold_11 AUGUSTUS CDS 699519 699816 0.1 - 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_11 AUGUSTUS start_codon 699814 699816 . - 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MEQIAPKLPIICAPEHEVRMQLTQADQLPDKSGSLDTSSTMISSLDSLPPVGYPSTALGKRRAEDPSIGEPIGPSESS # YDVQQMNGASGFLKSQIRARTDNSSPPFTFSNDRSLWADGSDAEDEDITEALPESKLHRRLPPSNRSRSPRLIAPTGSIPPQISHHPKRTLNEDGGDA # DDEEENERPTQGPREVHADAGQALSEVPASLNHQKVDIGATMNVDTHSIRPAATQRVPPRVGVEEVTDEEFNRPSTACGPSIGSLRSPAHTPTHNVPR # PPSQSRDNTDSSTPHSAQCPTKYQKVVETVDASAGAAPQKKQSTPLHLNSEKAHPKESNRQSSATLPGPEVNAQTRHPPQTYVEVDDDDEAVSSLTES # DIGTQTPAPEHSATNANERFLRDEIIRLIETEVKTRNMVSLFVLVFSHEKLKFSPTYSNLISGNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 Scaffold_11 AUGUSTUS gene 706997 707338 0.81 - . g155 Scaffold_11 AUGUSTUS transcript 706997 707338 0.81 - . g155.t1 Scaffold_11 AUGUSTUS stop_codon 706997 706999 . - 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_11 AUGUSTUS CDS 706997 707338 0.81 - 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_11 AUGUSTUS start_codon 707336 707338 . - 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MWFKYSLRDADPYNVVRYRSLVIMVGVILEMDLDSRPELIHHRLDHSGYTAENHTNTALALRPVASSGETTVQQDSMS # TTSPILPSAFMSAHTARYLARQAVIERELQAKFFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 Scaffold_11 AUGUSTUS gene 708869 709504 0.85 + . g156 Scaffold_11 AUGUSTUS transcript 708869 709504 0.85 + . g156.t1 Scaffold_11 AUGUSTUS start_codon 708869 708871 . + 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_11 AUGUSTUS CDS 708869 709504 0.85 + 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_11 AUGUSTUS stop_codon 709502 709504 . + 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MATISKAQLSSPSFGSEVVAYVFPDSTVEKVVLRTFAEAMQTLSTVVERLILLAEVELANLERLEEHLSVLYEIVVRE # NFTISSTKAELFGDIWTWLGGNRSILKGYDEHLTLLSGVADYRKRALIQVISSLQALRALSNDMEGLREQMSKPTLSGQTIPVEIHTKSIELGVRRLK # SSRASAKEKGDAARQSFLEDGTTQNIFASLEEYTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 Scaffold_11 AUGUSTUS gene 714159 715611 0.61 + . g157 Scaffold_11 AUGUSTUS transcript 714159 715611 0.61 + . g157.t1 Scaffold_11 AUGUSTUS start_codon 714159 714161 . + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_11 AUGUSTUS CDS 714159 714260 0.92 + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_11 AUGUSTUS CDS 714765 714803 0.66 + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_11 AUGUSTUS CDS 714853 715611 0.91 + 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_11 AUGUSTUS stop_codon 715609 715611 . + 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MNEEAHVEDLDSTKPSIHISQGMQEHTVDSFLTVVTEDTNPCISPIKMGILPQSQTSMNEVADATFVSVSMNDRKAST # VSRVSSQEDGALGYSCIDLRVFPYDTSNDTLTARANVYDLGSSHNLSLEMTEKASPVLLPKLPIVSTYSQNAHYLVNARNIEPRKPEIYALSLLLLLL # FFTAFCSAYTWSNLSVADFEGATDEAAQLSRNEEPLLEPGLLTSHTLNDYRYRQWQSDIRMLQDITGRENWIEDFKFENEGLQSAAMYSYNGLLSSRT # LDEYRCRQQRSLHVPEKEEQKSSTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 Scaffold_11 AUGUSTUS gene 723095 724165 0.88 + . g158 Scaffold_11 AUGUSTUS transcript 723095 724165 0.88 + . g158.t1 Scaffold_11 AUGUSTUS start_codon 723095 723097 . + 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_11 AUGUSTUS CDS 723095 723101 0.98 + 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_11 AUGUSTUS CDS 723222 724165 0.88 + 2 transcript_id "g158.t1"; gene_id "g158"; Scaffold_11 AUGUSTUS stop_codon 724163 724165 . + 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MFASPPVTESLRTKIGTEFYEPLVSQVVAGIALCATCDVAYPALCLITFGRLPASPPVTESLGTKIGTEFYEPLVSQV # VAGIALCATCDVAYSALCLITFGCLPASPPVTESLGTKIGTEFYEPLVSQVVTGIALCATCDVAYPALCLITFGRLPASPPVTESLRTRIGTEFYEPI # VSQVVAGIALCATCDVAYPALCLITFGRLPASPPVTESLRTRIGTEFYEPIVSQVVAGIALCATCDVAYPALLVIMFGCRHTPMLITLWSHFSTLSQD # LFDVEQLFDVLLISLMITYFLKLSGVFHVLHCRPHLKPLGPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 Scaffold_11 AUGUSTUS gene 736907 737503 0.73 - . g159 Scaffold_11 AUGUSTUS transcript 736907 737503 0.73 - . g159.t1 Scaffold_11 AUGUSTUS stop_codon 736907 736909 . - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_11 AUGUSTUS CDS 736907 737503 0.73 - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_11 AUGUSTUS start_codon 737501 737503 . - 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MHRMVANCAPSPDFYPPTPASAAVPMTTTIDSLSDRLSAISIPTAFASPELDIPLPPMESQSAERESADPDSQLLVVE # QLRSQLSQIQNRWEPTATQFNAEFTGTFQELSIDSVDSLLSPSAVNSPLRGYVEWLDASLAYVRLLPRFESAGGRNLVKILQRMLVAEMAIVMQKLEA # EWARQQRAAQGHRQIISVSSKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 Scaffold_11 AUGUSTUS gene 738796 740061 0.27 + . g160 Scaffold_11 AUGUSTUS transcript 738796 740061 0.27 + . g160.t1 Scaffold_11 AUGUSTUS start_codon 738796 738798 . + 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_11 AUGUSTUS CDS 738796 739485 0.27 + 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_11 AUGUSTUS CDS 739537 740061 0.99 + 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_11 AUGUSTUS stop_codon 740059 740061 . + 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MAEYSWGQAFPSLYGPEDLSQVSYDNLSSVTTRPAAPLHSSAVVPSLAGPSRCSTSSKVTRKDPCMLILDLIQGSCIT # GFDLDPKNFRSKPSSNHRKDRNKFMEVTSPLLPNSIPDWVVASEHVGKGFDQNQKARSGVPRGYFLPEPALFANHSSDVSRQAYFSTYLKVREVILYR # LRTLGASTCLKSSGEWRKLLGLELHGLKIGTKCATTRKKLVDELQQGLEMSNSLTLDLSDLQNVVPRWQNKEVAGRISDDICRQVLHEIFTVSFKAEL # LLADQYLYELQSEGFDGDGKEFDDLDASSREDRKIKVMAFMPGFTTGVIGFGSGDQSERQRSIYALYKLMCSWTRVPSPSSDTHDYLVKLEPSKYPSR # STLDHAERLVAYHYIISFADFFKRAPVLPHAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 Scaffold_11 AUGUSTUS gene 741686 742877 0.11 - . g161 Scaffold_11 AUGUSTUS transcript 741686 742877 0.11 - . g161.t1 Scaffold_11 AUGUSTUS stop_codon 741686 741688 . - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_11 AUGUSTUS CDS 741686 742552 0.92 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_11 AUGUSTUS CDS 742711 742736 0.52 - 2 transcript_id "g161.t1"; gene_id "g161"; Scaffold_11 AUGUSTUS CDS 742784 742877 0.11 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_11 AUGUSTUS start_codon 742875 742877 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MTKLISNHLPQLLVNESAENISSKAPLPKIVHNSSPPFTFSNDSLWADGSDAEDEDITEALPESKLHRRLPPSNRSRS # PRLIAPTGSIPPQISHHPKRTLNEDGGDADDEEENERPTQGPREVHADAGQALSEVPASLNHQKVDIGATMNVDTHSIRPAATQRVPPRVGVEEVTDE # EFNRPSTACGPSIGSLRSPAHTPTHNVPRPPSQSRDNTDSSTPHSAQCPTKYQKVVETVDASAGAAPQKKQSTPLHLNSEKAHPKESNRQSSATLPGP # EVNAQTRHPPQTYVEVDDDDEAVSSLTESDIGTQTPAPEHPPLMQMNVFCATRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 Scaffold_11 AUGUSTUS gene 742904 744165 0.17 - . g162 Scaffold_11 AUGUSTUS transcript 742904 744165 0.17 - . g162.t1 Scaffold_11 AUGUSTUS stop_codon 742904 742906 . - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_11 AUGUSTUS CDS 742904 743658 0.25 - 2 transcript_id "g162.t1"; gene_id "g162"; Scaffold_11 AUGUSTUS CDS 744009 744165 0.34 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_11 AUGUSTUS start_codon 744163 744165 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MQSDDRADATDTLTSVVRKRKRSATLEAVVTSDHAFEEQLEPADVNSGAGPAPAARNRKNDKLSKPLQTRPAELPLQD # VALFAPPSVSSSRHLLEDVTLPLPTTISLPLGSIPAVPSPQDVITHTPTTELFSPQYVAHSPPSSPPTSPPPPPPPSPPPPPPPSPPAESSSAAVNHS # VASYSEPRSALLELDYVSDDEDMEQIAPKLPIICAPEHEVRMQLTQADQLPDKSGSLDTSSTMISSLDSLPPVGYPSTALGKRRAEDPSIGEPIGPSE # SSYDVQQMNGASGFLKSQIRARTGAKRAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 Scaffold_11 AUGUSTUS gene 759100 759768 0.26 - . g163 Scaffold_11 AUGUSTUS transcript 759100 759768 0.26 - . g163.t1 Scaffold_11 AUGUSTUS stop_codon 759100 759102 . - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_11 AUGUSTUS CDS 759100 759768 0.26 - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_11 AUGUSTUS start_codon 759766 759768 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MATISKAQLSSPSFGSEVVAYVFPDSTVEKVVLRTFAEAMQTLSTVVERLILLAEVELANLERLEEHLSVLYEIVVRE # NFTISSTKAELFGDIWTWLGGNRSILKGYDEHLTLLSGVADYRKRALIQVISSLQALRALSNDMEGLREQMSKPTLSGQTIPVEIHTKSIELGVRRLK # SSRALAKEKGDAARQSFLEDERRRTFSRVWKDIRVETLLLTFNTKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 Scaffold_11 AUGUSTUS gene 763736 764182 0.97 - . g164 Scaffold_11 AUGUSTUS transcript 763736 764182 0.97 - . g164.t1 Scaffold_11 AUGUSTUS stop_codon 763736 763738 . - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_11 AUGUSTUS CDS 763736 764182 0.97 - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_11 AUGUSTUS start_codon 764180 764182 . - 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MPRTSSRRGGDRNDHQAGADGWTVTDNAPPTKVGDLSKFGQISKGAPITFGPISVFAGKKESKRESLSRTNFNANMFQ # MLQNVEAAEVATKTGGRPSRKPSVDLGSGGAPEPAPQRKRLNFLPRTKPVGQDSAPRSAISMLCSTVLAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 Scaffold_11 AUGUSTUS gene 769901 771076 0.9 - . g165 Scaffold_11 AUGUSTUS transcript 769901 771076 0.9 - . g165.t1 Scaffold_11 AUGUSTUS stop_codon 769901 769903 . - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_11 AUGUSTUS CDS 769901 771076 0.9 - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_11 AUGUSTUS start_codon 771074 771076 . - 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MFDHSSSAYDHLNHLYDDNPNNEHISSFDYGLNSAEPIQIPITTVSGNSLHALFGDSPGGRSGGRLLTPFEETLSFSG # QHGHLSRHNSHTSSSSHHTHLSHHEDDAESSVDVDVGSDNSSDSVELMSSTTMTTLSSAQRSTEFVYSGAGSIGGVKKKLSGIKLTLNPNKSKSLSQR # RSTTPRPSFTGGGGRVAGGGLSVSSKPSASSRPYNRPTPRANARATPRPSARQTPRAGVRNTHNNNNTTPRSSVAASRAASSRPALTVRTSSSGVSTR # SSLPSATAPPSSLVSSISSSFSASGSGSGSGSGSVGFGFLDSAPVSAFKVEDEGQGQGQNSHVGNNLTNSTSSSCFNYNCRCHSCPSTSIIKYHPADH # ASDDDDHYVHPWCTCRSES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 Scaffold_11 AUGUSTUS gene 778415 778639 0.64 + . g166 Scaffold_11 AUGUSTUS transcript 778415 778639 0.64 + . g166.t1 Scaffold_11 AUGUSTUS start_codon 778415 778417 . + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_11 AUGUSTUS CDS 778415 778639 0.64 + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_11 AUGUSTUS stop_codon 778637 778639 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MPATAWDAGGTKWISIPSDSADGGEVLRSCTPCNRAKATGCLSAEDEWDSSEVINNTAVTPLVPESESRERGAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 Scaffold_11 AUGUSTUS gene 780727 781309 0.74 - . g167 Scaffold_11 AUGUSTUS transcript 780727 781309 0.74 - . g167.t1 Scaffold_11 AUGUSTUS stop_codon 780727 780729 . - 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_11 AUGUSTUS CDS 780727 781105 0.85 - 1 transcript_id "g167.t1"; gene_id "g167"; Scaffold_11 AUGUSTUS CDS 781179 781309 0.74 - 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_11 AUGUSTUS start_codon 781307 781309 . - 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEKISWSFQGHQSTWYFVLRAQAPRLSSPNSPGFPR # LTAGAGYAESFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPASTPIPSQPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 Scaffold_11 AUGUSTUS gene 781663 782385 0.55 - . g168 Scaffold_11 AUGUSTUS transcript 781663 782385 0.55 - . g168.t1 Scaffold_11 AUGUSTUS stop_codon 781663 781665 . - 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_11 AUGUSTUS CDS 781663 782385 0.55 - 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_11 AUGUSTUS start_codon 782383 782385 . - 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFVLSLLTNNSLRLFELPSGRPGFTSLDYHGYRSPTPSII # LALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRN # NPPSSALRLVETLPVPVRPWDSISMDFIEQLPMSNGLQLSSSLWIDLPNKLYLFQLTTPLLPNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 Scaffold_11 AUGUSTUS gene 782815 784269 0.62 - . g169 Scaffold_11 AUGUSTUS transcript 782815 784269 0.62 - . g169.t1 Scaffold_11 AUGUSTUS stop_codon 782815 782817 . - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_11 AUGUSTUS CDS 782815 784269 0.62 - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_11 AUGUSTUS start_codon 784267 784269 . - 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSASTRCCKGRCS # ATGTFAVGFTDNSGDPSWGLTSLSLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAAR # AADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFV # PKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIF # SDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFWVLQTS # IVVLFIIIVISLCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 Scaffold_11 AUGUSTUS gene 785311 786274 0.89 - . g170 Scaffold_11 AUGUSTUS transcript 785311 786274 0.89 - . g170.t1 Scaffold_11 AUGUSTUS stop_codon 785311 785313 . - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_11 AUGUSTUS CDS 785311 785947 0.95 - 1 transcript_id "g170.t1"; gene_id "g170"; Scaffold_11 AUGUSTUS CDS 786063 786274 0.94 - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_11 AUGUSTUS start_codon 786272 786274 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTFHSPPYGE # TTPTSAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGDLVTPVDLVVLVVPAVPAVLVDLVDLVPQSPDIPNEQRAMLE # LLSGSRVPLRPLVPSSPLGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPA # WTSSFKPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 Scaffold_11 AUGUSTUS gene 802170 802955 0.95 + . g171 Scaffold_11 AUGUSTUS transcript 802170 802955 0.95 + . g171.t1 Scaffold_11 AUGUSTUS start_codon 802170 802172 . + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_11 AUGUSTUS CDS 802170 802955 0.95 + 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_11 AUGUSTUS stop_codon 802953 802955 . + 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MPPKTQAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRHGQPPVVAPARGWSTTRIESPILQAIARCTRKQPQRRAASESHRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPG # DPSGPGGPGGPRSPISPDIPNEQHSMLELLSGFKGSIETLVPFSPLSAVPLTALNLRARSRSQRYSTVWTPKTEDVLCQSCPGLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 Scaffold_11 AUGUSTUS gene 806567 806992 0.64 - . g172 Scaffold_11 AUGUSTUS transcript 806567 806992 0.64 - . g172.t1 Scaffold_11 AUGUSTUS stop_codon 806567 806569 . - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_11 AUGUSTUS CDS 806567 806992 0.64 - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_11 AUGUSTUS start_codon 806990 806992 . - 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MDDSPESNEQIDTDELDELEADPLAAESEDELEDFDKRRSITQNLTDRVRKDLGAKRTHANYTIVVFFGEIHKFLQLT # NGMSIIPLFRKRLKSDERMLKDRGFCVQRGKPRRKQQMQIPKITQTMRRIATVLQRKRVFRLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 Scaffold_11 AUGUSTUS gene 808429 809919 0.74 + . g173 Scaffold_11 AUGUSTUS transcript 808429 809919 0.74 + . g173.t1 Scaffold_11 AUGUSTUS start_codon 808429 808431 . + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_11 AUGUSTUS CDS 808429 809919 0.74 + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_11 AUGUSTUS stop_codon 809917 809919 . + 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MFSQNSIPTTKISPVNLCLFDGSLSSKPITDMANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWAS # RNITFRNTSHFDSPQTSVPSAINPVVAKVAVPLPELSPSVSPTIQDTPSGDSPRSCSCSHSRMLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPQVDI # ALVSAAVFNRACKDAGMEPILLRAIHSEVAARAADHSSTTPTVPPLHHSIPEEYAEFADIFDEIAADSLPEHRPYDLKIDLEEEALPPLGRIYPLSEK # ELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNHIAKKDRYPLLLILDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTT # FRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIIYLDNILIYSDTPEEHQEHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYILSPDR # LTMSKEKVQTILEWPVPRCHKAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 Scaffold_11 AUGUSTUS gene 811473 812357 0.61 + . g174 Scaffold_11 AUGUSTUS transcript 811473 812357 0.61 + . g174.t1 Scaffold_11 AUGUSTUS start_codon 811473 811475 . + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_11 AUGUSTUS CDS 811473 811944 0.63 + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_11 AUGUSTUS CDS 812029 812357 0.65 + 2 transcript_id "g174.t1"; gene_id "g174"; Scaffold_11 AUGUSTUS stop_codon 812355 812357 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTYDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADRQTSVSIRLSNSTSGSTAPTNKMMVAFTSDHRVRLYTTLPMLPLVLLHSSLTKDTTPTSPFGRAQSRYKEQADRKRISHPEF # PIGSEVFVLAKHIRSTRPTEKFSENIFGPFKVISRPGTLSYKLKLPDYLRRIPPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 Scaffold_11 AUGUSTUS gene 815692 816132 1 - . g175 Scaffold_11 AUGUSTUS transcript 815692 816132 1 - . g175.t1 Scaffold_11 AUGUSTUS stop_codon 815692 815694 . - 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_11 AUGUSTUS CDS 815692 816132 1 - 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_11 AUGUSTUS start_codon 816130 816132 . - 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MTGTATAANSTSFPLASTLSSSTLGTTTCPTRASGRSRGTVINYAEVDDEGDDDDGDGDSDDAKKDGDHIPDAGALDD # DATDGDFLGGNGSGRRVGRPSKQQQQQGRGDTSMDLDQSYLGQVPPVRFIKSRGFFIERCDGARQSNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 Scaffold_11 AUGUSTUS gene 822357 823528 0.42 + . g176 Scaffold_11 AUGUSTUS transcript 822357 823528 0.42 + . g176.t1 Scaffold_11 AUGUSTUS start_codon 822357 822359 . + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_11 AUGUSTUS CDS 822357 823031 0.42 + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_11 AUGUSTUS CDS 823100 823528 0.63 + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_11 AUGUSTUS stop_codon 823526 823528 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MSTPAPTTSADELMTQLIKQVANLATAMEERSSSKSSMNKPKVFKGKDSNEARRFRAQFQNWASEQPDLASSQVKLIK # SALGFFTEGTGVWATPHLLHFSAENPPFEGSWKKFLKEFGQRFESIDPGMEARNAIQSLKQGKGQTVAEFAQKFQDIGSRTEMSDIDLKEHFYSALLP # EIQQNLITVNIGQGAAWTLKEAITQAISVDVYLHDPTLTGQNTGPICSYAFLAACVDDALAVVPKVMSSRIAHTKKPPAITVDVEDTWKQSARTSLWD # LDETEAGASRYQPLDPLHSPCFPNESVQIATSTPPLAPTTVPATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFNRVFKEGTRFGCTESTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 Scaffold_11 AUGUSTUS gene 832540 833025 0.52 - . g177 Scaffold_11 AUGUSTUS transcript 832540 833025 0.52 - . g177.t1 Scaffold_11 AUGUSTUS stop_codon 832540 832542 . - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_11 AUGUSTUS CDS 832540 833025 0.52 - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_11 AUGUSTUS start_codon 833023 833025 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MGAKEGNPQGEQTVPILATPSVDRQHIHEWEPECKELSLGEYVRPEGGVYTLEDSGGGKGGFNPPPRVPPPHFSSQLR # DQRMTSESRGTGSKRTGRKERGRGTTSASPPPPPSGGPGDSNSEGSDEGEHNQSSRNXGGSSLSCEVCPSSLLLQPRQCVTAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 Scaffold_11 AUGUSTUS gene 842267 842759 0.29 - . g178 Scaffold_11 AUGUSTUS transcript 842267 842759 0.29 - . g178.t1 Scaffold_11 AUGUSTUS stop_codon 842267 842269 . - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_11 AUGUSTUS CDS 842267 842519 0.78 - 1 transcript_id "g178.t1"; gene_id "g178"; Scaffold_11 AUGUSTUS CDS 842593 842759 0.29 - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_11 AUGUSTUS start_codon 842757 842759 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MERLYRKESAVADGLEGEDWEFIEDDTTTTPKPSTTTSVSEISQSLPPFLPNPNAPAHILDIIAGNAVASTRPSDLSF # QRNSLLPTVVEEEPKVLELEGEGTADWMMAMVDEDFVEEYALAMEMSEIEALEPRNLAEAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 Scaffold_11 AUGUSTUS gene 843384 844274 0.63 - . g179 Scaffold_11 AUGUSTUS transcript 843384 844274 0.63 - . g179.t1 Scaffold_11 AUGUSTUS stop_codon 843384 843386 . - 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_11 AUGUSTUS CDS 843384 844274 0.63 - 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_11 AUGUSTUS start_codon 844272 844274 . - 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MPSLESVTDSTLCKYESCSEEDAESGGVGEDWFSNVGGDDGDVEDLSDADWSDVYSFVGKESDDGSVRSSEDDLPVFQ # AINITHETANLSEPLTLTLAELYDSGCTRHISPYHNDLSSITSIPLKHFRAANKQHFSADKRGELSVDLPNGVDDPSKLHLTEVLYSPEVRYTLISIG # KLDEAGFEVTFSDGKCRFMHPVGRRWGRFQGWEWAVPWCMRLTLHTLWKQSHWISFTVEWGILRPRQRGSWWRRDLSPGEVGYVVGDEVSANLVSMPR # LLVSLWQRFARETVLPNLRGIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 Scaffold_11 AUGUSTUS gene 849853 850521 0.86 - . g180 Scaffold_11 AUGUSTUS transcript 849853 850521 0.86 - . g180.t1 Scaffold_11 AUGUSTUS stop_codon 849853 849855 . - 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_11 AUGUSTUS CDS 849853 850521 0.86 - 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_11 AUGUSTUS start_codon 850519 850521 . - 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTWKGAPWIWDNDC # QEAFENLKIAFTSAPILAHWEPNRPIIVETNASDYTIAAILSIQTVDGEIHPLAFLSRTLHTAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDIV # TNHKNLEYFSTTKILTRRQVRWSEYLHQFNMVIASDWGNSARNLIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 Scaffold_11 AUGUSTUS gene 851047 851394 0.95 - . g181 Scaffold_11 AUGUSTUS transcript 851047 851394 0.95 - . g181.t1 Scaffold_11 AUGUSTUS stop_codon 851047 851049 . - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_11 AUGUSTUS CDS 851047 851394 0.95 - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_11 AUGUSTUS start_codon 851392 851394 . - 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAADRSSTAPTVPPLPHSIPAEYAEFADVFD # KIAADALPEHRPYDLKIDLVEGASLPLVEFILCLKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 Scaffold_11 AUGUSTUS gene 853379 854224 0.38 - . g182 Scaffold_11 AUGUSTUS transcript 853379 854224 0.38 - . g182.t1 Scaffold_11 AUGUSTUS stop_codon 853379 853381 . - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_11 AUGUSTUS CDS 853379 854224 0.38 - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_11 AUGUSTUS start_codon 854222 854224 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK # HPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 Scaffold_11 AUGUSTUS gene 855219 856765 0.19 - . g183 Scaffold_11 AUGUSTUS transcript 855219 856765 0.19 - . g183.t1 Scaffold_11 AUGUSTUS stop_codon 855219 855221 . - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_11 AUGUSTUS CDS 855219 856591 0.72 - 2 transcript_id "g183.t1"; gene_id "g183"; Scaffold_11 AUGUSTUS CDS 856705 856765 0.22 - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_11 AUGUSTUS start_codon 856763 856765 . - 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MDGFPDHKLRRRGYYFLDSPVASTTDSPIQELLNEGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKA # GILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLE # ENLRKGTSFPRVTISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGVRYFTKFDVRWATIMCGLRRGMNGKAHLQQLGACSSLR # LCSFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAA # VRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQ # DDGQWHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 Scaffold_11 AUGUSTUS gene 856862 858285 0.19 - . g184 Scaffold_11 AUGUSTUS transcript 856862 858285 0.19 - . g184.t1 Scaffold_11 AUGUSTUS stop_codon 856862 856864 . - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_11 AUGUSTUS CDS 856862 857924 0.31 - 1 transcript_id "g184.t1"; gene_id "g184"; Scaffold_11 AUGUSTUS CDS 858044 858285 0.49 - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_11 AUGUSTUS start_codon 858283 858285 . - 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LINQQFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPT # MTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQP # RRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANAMSPSVLWFSAGFLKRVPAPAAPRVPHNQFTMFATSSYDL # LPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGYRPVFKPRLCHQKSRNLRTPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 Scaffold_11 AUGUSTUS gene 859591 859923 0.82 - . g185 Scaffold_11 AUGUSTUS transcript 859591 859923 0.82 - . g185.t1 Scaffold_11 AUGUSTUS stop_codon 859591 859593 . - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_11 AUGUSTUS CDS 859591 859923 0.82 - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_11 AUGUSTUS start_codon 859921 859923 . - 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPCHHNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQH # VQVLTLAVDNPPWSLWLGAGLLLELSLPSSKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 Scaffold_11 AUGUSTUS gene 861837 862854 0.19 - . g186 Scaffold_11 AUGUSTUS transcript 861837 862854 0.19 - . g186.t1 Scaffold_11 AUGUSTUS stop_codon 861837 861839 . - 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_11 AUGUSTUS CDS 861837 862198 0.71 - 2 transcript_id "g186.t1"; gene_id "g186"; Scaffold_11 AUGUSTUS CDS 862281 862597 0.39 - 1 transcript_id "g186.t1"; gene_id "g186"; Scaffold_11 AUGUSTUS CDS 862673 862854 0.53 - 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_11 AUGUSTUS start_codon 862852 862854 . - 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MITNSDAVRLFLAPMTPEVRRGALETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGNRGHINLPFAADVPKTDR # NYLQALKPKVENEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMIMGMFLVQVDR # PFVNECPHLLEFTKRGWMMPEGGDSKHYKLRDNARMPRDDPNIPCYKKIEQMAKDLGWDHAESYFANREDDKDDKVMDQQMNPNVNLAVWMTRIEELS # DRTWEFGSTPRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 Scaffold_11 AUGUSTUS gene 868710 869344 0.32 - . g187 Scaffold_11 AUGUSTUS transcript 868710 869344 0.32 - . g187.t1 Scaffold_11 AUGUSTUS stop_codon 868710 868712 . - 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_11 AUGUSTUS CDS 868710 868965 0.71 - 1 transcript_id "g187.t1"; gene_id "g187"; Scaffold_11 AUGUSTUS CDS 869058 869344 0.32 - 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_11 AUGUSTUS start_codon 869342 869344 . - 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MKASSPADDWLNKAPENALRKWPDFKVVFLDRFPAPEATSATPQEFDCQLIAMRITDDELLCELGRPVTSILSLQWSY # FELQSLLALIKPLRPSLVKAEIEENLEQDKHIRELERVAAAAEQVAYRPRAQLPPMPETPSKSLGWSLARVNLGPVLSRPMSNRPVASLTEEQRAILL # ANST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 Scaffold_11 AUGUSTUS gene 870237 870578 0.98 + . g188 Scaffold_11 AUGUSTUS transcript 870237 870578 0.98 + . g188.t1 Scaffold_11 AUGUSTUS start_codon 870237 870239 . + 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_11 AUGUSTUS CDS 870237 870578 0.98 + 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_11 AUGUSTUS stop_codon 870576 870578 . + 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MSDPAQPAPTPPTANNLMALLIKQVANLAAAMEEHSSAKLSMNKPKVFKGKDSTEACCFMAQFQNWALEHPDLTKSQA # KLIKLALGFFTESAGDWATPHLLHFSPENPPFRGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 Scaffold_11 AUGUSTUS gene 872000 872617 0.71 + . g189 Scaffold_11 AUGUSTUS transcript 872000 872617 0.71 + . g189.t1 Scaffold_11 AUGUSTUS start_codon 872000 872002 . + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_11 AUGUSTUS CDS 872000 872617 0.71 + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_11 AUGUSTUS stop_codon 872615 872617 . + 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MLFGNSPNIPRLPDEKQLIGEDNWRPFKQEVLFAVQLKGLTRYLNGMIARPNKYPGPIYPPTQLMTPLFSPTPYPEEW # EARDRLVAGAIVLNITHPVGLGIDETKRASEMWQELIRQFEKRDEQRIHLANTNLHQEKYDPETTMEDHKKKMRNLLKKVHDLGGTATDAQFCRIMIS # SMPSGWKQDVWSVPGVSSTEAFTSPYFVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 Scaffold_11 AUGUSTUS gene 873575 874372 0.93 + . g190 Scaffold_11 AUGUSTUS transcript 873575 874372 0.93 + . g190.t1 Scaffold_11 AUGUSTUS start_codon 873575 873577 . + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_11 AUGUSTUS CDS 873575 873970 0.93 + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_11 AUGUSTUS CDS 874052 874372 0.93 + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_11 AUGUSTUS stop_codon 874370 874372 . + 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MTTSRTQTTTTNPSTAGPSRSQPAPPADPVVPEEEGLEDEDEEEIIRRAQARVERVRARKAAEEKAARAAAARERAAQ # EARERAIWARQQEKEVVEQKRLLAEVATARSQRGTSPSEMSASPRRPVVKIRRAPVGGDPDNGDDDDNNKEDRAPCGWCKTKKLPCQMQAGKRSSIIC # KPCHDAKVRCSYLGCPTTSKQREGGSGERIAVMESQMAQSLADLQALWEADSKTHTNTSASC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 Scaffold_11 AUGUSTUS gene 881140 881789 0.69 - . g191 Scaffold_11 AUGUSTUS transcript 881140 881789 0.69 - . g191.t1 Scaffold_11 AUGUSTUS stop_codon 881140 881142 . - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_11 AUGUSTUS CDS 881140 881469 0.94 - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_11 AUGUSTUS CDS 881622 881789 0.69 - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_11 AUGUSTUS start_codon 881787 881789 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYPSGSSAPFTPKPKPFSGGKPNN # NGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 Scaffold_11 AUGUSTUS gene 882343 882814 0.53 - . g192 Scaffold_11 AUGUSTUS transcript 882343 882814 0.53 - . g192.t1 Scaffold_11 AUGUSTUS stop_codon 882343 882345 . - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_11 AUGUSTUS CDS 882343 882491 0.55 - 2 transcript_id "g192.t1"; gene_id "g192"; Scaffold_11 AUGUSTUS CDS 882562 882814 0.56 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_11 AUGUSTUS start_codon 882812 882814 . - 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTSTLPEAMEEEQQFEYSTLYTGDGQPV # QVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 Scaffold_11 AUGUSTUS gene 894320 894811 0.66 - . g193 Scaffold_11 AUGUSTUS transcript 894320 894811 0.66 - . g193.t1 Scaffold_11 AUGUSTUS stop_codon 894320 894322 . - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_11 AUGUSTUS CDS 894320 894811 0.66 - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_11 AUGUSTUS start_codon 894809 894811 . - 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MDTQQQAFDTLQEAFISAPILALWTPDRPTRIKVDASGFATGSALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREM # LAIIEALKDCRNFLEGLPQPFDIITDHSNLEFWHTAQDLTRRQARWALYLSQFDFHMIHRPGRINTQADALSRMAAHQVLDNEDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 Scaffold_11 AUGUSTUS gene 908886 909260 0.95 + . g194 Scaffold_11 AUGUSTUS transcript 908886 909260 0.95 + . g194.t1 Scaffold_11 AUGUSTUS start_codon 908886 908888 . + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_11 AUGUSTUS CDS 908886 909260 0.95 + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_11 AUGUSTUS stop_codon 909258 909260 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MLQSECATLEEKVRGAEESEKNTRTKLSTEIERLKEENADLNATKSELFSELEDMQTDIEERMQMFASSQEKMNKEME # KFEQAKNQLDELEADNQQLLNDLDLFKEHHEEYKVGYIPVSILYIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 Scaffold_11 AUGUSTUS gene 912749 913966 0.18 + . g195 Scaffold_11 AUGUSTUS transcript 912749 913966 0.18 + . g195.t1 Scaffold_11 AUGUSTUS start_codon 912749 912751 . + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_11 AUGUSTUS CDS 912749 913243 0.19 + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_11 AUGUSTUS CDS 913324 913458 0.34 + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_11 AUGUSTUS CDS 913517 913966 0.39 + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_11 AUGUSTUS stop_codon 913964 913966 . + 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MIKVSRERNDNASVEFWSYGLNVMEILGDQGQSDEEDITLDVEVEGVSVKQSAKRVLRLFWRHPYIEDLIRIMEKAPA # LEKLLFHRAGAKRILRIRSDKLSHRPPKSGYPREFFREDYLSALLPHEVADLNLGDGESYTFELTSGMKLDTSAPTAANMQNSHWNRIEWSRLLKDRV # YRILLEVVKAKAGNQDPIYETRKQASRKRRCCQYVFEQCVQISTTMMTVARGFGDDEEYHCWSEILYSLDRLGIDGMSDNEEILDSQGQQGIAVYEPD # YRNPGFSAVYDRVDEVPQTAKHLFSQVGRKRLPRIRSSEKVKCPPPAGLPRSYYRSGYLERMENSLLTLTVDVVSEELDRPIPRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 Scaffold_11 AUGUSTUS gene 921123 922807 0.26 - . g196 Scaffold_11 AUGUSTUS transcript 921123 922807 0.26 - . g196.t1 Scaffold_11 AUGUSTUS stop_codon 921123 921125 . - 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_11 AUGUSTUS CDS 921123 921452 0.75 - 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_11 AUGUSTUS CDS 921592 921931 0.73 - 1 transcript_id "g196.t1"; gene_id "g196"; Scaffold_11 AUGUSTUS CDS 922155 922485 0.66 - 2 transcript_id "g196.t1"; gene_id "g196"; Scaffold_11 AUGUSTUS CDS 922672 922807 0.5 - 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_11 AUGUSTUS start_codon 922805 922807 . - 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFAIARRTGKQPQRRAASESPRDPPPHFDLDTGDH # DDQDPPVDPDDPGADNNMTIWMTIPAVYRVVSLVTPVDLVVLVVPAVPAVLVDLVDLVLPISPDIPNEQRAMLELLSGGSAKEWFVPDILDPDLDSLP # AWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEPSGSS # APFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVV # EEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 Scaffold_11 AUGUSTUS gene 923871 924647 0.76 - . g197 Scaffold_11 AUGUSTUS transcript 923871 924647 0.76 - . g197.t1 Scaffold_11 AUGUSTUS stop_codon 923871 923873 . - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_11 AUGUSTUS CDS 923871 924647 0.76 - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_11 AUGUSTUS start_codon 924645 924647 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MFATSLYDSHLSCTISSIWELNSTSPHFRIHVRLRGRNHSITTAAMVDCGATALFLNQDFATRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFACLALTVDNQERWMDFLITNLGGEDVILGLPWLRKVNPEIDWEKGQLSVKPPRVAIEEVPDEEISYSHLATANTESPIPELPN # LEPPAESPHIEVPLEATLEESESAVLEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCATGFTYGAIGYNTTNLEQLNYLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 Scaffold_11 AUGUSTUS gene 931361 931945 0.48 + . g198 Scaffold_11 AUGUSTUS transcript 931361 931945 0.48 + . g198.t1 Scaffold_11 AUGUSTUS start_codon 931361 931363 . + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_11 AUGUSTUS CDS 931361 931945 0.48 + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_11 AUGUSTUS stop_codon 931943 931945 . + 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MYTIPRGMPSTYLYSSTYTMTPAFQYSPGGAAAVTNPATIASIAYMGERAATPASPSTESSASGSVRSGGSGGSVRSM # RSTGSAGSGGSVYVPSSSSLYGPGVPGVSSSRASVGDLRTNELVRSAELVRLMSLDMLWGSAGGGDAAGGSLSGSPQRAVPLPPLHSLKRSHPYRRHP # EDDKTLRLLDPRPVSSVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 Scaffold_11 AUGUSTUS gene 932549 933706 0.79 - . g199 Scaffold_11 AUGUSTUS transcript 932549 933706 0.79 - . g199.t1 Scaffold_11 AUGUSTUS stop_codon 932549 932551 . - 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_11 AUGUSTUS CDS 932549 933706 0.79 - 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_11 AUGUSTUS start_codon 933704 933706 . - 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MALSIPFHTVDVFTQTRFLGNPLAIVLLHHPSSSSDSSDPKPRPPVLTQHQKQLIAREFNLSETVFIHITQSNYDDPS # VPFAIDIFTTTEELPFAGHPTIGAGWFLAGHERWRDRKEFRLDTRAGVILVSRVTKIPGPLTSPDDRARASAELVKLRIPIDFKTHPPYGSTLLSTLK # SSLCQPQLEPGDYVNGVDGSEPVASIVKGMSFVLMQLRDEGSLSRIQPLVGINDAVPGSLIPDEHLGDWKGFSSLYVFVVSRSTESNSIFDNIYDDDP # VNLIHPIIRLRTRMFQSGGFEDPATGSAASTLCGWVASQQQNAVGRWRFEVIQGVEMGRESRIGVVVDVEREANVDGDGVVRKIELVGGAVKIMEGMV # DIPSTQGQSNLSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 Scaffold_11 AUGUSTUS gene 937446 939404 0.1 - . g200 Scaffold_11 AUGUSTUS transcript 937446 939404 0.1 - . g200.t1 Scaffold_11 AUGUSTUS stop_codon 937446 937448 . - 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_11 AUGUSTUS CDS 937446 938098 0.75 - 2 transcript_id "g200.t1"; gene_id "g200"; Scaffold_11 AUGUSTUS CDS 938217 938271 0.31 - 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_11 AUGUSTUS CDS 938352 939404 0.23 - 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_11 AUGUSTUS start_codon 939402 939404 . - 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MQTALQTYLAAQNGVSNFHAISDGWKPIDFAGTGTSLNGDEAANSIFYIADQIQGATTTISYSGMVISFIQDVNVAMS # LNTSGASNPEVTKAMQASSKACYAGMGATTTTVSKEYAEQHSGQAPNITSPEFLQFAAQDPEYTQASAICQSATNTYQSALSRAVGDDFYIFSGALNN # IEQLTASVTLIDGLNMEVSSETAVAGKGAGKYKPYYAIPTLNGTMSAWQSNSNGFSSSPAFTWSSSSTTGSSTNTTTSGGGGIGFIWEDFSGSGAGSS # SSSKTTSNVSSVGMSVSFGQISMFGVEYGLWNTPEVAEALQNPPDAITKKGTPVFQKYYGSASKPGPLASWKDQALVNSPPLMKHPFPSICSLCRIGF # TQTNFFPNQGPQDDSNWPSLLGNNTDATSATSDTDSSSNSSGNSTTSDGNSIGDSSSDTDSSSTSTGDSTSDTDSSSSTDSSSSSTDASSVDNASTTK # NNGTSLDSSSSADSSSSSDTSSSTDASPTTSTSNSPSDSPPSSSKDPGSTGSKGDSTSSTSSTSDTASANPTKSSSGSGDDNESTTSGAKQSTKTTSV # TQSSGTQATPVVKASKAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 Scaffold_11 AUGUSTUS gene 940823 941953 0.98 - . g201 Scaffold_11 AUGUSTUS transcript 940823 941953 0.98 - . g201.t1 Scaffold_11 AUGUSTUS stop_codon 940823 940825 . - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_11 AUGUSTUS CDS 940823 941953 0.98 - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_11 AUGUSTUS start_codon 941951 941953 . - 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MADQAEFAFIKTFVNTISTQPITYDDEYQQPPENSLKKIPVLTGVAVPEPPARKVEETAAGSSSSKRFKGNIAVSCAN # SAHTATLNLLIKSTKPPITYTLSGIHPTDTISAIKQHLSTTNPTAPAPDAQRLLLKGKALADNKLLKEYPVKDGDTINLMVKPGVEWNPAASAADPPV # VTLNTPAPKPAFGTSLSSSLLSGGSPAAPSGHTGKRHQRIPSVVLSPSPSNEDELGAQPRKDVLLTLDTTDLALGTGSTPKETLGAYHLTISSPGFWD # KLIQFLRYAHIFGTVSIVIDGPLSKNGVHERIRRTHCIRRFSCCEQRIFECERHSKDTGSCRGYGDGWYMTERRKERLLFTALRSHRALYIIKSKSVI # ALSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 Scaffold_11 AUGUSTUS gene 946299 947123 0.98 + . g202 Scaffold_11 AUGUSTUS transcript 946299 947123 0.98 + . g202.t1 Scaffold_11 AUGUSTUS start_codon 946299 946301 . + 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_11 AUGUSTUS CDS 946299 947123 0.98 + 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_11 AUGUSTUS stop_codon 947121 947123 . + 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MAKNKVIASHVADFEVVNVPPAQAPHHSYQTHAMHMMQSHPAYTAAAAPHSYVAAAPPQPGVKAEPIDTRYMLHNAPQ # MAYALPHLPGPAINGARQPAVPQYGSQTSILSFPPGPPPVQSIPTNGAGVPLGRAYVPPTNGTPIATMSAPPPPPSNSGGGGSSGRIPQLDGPSEDES # DEDSQTPPPYAPRSTHPSLPQPQASTSASADSEAINSDLDDSDTGDEEEADDGAVGETDIVFCTYDKVSYNLCFLLPDFHFVLGRTSQNKWKCILKDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 Scaffold_11 AUGUSTUS gene 951629 952378 0.77 + . g203 Scaffold_11 AUGUSTUS transcript 951629 952378 0.77 + . g203.t1 Scaffold_11 AUGUSTUS start_codon 951629 951631 . + 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_11 AUGUSTUS CDS 951629 952378 0.77 + 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_11 AUGUSTUS stop_codon 952376 952378 . + 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MPIAPPKNGNNPFGFTRIAGENSAIIAADTNDGFTIFDLSDGSKSSSVDVNTLGAICWSTYSPKTGNYYMIDAGGAVF # EVNIDNNLKGSVVQVASFFFLQVISTFLVRLITETYSQQYNSTNMVGLFDGDVASLQDNEYVLLYHQIFFLILPNLFIYSFLYILAENFSTIEVMSLN # APGKAQHIQSLNVASTLMAAGIPISEYPLIITGIIIRRPDWLCLHVQVPQIKAWLLSLRKREGHATCLLEKHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 Scaffold_11 AUGUSTUS gene 957643 957948 0.79 + . g204 Scaffold_11 AUGUSTUS transcript 957643 957948 0.79 + . g204.t1 Scaffold_11 AUGUSTUS start_codon 957643 957645 . + 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_11 AUGUSTUS CDS 957643 957948 0.79 + 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_11 AUGUSTUS stop_codon 957946 957948 . + 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MDTHGLVHIDVPSFVSDSGSTLSLGSGNGLSCPTSDTRSSGIDVGSEILRVMFWYQIVGEWHIQNIKSNTPEMSTPFK # IMTIDDILDHGEPQENDLELKVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 Scaffold_11 AUGUSTUS gene 960337 960765 0.95 - . g205 Scaffold_11 AUGUSTUS transcript 960337 960765 0.95 - . g205.t1 Scaffold_11 AUGUSTUS stop_codon 960337 960339 . - 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_11 AUGUSTUS CDS 960337 960765 0.95 - 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_11 AUGUSTUS start_codon 960763 960765 . - 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MGNKQSKAAKADVDEINERTIRRNPIVQAMDKKHQEELQNLQKAAEKRAEADENARSRQEKEHQKNLIALQSQLDQEA # EARRVAEEQHREAEQKRIKAEQEAADHAKQAEKRKLETTLYTLRRRLGKQWKKLSIVRRTNGSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 Scaffold_11 AUGUSTUS gene 970780 971250 0.59 + . g206 Scaffold_11 AUGUSTUS transcript 970780 971250 0.59 + . g206.t1 Scaffold_11 AUGUSTUS start_codon 970780 970782 . + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_11 AUGUSTUS CDS 970780 971250 0.59 + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_11 AUGUSTUS stop_codon 971248 971250 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MIVGRATDYTSDDPTLNPPIAANQTNPVRRDTVLIPAGGSATLRVVADNPGVWFLHCMSLFYVQSMYEINSKFEPGHI # EWHLEVGLAIQLVEAPLQAQQYADTVPQALSDHCEALGKPASGNAAGIASATDLTGLPLGPFPQNNGWHPKGILAMFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 Scaffold_11 AUGUSTUS gene 971586 971966 0.84 - . g207 Scaffold_11 AUGUSTUS transcript 971586 971966 0.84 - . g207.t1 Scaffold_11 AUGUSTUS stop_codon 971586 971588 . - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_11 AUGUSTUS CDS 971586 971966 0.84 - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_11 AUGUSTUS start_codon 971964 971966 . - 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MAIYSLINGSKTIPPDSVPIFCDVVSTARVHVKALDSEATYGKRVLFAKGPATMYQILQIIVKARPELADRFPPIPEV # DPVAGKPISRIDSTIAMEALGIKGLELEETVLQTVDNLLELEKKLGPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 Scaffold_11 AUGUSTUS gene 973652 974134 1 - . g208 Scaffold_11 AUGUSTUS transcript 973652 974134 1 - . g208.t1 Scaffold_11 AUGUSTUS stop_codon 973652 973654 . - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_11 AUGUSTUS CDS 973652 974134 1 - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_11 AUGUSTUS start_codon 974132 974134 . - 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MFNEFCVTVFILATVIYGPVIHPISSLKSLNASNTIIYSLINGSKAIPPDTVPVFCDVVSTAQIHVKALESKATYGKR # VIFTKGPGTVYQMLQIIAKARPELADRLSPIPEADPLAGKPFSKFDTSIAVDVLGVKGLDLEETVLQTVDSLLELEKKLGTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 Scaffold_11 AUGUSTUS gene 984028 984366 0.97 - . g209 Scaffold_11 AUGUSTUS transcript 984028 984366 0.97 - . g209.t1 Scaffold_11 AUGUSTUS stop_codon 984028 984030 . - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_11 AUGUSTUS CDS 984028 984366 0.97 - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_11 AUGUSTUS start_codon 984364 984366 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MSLPPPSYDSFDYPIPDYSSEPRANEERLVYQQIRQSQGSDTRPTGVFVSQEEGITVVINYQEDKTPTPVFGRKSNIE # GTLLVDAPESVSEVTVKVLYSKSALELGSSVIDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 Scaffold_11 AUGUSTUS gene 992131 993237 0.63 - . g210 Scaffold_11 AUGUSTUS transcript 992131 993237 0.63 - . g210.t1 Scaffold_11 AUGUSTUS stop_codon 992131 992133 . - 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_11 AUGUSTUS CDS 992131 993002 0.97 - 2 transcript_id "g210.t1"; gene_id "g210"; Scaffold_11 AUGUSTUS CDS 993108 993237 0.63 - 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_11 AUGUSTUS start_codon 993235 993237 . - 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MVRAVKRHENGFISDPVVLSPSHTVADVLDIKARLGFCGIPVTDTGMLGGKLVGIVTSRDIQFREPSTSLSDVMVTDL # VTAPQGITLLEANDILRDSKKGKLPIIDSKGHLITLLARSDLLKNQSYPLASKNPETKQLYAAASVGTRPSDRERLALLVEAGLDIVVVDSSQGNSIY # QIDMIRFIKEKYSKLEIIAGNVVTREQAASLIAAGADGLRVGMGSGSICITQEVMAVGRPQATAVYAVSEFANKFGVPVIADGGISNIGHIVKAVTLG # ASAVMMGGLLAGTEEAPGEYFYHEGKRVKAYRGMGSLEAMEQGKPGVPTQGQRCAIRFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 Scaffold_11 AUGUSTUS gene 998637 999425 0.39 + . g211 Scaffold_11 AUGUSTUS transcript 998637 999425 0.39 + . g211.t1 Scaffold_11 AUGUSTUS start_codon 998637 998639 . + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_11 AUGUSTUS CDS 998637 999425 0.39 + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_11 AUGUSTUS stop_codon 999423 999425 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MEAEYDKDHSKPTDVDEVNRLIPYRIFRLLTYVPSGVVCWLSLRYVKPISGSTNTFILCLADVGGGSVSNDTTINLAR # IPLRWMIRECFKTKTGIMFDRDGLRGLGLDPDALYPDVLPRPPPLPVGNARIQDIPTKGSVSQIEKDSGLKNFSGGSSEVSGALIQTEEELELKDALS # PIYDQLSLAWFWWILEIFPIKQRFQRGDNSWASYFGWNLGRGRIVPKQKKQGVRVHRSVKMRLESHTQMEVNINQKLISTSNMPPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 Scaffold_11 AUGUSTUS gene 1002410 1003458 0.24 + . g212 Scaffold_11 AUGUSTUS transcript 1002410 1003458 0.24 + . g212.t1 Scaffold_11 AUGUSTUS start_codon 1002410 1002412 . + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_11 AUGUSTUS CDS 1002410 1002868 0.24 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_11 AUGUSTUS CDS 1002931 1003458 1 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_11 AUGUSTUS stop_codon 1003456 1003458 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MRDKLEVVVKGGRMGPQPRSLRNDGRVATIVVTLPVRFRGGSFIVRDSEGYEERYFGRGGKNGDMEWLAFSADCEYEV # ETVTKGCRITILYGVYLKTFGPTGVTEPLINPSDNFLDLMSPVLNMSLGRRVGIYVSNDYGVNPSEVLAESLVPMLKGGDSVLYHAIKLYKLSPELHW # TAGGYIWPVDRTVEIAEQGQNSSPSAKLAGLLETPRGRVTSTPAVRGAFALPPHAGSASGRAGSVAGRAGSVNGGFSGSSAGSTYPDSDEDLLDNLRY # RVQQSGAIPLGEADITILNDWNNPTPMIGKERVPFVVGGELDKLVVNALMVICP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 Scaffold_11 AUGUSTUS gene 1004749 1006190 0.37 + . g213 Scaffold_11 AUGUSTUS transcript 1004749 1006190 0.37 + . g213.t1 Scaffold_11 AUGUSTUS start_codon 1004749 1004751 . + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_11 AUGUSTUS CDS 1004749 1005399 0.5 + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_11 AUGUSTUS CDS 1005546 1006190 0.55 + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_11 AUGUSTUS stop_codon 1006188 1006190 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MDCSSHSLWIQLSNGVPLLHRPRTISGHPNTNHEGYKSTLSTRDNANSSASSNGTTSVSPSIRDDVESMLQLIGPDAE # SRFVSINLPTAFGANDPVQSNKDLSQLVDRAFLSGQAKSGNSGWVDTYIQCLIDVANTLPSLDNQTVLIDDYYNSMRTLAPVQAKLVQAYKAAKNEST # TNIGVQLSSGQLIDALTMRTVDEWAASALTEATLVKEVAIRIASEGWLLREMINQSPAIFNLSMITSGDPSSLSAHYSPAWSAIIINSTSVAVTSSNS # DVSGNLDHSLHDGTDKQYHICYKYNNEAPVSTSISFNSTTESSDSGSSSATPTSTNSLSSKQNTQSLTSTSAVSLAHTATATGSARRSRIRRAIVSTG # SRIQRRALAASNALCSPQVQKYFCSHDSSGKNAGKTAGKYASLPGMKEVASAANFGSRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 Scaffold_11 AUGUSTUS gene 1011707 1012301 0.49 + . g214 Scaffold_11 AUGUSTUS transcript 1011707 1012301 0.49 + . g214.t1 Scaffold_11 AUGUSTUS start_codon 1011707 1011709 . + 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_11 AUGUSTUS CDS 1011707 1011862 0.49 + 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_11 AUGUSTUS CDS 1011948 1012301 0.73 + 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_11 AUGUSTUS stop_codon 1012299 1012301 . + 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MSESVSDRHWAILLLFPGLNPQYTGLYRDAVVDTVIPQGPGLEPLAVKAGDRPAEFPDPLKVDPTRPQSAYNLNGTGY # HQCPGVTYAEQTIAETVKVVFSLKNIRRADGDAGRLGGFTVIKDETETNVYLKPNGILTSWPGSMYLVVSFICLSAVEKGLNFCLSQYDDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 Scaffold_11 AUGUSTUS gene 1017180 1018727 0.61 - . g215 Scaffold_11 AUGUSTUS transcript 1017180 1018727 0.61 - . g215.t1 Scaffold_11 AUGUSTUS stop_codon 1017180 1017182 . - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_11 AUGUSTUS CDS 1017180 1018727 0.61 - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_11 AUGUSTUS start_codon 1018725 1018727 . - 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MRALGTATISPDRTLPPAPLPPQNPLLGGSSSRDLPPHPRPSLLHRVPRSYNVVSPPPVPPSVTSPVTPVVPSIDSIS # SSSSESSEPPSKPSSISQTSATKSNALTVDLTSPANAIQNGDQRPARKTSKISNSVNPLSPPVYTDSPSDAAASVLTIPSTQSNSTTTTTGTSTITTF # NDVPTTSTGDTGERDLKGLKDDMRMRNIDDPAKSTKSTRPNGRENGNGTGAGIKRSGSPLEKPGPSKIQQTPRNSQHHSAPVSPPHLPSHPSSSPHSL # PLRDIPSHPSHLTPDTSETFTEIPGLGNFPIPPSPKLRIIELPPINTHGPTTTTTEVLRNTVPIIKVTRTMDAMDTSMDTSESETKQMTSLIRPSISV # TSFHPNVESQPSLDFLNSNGNATMNGGLSSTSSSLRSSTTMSLHDSLTPSVPLEHLIRAQMKGGNKNQARSQDYTMKGESKPDSAELDADIFEGSGTV # GNKEVGRTNGTGSTGSTTGSGSSSTPFSLSRHTLAHLLGEPSNFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 Scaffold_11 AUGUSTUS gene 1018812 1020000 0.84 - . g216 Scaffold_11 AUGUSTUS transcript 1018812 1020000 0.84 - . g216.t1 Scaffold_11 AUGUSTUS stop_codon 1018812 1018814 . - 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_11 AUGUSTUS CDS 1018812 1019413 1 - 2 transcript_id "g216.t1"; gene_id "g216"; Scaffold_11 AUGUSTUS CDS 1019481 1020000 0.84 - 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_11 AUGUSTUS start_codon 1019998 1020000 . - 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MRGLVEMDGAWLWETPSQPIPDGIPAWSLRGTAGSMFVRQARTSTAKPANSAASASARVASKPLSAASDSQTPPRARR # TQNTASASASATAPSPITSSSARPTGTAPTTTSTNTTSTPVTRPIYGPPRPPASPGLKKASLLPKTDHGELSSVPVITSAKSSKRSSEISKSQKQVEV # KSSANITGDSISVVLQKPKTISKKSNKNTILTSTNASSAPIPSPPASMSTSTTGHRPVISTPSSLNTVVSSASPIPTPAPTPTPSMQSIPSLFPSNDA # TEPASSSKIKSKSLPLSKFPSTSSNYNSPTLTTTAINSTNHPLCDPQVLAHTKQMLALASVCQNARVPITHPQAPVESKHQLHPPRRLLFLLILGMLR # I] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 Scaffold_11 AUGUSTUS gene 1021120 1021758 0.78 - . g217 Scaffold_11 AUGUSTUS transcript 1021120 1021758 0.78 - . g217.t1 Scaffold_11 AUGUSTUS stop_codon 1021120 1021122 . - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_11 AUGUSTUS CDS 1021120 1021758 0.78 - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_11 AUGUSTUS start_codon 1021756 1021758 . - 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MPLPTRTGIVTRTGASGIPSSGLRSTTAALTSKISRPGTSTSVRPLSRPVSQTATSNSRTTLTRPVPRTASRTAVSLK # GGESTRSVTAATTIARGNSTTSTTAASRSRARSNTTTNASSVVGAVAGLKRPTSSAAASSKTTVRSAVTTTSTTTAPTLKRPTTLVRPKSSSTATFAM # KPARIADVVAQAPELGGDIVTLDRVEESLDDFMFDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 Scaffold_11 AUGUSTUS gene 1025464 1026077 0.79 + . g218 Scaffold_11 AUGUSTUS transcript 1025464 1026077 0.79 + . g218.t1 Scaffold_11 AUGUSTUS start_codon 1025464 1025466 . + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_11 AUGUSTUS CDS 1025464 1025501 0.82 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_11 AUGUSTUS CDS 1025567 1026077 0.89 + 1 transcript_id "g218.t1"; gene_id "g218"; Scaffold_11 AUGUSTUS stop_codon 1026075 1026077 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MNVGTDKPSMPTGWEAAPGNTSTFTVPDDWQSGRIWECPGVIFHSPFSQAQQGRTDCDFSKPNASSCATGGCNGGLLC # DEHSGTVSLVCSYVYGRSLISMRLGVPPVTVAEWTLGKNGSPDNYDGELINPRGMNSCACRYLHRGSVSVSMVDGFNIPMSVVPTAGCQAIDCNTDLN # PNCELY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 Scaffold_11 AUGUSTUS gene 1026937 1027275 0.78 - . g219 Scaffold_11 AUGUSTUS transcript 1026937 1027275 0.78 - . g219.t1 Scaffold_11 AUGUSTUS stop_codon 1026937 1026939 . - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_11 AUGUSTUS CDS 1026937 1027275 0.78 - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_11 AUGUSTUS start_codon 1027273 1027275 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MEALRKEAEKLAQERRLAREQALEWTREARMNESDEEKEKRPKKAKKSKGDGTGSGDEGDAPKKKRRGKIRKANGEPT # EEGEEPAAVFSDEDEAERPTKKVCICHLGMDRIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 Scaffold_11 AUGUSTUS gene 1027950 1029271 0.68 - . g220 Scaffold_11 AUGUSTUS transcript 1027950 1029271 0.68 - . g220.t1 Scaffold_11 AUGUSTUS stop_codon 1027950 1027952 . - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_11 AUGUSTUS CDS 1027950 1028517 0.98 - 1 transcript_id "g220.t1"; gene_id "g220"; Scaffold_11 AUGUSTUS CDS 1028610 1029271 0.69 - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_11 AUGUSTUS start_codon 1029269 1029271 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MNNGRNPQFLRFFGLIKTGLDEPGGAINTLDNLLQAPNPQKSLEATVMLASLRGSPRPGISSSEMVQERARARELFDR # ISKTLEIEDGKVNGSGLSKASRTISEDMNMHLEIARLWQDQNLDRSSKALQEALQISQLSGTTEPRLLNNLGALHHLDSNYSQALGFYEAALMESMSS # ENAEIISTSILYNLARVYEDQEEVEKATDAYEKLLSRHPEYVDGTEAHDLIKESLASQSSNLNLRAFYTYFLVQTNLTKNAKDFVFTTLKDFDKHDIY # SLCAAGWIHYNQARESRDTSSKGTEERRRGFQRSTEFYEKALQLDPFCAFAAQGLAIVTAEDALGALSGVSLSAGDEAQRRIQSTRDALDVFAKVRES # INDGSVYLNMGHCYYARDEFDRAIESVSHRSKRILTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 Scaffold_11 AUGUSTUS gene 1033640 1033831 0.73 - . g221 Scaffold_11 AUGUSTUS transcript 1033640 1033831 0.73 - . g221.t1 Scaffold_11 AUGUSTUS stop_codon 1033640 1033642 . - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_11 AUGUSTUS CDS 1033640 1033831 0.73 - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_11 AUGUSTUS start_codon 1033829 1033831 . - 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MPQITCAEVQNELFDIAQAFTVASHLMEDSDNSNDDSFQLDDGFDDEEAQNFDGEFTDSVVVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 Scaffold_11 AUGUSTUS gene 1037196 1037926 1 + . g222 Scaffold_11 AUGUSTUS transcript 1037196 1037926 1 + . g222.t1 Scaffold_11 AUGUSTUS start_codon 1037196 1037198 . + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_11 AUGUSTUS CDS 1037196 1037757 1 + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_11 AUGUSTUS CDS 1037814 1037926 1 + 2 transcript_id "g222.t1"; gene_id "g222"; Scaffold_11 AUGUSTUS stop_codon 1037924 1037926 . + 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MTFVSSLLVPTDTVLSLNLPPTLAHKPLLAGSLPVPSLTTSLAPSKNPDLLLSPTPELTTKLSVRRPYVNIPVIALCD # TDAPMKFVDVAIPTNNKAKHSIGLIWWLLAREVLRLRGTIPRTSDGWNVMVDMFFYRDPEEVEKQQQEEAAAKLAAQAGEEPAAGLTEWDVASGPAAG # AINPALVSQEGATLDWSADATAGPTDWAAEPSGAGWGADAPAGGSGWD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 Scaffold_11 AUGUSTUS gene 1046917 1047303 0.89 - . g223 Scaffold_11 AUGUSTUS transcript 1046917 1047303 0.89 - . g223.t1 Scaffold_11 AUGUSTUS stop_codon 1046917 1046919 . - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_11 AUGUSTUS CDS 1046917 1047303 0.89 - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_11 AUGUSTUS start_codon 1047301 1047303 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MLASLFANPVIRQILLSTGNIPVDRKSNDRRVLFRGTFEALSKGYAVALFPEGTSYTEPRIMQIKDGAAWAALEYTKY # AKEHPGTQEVKVIPVAIVYTNKSKYRSSVSVLAYSEEKFDIYSTGQVIIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 Scaffold_11 AUGUSTUS gene 1048186 1048821 1 - . g224 Scaffold_11 AUGUSTUS transcript 1048186 1048821 1 - . g224.t1 Scaffold_11 AUGUSTUS stop_codon 1048186 1048188 . - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_11 AUGUSTUS CDS 1048186 1048821 1 - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_11 AUGUSTUS start_codon 1048819 1048821 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MTLEAALDHSWLQDYVKKNNRDATADRNLGKPRDHQPDSSEFIPTGRDAIPDNTNEEKQPGSTFFSQGFQKLDINDKK # QVGPSNANDRAGVSSNSASADLPNGAADDDSQMDDATPPPPSQTRKLQPQNSRVLRRRKDVLEEANAGEMTIPRPSPELLSQFDEKRKREEDVGKPAT # GPSRTPEKRRGKRAHGDLSAVPEMADNGLEVVGRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 Scaffold_11 AUGUSTUS gene 1055212 1056254 0.14 - . g225 Scaffold_11 AUGUSTUS transcript 1055212 1056254 0.14 - . g225.t1 Scaffold_11 AUGUSTUS stop_codon 1055212 1055214 . - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_11 AUGUSTUS CDS 1055212 1055781 0.68 - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_11 AUGUSTUS CDS 1055844 1056102 0.6 - 1 transcript_id "g225.t1"; gene_id "g225"; Scaffold_11 AUGUSTUS CDS 1056148 1056254 0.25 - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_11 AUGUSTUS start_codon 1056252 1056254 . - 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MYARPLHPNVMLSKLNILDQYMCVNATLAGDTVECKRAFEHGEERSGMDGSVSLDDCSVVKLTKFTCGSGFGTQMSNN # PMVILWSNPDGSTTLSQRVARSWVMPEVVDNPPRIATLSSDLSTGMIGMASQFQYVHVSSLLDLIFNFPNKWDNSAKTNLIWAFGTQNPGSSAVDAPF # QFHLDAGYAHFDLSKPISANSNEDLSTPSTSTPSTNPASSSSKASPSSSSLTSTNSLPLNAHQRLVFAHAVFCTAGFLLFLPAGALVSRWARTFTPAW # YTAHWILQFIVCGSSCVHTEYTILIQPKKLGSASSLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 Scaffold_11 AUGUSTUS gene 1062649 1063386 0.7 - . g226 Scaffold_11 AUGUSTUS transcript 1062649 1063386 0.7 - . g226.t1 Scaffold_11 AUGUSTUS stop_codon 1062649 1062651 . - 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_11 AUGUSTUS CDS 1062649 1063386 0.7 - 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_11 AUGUSTUS start_codon 1063384 1063386 . - 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MTKTLDSFSTLLGMLTDTFLLEEPLHPRSQGRIQRAVEAHQSSFTSLKKNLKEASSEWIFWGRYRTPTSGAFTKLARG # NAPIRDPDNDGGRRKAYQDAVDSLNRLAQHLNGLRSGTRLQFELTQAGAVERKARNKKTHGVPSSKSGPLVDVSLADSMVEDDDEEAAMLKAAAVMFG # DLVDDLGPPMKALSVCDLLLISRLHFLIGFSYRAPVPPVSNAFVNLSSFHNKTIVAHTTASSTFQNSMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 Scaffold_11 AUGUSTUS gene 1063830 1064825 0.71 - . g227 Scaffold_11 AUGUSTUS transcript 1063830 1064825 0.71 - . g227.t1 Scaffold_11 AUGUSTUS stop_codon 1063830 1063832 . - 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_11 AUGUSTUS CDS 1063830 1064825 0.71 - 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_11 AUGUSTUS start_codon 1064823 1064825 . - 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MNHQNISSSSSWIPYVPSSSPSNGPVHDIEAGRSVDDSSLQPEAASVLTGSSSTRPTTPKLSTSFMVAPSSGEPFSRP # SLGRSATTPHLPQVRKRNSALLRLNTGNHTPREWSVFGQLMENEGQITPQSASFRRTSRAHSTRIPSGNITPRSSMIESHPSIDIQSPVAEEEFFGGQ # SPTDSDSDSESVHSLDSEESSSYASTVQDETQPKWYSLRERIPTVPVLYRNIFKCAVAYFIASLFTFNPYLSGFMSDLVSYGSGERRPLPSGHMVATV # CVIPTSLPWLYIIYFVSAVYFNPAKTMGGMIEADFFCLFGILYSAFICLSSIQCFGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 Scaffold_11 AUGUSTUS gene 1065230 1065896 0.2 - . g228 Scaffold_11 AUGUSTUS transcript 1065230 1065896 0.2 - . g228.t1 Scaffold_11 AUGUSTUS stop_codon 1065230 1065232 . - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_11 AUGUSTUS CDS 1065230 1065760 0.96 - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_11 AUGUSTUS CDS 1065876 1065896 0.2 - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_11 AUGUSTUS start_codon 1065894 1065896 . - 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MSAAFETELLPAASSILSTEARQSTWIQSTVQHLNPWSGAFEVPLTPNQIFTIASNFIVTCPSSNPPIAATHAFPPIG # IPTTAAPGASVQLSFDLNETSASDLSELFVAFLTSNGTIFEQFSSSDSYNVTFPTQEEGLLGTVFVLIVNSTTEAVTDATTVAGPTPLMFPFNATDPQ # IEALFPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 Scaffold_11 AUGUSTUS gene 1065993 1066406 0.18 - . g229 Scaffold_11 AUGUSTUS transcript 1065993 1066406 0.18 - . g229.t1 Scaffold_11 AUGUSTUS stop_codon 1065993 1065995 . - 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_11 AUGUSTUS CDS 1065993 1066406 0.18 - 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_11 AUGUSTUS start_codon 1066404 1066406 . - 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MKSALFLSALAFFSSTKAYTIPQSKRTIDIVGKSRGSASHYSSSSSSSSSSYSSDYSSITDAEVLNYALTLEHLEVAF # YTQGLANFSADAFAAAGFAAAVRANYDEILSHEETHITLLQSVLEEMGADIVQECTYDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 Scaffold_11 AUGUSTUS gene 1069582 1070537 0.91 + . g230 Scaffold_11 AUGUSTUS transcript 1069582 1070537 0.91 + . g230.t1 Scaffold_11 AUGUSTUS start_codon 1069582 1069584 . + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_11 AUGUSTUS CDS 1069582 1069849 0.96 + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_11 AUGUSTUS CDS 1070002 1070537 0.98 + 2 transcript_id "g230.t1"; gene_id "g230"; Scaffold_11 AUGUSTUS stop_codon 1070535 1070537 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MDISVRLIFDCTAHTPISSWQSKHKRSATSIEADVDLRDSKRTKTSAISKLLSTNRTSKKVPEEASIRVSKNSVSNPL # VNTRANPLIPRLPIGRCLWFIDKLSTLMTANRLPTSSSRASAPSAFPSSESWVEDDLAHSLKTHSSSSKTTTSETGPLNSNIINDNNPTGSSTFGFRA # ETSSDTAEVVSTRPPASSTSLPVSSLSSALGSVAHALVNNVILPSVLPDSESIKPKLLDDTTVQLLSAAHKAIGALLAAHQAAVARGEGVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 Scaffold_11 AUGUSTUS gene 1073353 1073676 0.37 - . g231 Scaffold_11 AUGUSTUS transcript 1073353 1073676 0.37 - . g231.t1 Scaffold_11 AUGUSTUS stop_codon 1073353 1073355 . - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_11 AUGUSTUS CDS 1073353 1073676 0.37 - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_11 AUGUSTUS start_codon 1073674 1073676 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MANDIRQKRKRASDKVSVEIEDAGLSSDLSDIEDEFIPKTPKKKRKKKAGKESQTVSEAVKVDADEEAYDEVEVKKAR # RPRKPKPEPVYIIQDVERRETKFRGRLGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 Scaffold_11 AUGUSTUS gene 1087377 1089352 0.28 + . g232 Scaffold_11 AUGUSTUS transcript 1087377 1089352 0.28 + . g232.t1 Scaffold_11 AUGUSTUS start_codon 1087377 1087379 . + 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_11 AUGUSTUS CDS 1087377 1088872 0.29 + 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_11 AUGUSTUS CDS 1088962 1089352 0.5 + 1 transcript_id "g232.t1"; gene_id "g232"; Scaffold_11 AUGUSTUS stop_codon 1089350 1089352 . + 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MRTELEDHTWQLPLDRVARMLSPENRNNPLDDKVIDHLGNYACVSDSPGFMKKLKNAVMKLRPRVKDIQWPSDPDERP # FYTPLAQFLNVCVSVCKEELTDDERYTKGPFHDLEFIVYDKETQDSVNGASPTKPHLVGGKKFMAFADSDDCKVKSAQLYWNTPDKNASPILLPVEVK # DNWIELVCQAATYARCPLRQYSLVLGYNHKEGTFRFLIFHRGGLSASLPRDLRDENSHESLLHVFLSLLDCFHAGDAGMAAWCVKLPVDNSDKPDFIV # ANIKEVLHDGNSCRGRASQVTRISYSVREDVSTSPLPVVATTPLFPVIQLRCSARVANAEVKKGVEAPANSKKSSRNQVDSRTRSETKPSNIPDLSTL # AITPITVYGPTRDLEDVKQELMILVKSLNPRRGIISHGLMKAAWPKRDSGRSSVPETWMLNVCGDKFGTWKHHYDFPANRSHGIPTSNNIFLPTEMEL # KKGVAEFHWDLFSLHQKYSTPLPEYRSLRSVAICSEGRLLLMNIAGWLTICQEALQHRDVSVGNVLRLENPVEMPSFKFKRDIADLVGTLSLSETLPF # TVTDQITRLESSLAELNVNTRCSGFIIDRDMAADWKTYFDANHDGTRSVSRSDSLLSPII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 Scaffold_11 AUGUSTUS gene 1092187 1093435 0.44 - . g233 Scaffold_11 AUGUSTUS transcript 1092187 1093435 0.44 - . g233.t1 Scaffold_11 AUGUSTUS stop_codon 1092187 1092189 . - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_11 AUGUSTUS CDS 1092187 1092969 0.93 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_11 AUGUSTUS CDS 1093034 1093435 0.44 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_11 AUGUSTUS start_codon 1093433 1093435 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MIFLRSLLMKVGWNTKLSARASNYGTRIDYILATPGLLPWIKAADIEPTIKGSDHCPVWIDLHDEISLSGGGNSTLKL # RDVMSCPTPDKPDREPPRLATRFWDEYSGKQRLLASFFNTGSAGDKIKPKVVAAKATPTTNSDNSDVKMLMTSCESTLHNTTIPQPVSISSSLTSIAS # VSSFPTSSGTSTPTSTSSRSNSLKKRKTPPPSTSSSTAGTSSSSSAIQTKPKKPKGDVQNVKDLKKPGQSKLSSFFVAPPTTRDTSNSKAKNSITSKI # KPRRSESIANLADRGTQVIVDLTASDDKDDKYPVAQTVQEVEEEDIDEDLRQAIQLSLSQTSSSSMPSQSSPISSSHEVWKSLLKPREPPKCLVHNEV # AKEFRVNKPGVNKGRSFWVCSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 Scaffold_11 AUGUSTUS gene 1107003 1107689 0.45 - . g234 Scaffold_11 AUGUSTUS transcript 1107003 1107689 0.45 - . g234.t1 Scaffold_11 AUGUSTUS stop_codon 1107003 1107005 . - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_11 AUGUSTUS CDS 1107003 1107689 0.45 - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_11 AUGUSTUS start_codon 1107687 1107689 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MRAYPSNASWSLTSNTFIPTLSPSQSTDSHSTPTVSSTGSPNSDENSSSSRDQRTGRTIGGIVGGVIALILLVVILTY # YIVPYFRRKQDIGGGRIGDDEMRTSRWRRPWFEMVNFGSNAQSSVIPFALAASVSQRGSTKEAMISERTTMRHDEGAASFTAVNVAGRSHGGSGTERT # IKSNTNQGQDHSTEDTPRSGRKLTLPTLIVTDASVSMATTSGERQHVFTIHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 Scaffold_11 AUGUSTUS gene 1113818 1114303 0.79 + . g235 Scaffold_11 AUGUSTUS transcript 1113818 1114303 0.79 + . g235.t1 Scaffold_11 AUGUSTUS start_codon 1113818 1113820 . + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_11 AUGUSTUS CDS 1113818 1114303 0.79 + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_11 AUGUSTUS stop_codon 1114301 1114303 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MPQGLYFEVNTTGRDPSGWSVIGWLYRDVYYNSTESFRAAWEAGELEKSTLNLEGPWIGSDYRGPTTKVGENSTMWAS # EKAPPVMVPPSGEDGIRYKVDVDNKYVEWSEFQLSVGVFSMFSLALITVDFSFYVAFRRDSGVRLFDIRYRGERIVYELGLGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 Scaffold_11 AUGUSTUS gene 1115077 1115916 0.91 + . g236 Scaffold_11 AUGUSTUS transcript 1115077 1115916 0.91 + . g236.t1 Scaffold_11 AUGUSTUS start_codon 1115077 1115079 . + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_11 AUGUSTUS CDS 1115077 1115916 0.91 + 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_11 AUGUSTUS stop_codon 1115914 1115916 . + 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MHDHVLTFKADIDILGTSNSFANHTVAPVTASYPWSHGMERSTMKLFRSYLDNEDNAKLFWPGNAHSMFMVVNKDSPN # EFGEPRGYRIMPSKGSGMHATIQNSSNLLNSMNFATHALYVTKQKDTEPRASNANNDYDTANPVVDFAAFFDGESLDQEDLVVWFNLGMHHVPHTGDL # PNTVFTTAQGSMLILPHNYLLHDPSRDSRQTVRIDYNDSGVQAVHTFGADFSNGLVNLVCSIYVTIHVAWVFTKPVTLLQSSVVPDFWAYRGDIDVRK # FPYDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 Scaffold_11 AUGUSTUS gene 1119437 1121441 0.51 + . g237 Scaffold_11 AUGUSTUS transcript 1119437 1121441 0.51 + . g237.t1 Scaffold_11 AUGUSTUS start_codon 1119437 1119439 . + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_11 AUGUSTUS CDS 1119437 1120097 0.51 + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_11 AUGUSTUS CDS 1120216 1121441 1 + 2 transcript_id "g237.t1"; gene_id "g237"; Scaffold_11 AUGUSTUS stop_codon 1121439 1121441 . + 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MKSVRTPGRPSGIGGGSSLPTPRSRSSSIANAERAKTPTYSIPAVPSVPPAAKSTRPPSRTSGASSSNAVFTPTLNAP # VRIESLGFEGILRYLGEIPPKQGIWAGVELSAGFAGKGKNDGSTPDGKRYFNCAPMCGVFVSVSKLSRATAGVSRPPSVASTAGSETMSGLLSASSSR # SGLGISTGRVTPSARTGRLSLAASNSSNASTSTSSYSYKPASYSVKTRSQGANVEKAVPVPAVPSIPRASSAAGTSIPSSLPSPTISNASPRRIPSLN # QTSHLSSPFNTPKARNLATASGIGLGSPHGATPRARLPSAVSMPPPPSPNKDPTLKDLTDLQKTTREIQERIRGLTGETVSPPSPSTSVTSNNASPPS # AASTSYSYSSQTVPSPSRRPQSRIASAATISSRARSRSRAGSTSVNDSMSSTSMHSRPSSVASTASVVSATTRSHAPRSSTPGFGPRSSTPGFGVSIG # PRSSTPGFGRSLSRAGAETPSASVDERLERMQSRIAALEYENTRLRDEAEETANSGGIGELRIKLRELEKDLENANALVASGTSATSDDVSLRHLTLK # AKLNPQRLPVPLSLLLAQHHQAKTPTTNFAKKSISLLFALTTLPPKLFPPMLVQNNSNLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 Scaffold_11 AUGUSTUS gene 1121660 1122004 0.71 + . g238 Scaffold_11 AUGUSTUS transcript 1121660 1122004 0.71 + . g238.t1 Scaffold_11 AUGUSTUS start_codon 1121660 1121662 . + 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_11 AUGUSTUS CDS 1121660 1122004 0.71 + 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_11 AUGUSTUS stop_codon 1122002 1122004 . + 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MERDRDMWDVERKELRIQVDELRRAGQETIALYEEKLDEMRITLKGNDLSSSVSSLSRSRSSTLADDRDLKKDDTLSA # SSIDHSALLEQLTYLQTKTASLTDALEDARHPISLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 Scaffold_11 AUGUSTUS gene 1122168 1122788 0.84 + . g239 Scaffold_11 AUGUSTUS transcript 1122168 1122788 0.84 + . g239.t1 Scaffold_11 AUGUSTUS start_codon 1122168 1122170 . + 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_11 AUGUSTUS CDS 1122168 1122788 0.84 + 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_11 AUGUSTUS stop_codon 1122786 1122788 . + 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MWRGIRGSSERIRFKEGLGGEDSEAKDKSSQDALQSELAASQTDLARVTSELLKSLTKSEINSHKEEIAGLKHLVKEL # QRLQRDSARDEEGEMSENAVLRRENEMIKEENRMLIREMEGLKEEVKVLEEGLSVLEDEEEGKAKRREAMVNGSSKDGNPVVNSMNSGVNVSGDEVEE # LKKEIEVLKKKLGEMEIKAARKTHDVSLSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 Scaffold_11 AUGUSTUS gene 1125734 1126342 0.91 + . g240 Scaffold_11 AUGUSTUS transcript 1125734 1126342 0.91 + . g240.t1 Scaffold_11 AUGUSTUS start_codon 1125734 1125736 . + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_11 AUGUSTUS CDS 1125734 1126342 0.91 + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_11 AUGUSTUS stop_codon 1126340 1126342 . + 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MAKTPFYKQVCYFVARPATSISSVNCFSVSFNAPTYALLPGAIPLKAFHRARITFSGVWTTRYDQGGLLLHLTRTGST # DRWLKTGVEFYQDKVYLSTVSTLTYSDWSITPPTAGDNAKSTTIEVRREVDELGSSLWVYELVLGDSGEVLERQPLREVTWFLAEEDGWEVSVSAMAA # RPAKEESVVGTKELVVKFEGAEVDVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 Scaffold_11 AUGUSTUS gene 1128074 1129531 0.48 + . g241 Scaffold_11 AUGUSTUS transcript 1128074 1129531 0.48 + . g241.t1 Scaffold_11 AUGUSTUS start_codon 1128074 1128076 . + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_11 AUGUSTUS CDS 1128074 1129531 0.48 + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_11 AUGUSTUS stop_codon 1129529 1129531 . + 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MQGSRTHMLQGTRPYLYANHGLDTAISSRPDGDGHQSGRTEDPSNSLPSLTADSTTSRVGRSQTRSRAVEELELRPAT # AAVNARPSRGASTGGALITETLVPRMARPRYALHRTDSGSRQIRAHSVDATGPSRPATERVPEPELFVPPVPEAHGRSRAHLIHVVNRILPHSAQGTG # IIPGPAPTIPHNHTHHHHHHTHSLPPPLHRQHQHHHHLPPTHIAAITSQPPQAPYIPPAPEPAQHPPARRLRHHVSFANPNKPQLLHMHPLFAASSPD # SPAPICYDVTRPPSRTSVRCKFAETTHEAASSTPRSTKNGEAVPAHVLAEPATDPPTLGKLVLKSDRFPWEVIVTAGCAEAPSVNSRPVVTNNDVLHA # LHRTLHAHVLHSEWDTLDSDRSRQRRVSRAYQRRVEIMQLRAARDRAQASLNAGRRVSGGAEGEGREEQEGVRRVDWLMGRTRFVGIVVERSAGVGES # SDGLKGVGKLVFTKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 Scaffold_11 AUGUSTUS gene 1130839 1132017 0.63 - . g242 Scaffold_11 AUGUSTUS transcript 1130839 1132017 0.63 - . g242.t1 Scaffold_11 AUGUSTUS stop_codon 1130839 1130841 . - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_11 AUGUSTUS CDS 1130839 1131622 0.77 - 1 transcript_id "g242.t1"; gene_id "g242"; Scaffold_11 AUGUSTUS CDS 1131692 1131810 1 - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_11 AUGUSTUS CDS 1131862 1132017 0.84 - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_11 AUGUSTUS start_codon 1132015 1132017 . - 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MIENEYPIPSYMADVDNERPPGWVETPEETKLGDQDQNPRPRRKVYGIDCEMCTTEDGKELTRVCMIDYDTQLVVYDQ # LVIPNKPVVDYLTRWSGITAESLATATTTFAEAQANVLKLLSPVSSHIPKANPFSTKPSVASSSAPLLTPILLGHSLESDLKALKIAHSFCVDTALIY # SHPRGRPFKPGLAWLTKKWCGREIQTRGEGGHDPEEDARATMELVRKKVENGHEFGEFKADLEGLFERMGRAVKRSSTSTVSTGTGGEKIRTAVVDHG # NPGVMHGNKASTSIGCKDDDEVVKNAVELVGSHDFVFVRLMGLAGVRGCKSNSPAPFSLEDISLSTYDFHLGQFMLIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 Scaffold_11 AUGUSTUS gene 1140418 1142113 0.19 + . g243 Scaffold_11 AUGUSTUS transcript 1140418 1142113 0.19 + . g243.t1 Scaffold_11 AUGUSTUS start_codon 1140418 1140420 . + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_11 AUGUSTUS CDS 1140418 1140956 0.19 + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_11 AUGUSTUS CDS 1141474 1142113 0.36 + 1 transcript_id "g243.t1"; gene_id "g243"; Scaffold_11 AUGUSTUS stop_codon 1142111 1142113 . + 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MTFDNMDELYKVARTHPRAKLVVRILTDDTKSLCQLGLKYGAPLVTVPALLTKAKELNLDVIGVSFHVGSGCYDPTVY # SDAIARARYAFDMAKEAGFSFTLLDVGGGFEDASFEQAASVLKDAIEEHFPDRRNIRVIAEPGRFYVSKAFSLAANIIARRAPFSDSAEMTTGNDQPS # VMCESSDTFVHLEDPYVIEKSYVVMCRPDVAASISTGTTMDERLQLVASTALLSLFTSGVVTTPIASKSLLIKVITCKHSLVDFPRFRLTDLAKFEAT # LESLAHNWPGPGDPVSLRLVREDGHLLVMDVILPSGVSTTARGLDFNPKNPRKRKRIIDEEADSAAGSEPEEEEDEEEDIGRYKQSGLAGFSKQQREV # YKLVQQPTAKGRLLAEEVSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 Scaffold_11 AUGUSTUS gene 1152815 1153651 0.55 + . g244 Scaffold_11 AUGUSTUS transcript 1152815 1153651 0.55 + . g244.t1 Scaffold_11 AUGUSTUS start_codon 1152815 1152817 . + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_11 AUGUSTUS CDS 1152815 1153651 0.55 + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_11 AUGUSTUS stop_codon 1153649 1153651 . + 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MMYNPLSSKASLVTVTITSSTSSATAPDDSTKMTTPAKSNVEPTNGTDTAAIIGSIVGSVVLVFLIGVILLFLRYRTR # RRTIEFSQTKMVRDYVPDMVEGSTWRISDSERDLIDYSSESASFPPARRNTLRPQDSVSNIHERYVPQILPPIPAARPVSSSEPDSATSTSSIRRARD # TERKTPSISLSNLSSSNGSTGTGSLFPIPVLPPRPRTDRQMSIEEEIQQLQARMLFLQGNGNTSPIGLEKEEELKKIYRKVETLKKLHESKWALGLTN # EMSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 Scaffold_11 AUGUSTUS gene 1155280 1155810 0.54 + . g245 Scaffold_11 AUGUSTUS transcript 1155280 1155810 0.54 + . g245.t1 Scaffold_11 AUGUSTUS start_codon 1155280 1155282 . + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_11 AUGUSTUS CDS 1155280 1155810 0.54 + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_11 AUGUSTUS stop_codon 1155808 1155810 . + 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MMVKTQETEFMTDPFGVIVRPRATVHRSRSMRSSRNSSIDNSNEKTPLETFSRPAIISGASSEYRDNVDDDDDGRSTL # VSTIEDGEKGPSRLSPPRTDRQMELEQKIHELRSQMISLSSRHKEESEGGEESIESEDSDTYLIHWHHIRARIKRLEQLEFSDWALGMTNQVPRDFIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 Scaffold_11 AUGUSTUS gene 1157347 1157853 0.99 + . g246 Scaffold_11 AUGUSTUS transcript 1157347 1157853 0.99 + . g246.t1 Scaffold_11 AUGUSTUS start_codon 1157347 1157349 . + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_11 AUGUSTUS CDS 1157347 1157853 0.99 + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_11 AUGUSTUS stop_codon 1157851 1157853 . + 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MLEEIDYELSQPEGEDSGVESDPEYNEPGPSSAGPSSSSHRRHNKSKQPSAAPEHVFRPSANELETLSVLRTRLLPLV # ALHDSLASELSGGVSFSRGLTGVFVRAGWQGLLQSNPGSRAGKGSVVGVAGLAAKALDSSREDIQALWAHSSVKELIQERKLKLEESAPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 Scaffold_11 AUGUSTUS gene 1164131 1164616 0.47 + . g247 Scaffold_11 AUGUSTUS transcript 1164131 1164616 0.47 + . g247.t1 Scaffold_11 AUGUSTUS start_codon 1164131 1164133 . + 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_11 AUGUSTUS CDS 1164131 1164616 0.47 + 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_11 AUGUSTUS stop_codon 1164614 1164616 . + 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MCKTFLVVFSGLRTRGCHGKLYNQWSIPEIQGIEEDTKETLERAVIRIQDILIQEIEKPLSTRNAVSESSAGTTAVSS # SRASVTSGSPGSPSESPIEDSEDSDTREEIAHQENLYEWEATPVASHQCLPVLANSGGTHNLIAGTGTHWLHHMGIADNLLSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 Scaffold_11 AUGUSTUS gene 1168466 1168858 0.78 - . g248 Scaffold_11 AUGUSTUS transcript 1168466 1168858 0.78 - . g248.t1 Scaffold_11 AUGUSTUS stop_codon 1168466 1168468 . - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_11 AUGUSTUS CDS 1168466 1168858 0.78 - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_11 AUGUSTUS start_codon 1168856 1168858 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MMAETGSMEIPSESDPSEVIVQPNATVSRTTGSVGSAKNSDMDGFNESPTLEGLSPQAIIARALIEYRGDVDDDGRST # LASTTRMFPSTSSSSYKEGSGEDKSINSQESDNSFMYHISKWALGMTNRVPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 Scaffold_11 AUGUSTUS gene 1176165 1176825 0.31 + . g249 Scaffold_11 AUGUSTUS transcript 1176165 1176825 0.31 + . g249.t1 Scaffold_11 AUGUSTUS start_codon 1176165 1176167 . + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_11 AUGUSTUS CDS 1176165 1176287 0.35 + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_11 AUGUSTUS CDS 1176343 1176825 0.35 + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_11 AUGUSTUS stop_codon 1176823 1176825 . + 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MDGKNIADFIDPDIAEKLEALEREEEKLEAEGFYASDDDDMPDSDDELLAAKAQEDLAHKIHSQSIKKSKKNQARLPR # TAGLRTLSEMTDALTKAGLDPSRITERAQMLAKAAGVKRKRPRDAEDGDVEMDDAEGEGGDDGEEGWMDVDGEEAPQLKRTKGNSGTAVASVNKRAPR # TNRQLMGMRDEGVRIFVYFSDIALY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 Scaffold_11 AUGUSTUS gene 1180180 1181103 0.81 + . g250 Scaffold_11 AUGUSTUS transcript 1180180 1181103 0.81 + . g250.t1 Scaffold_11 AUGUSTUS start_codon 1180180 1180182 . + 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_11 AUGUSTUS CDS 1180180 1181103 0.81 + 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_11 AUGUSTUS stop_codon 1181101 1181103 . + 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MAPAPPPPPPPICLPFIGNKPRRRLSFSSAQPGGSPYTSSSYSGSSSFTASQLSRHQSYSSQGTTPVKRDVAPSRDID # ALTFYSDSEKYDDIPTDTLPTLPSGKGKKDKPKLVRSNTMTGSKKSKWGYGWGIGKKNKEKEAEAEREMAEKSPSILSGTNLPMYESPRIAPVRSNTK # TTQFSKMTGMTGTTAHTAHPAQTLARSNTRDTQNTMQSHSSKNSRSTQNTQDTQNSRRPSQRSHHSSRSNGTIKPMRPRLDGPTDSSSTLVGSAMERK # LHPEESITERIDTSDRLNELRNLMEKEKEPLQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 Scaffold_11 AUGUSTUS gene 1184277 1184687 0.59 - . g251 Scaffold_11 AUGUSTUS transcript 1184277 1184687 0.59 - . g251.t1 Scaffold_11 AUGUSTUS stop_codon 1184277 1184279 . - 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_11 AUGUSTUS CDS 1184277 1184687 0.59 - 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_11 AUGUSTUS start_codon 1184685 1184687 . - 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MKRPREDDRNMPSYSSADPDFVDNGQQHNDMNAGNDMGTPYLPTIEEHPRNFELPLNSGELGSLPVHEPFLDWSVSSN # QWVPISENENALDSWAATVPNDTNQFGFYNYSTSSESITNFPFTGEQSSDQQLEDNER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 Scaffold_11 AUGUSTUS gene 1186485 1187006 0.98 - . g252 Scaffold_11 AUGUSTUS transcript 1186485 1187006 0.98 - . g252.t1 Scaffold_11 AUGUSTUS stop_codon 1186485 1186487 . - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_11 AUGUSTUS CDS 1186485 1187006 0.98 - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_11 AUGUSTUS start_codon 1187004 1187006 . - 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MQPRNPQRSIQATVDAILSTRKPFEVPKDPAIVKGIFVDLANCIKDLEEDIAGLRQTLSTPLSHENTLSQTSLQPNRE # KRIAVVSQYPNHPSPPVEGYSVNDLTRDLKTFGYYEDRARHFGSSSSRKLVKDALDVKKEYTGGADFVNVKPSFKRLEFWSVQPVIRLSDKPAQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 Scaffold_11 AUGUSTUS gene 1190401 1191057 0.63 + . g253 Scaffold_11 AUGUSTUS transcript 1190401 1191057 0.63 + . g253.t1 Scaffold_11 AUGUSTUS start_codon 1190401 1190403 . + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_11 AUGUSTUS CDS 1190401 1191057 0.63 + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_11 AUGUSTUS stop_codon 1191055 1191057 . + 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MEMFSTSSRRSTGHVRLSSSSSTHIDFVKPRKPTWALPGKKLWKNSQLARKIHRTLTLFPVPWRNAPVSVQSISPPRK # FEIDASSDRTRTDSTLENFRRGGFRNSGTRTETTESALATSSRYDYYNTIQEEDEEDDHSDLGLEDSGANNEREHLISDDSDHLDLDEVMIISETGDN # FTMHSHSTNVATLRIPPSPVRARSDSPVQPVGLPNTRFLFSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 Scaffold_11 AUGUSTUS gene 1191437 1192198 0.71 + . g254 Scaffold_11 AUGUSTUS transcript 1191437 1192198 0.71 + . g254.t1 Scaffold_11 AUGUSTUS start_codon 1191437 1191439 . + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_11 AUGUSTUS CDS 1191437 1192198 0.71 + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_11 AUGUSTUS stop_codon 1192196 1192198 . + 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MLRRLFPRNDMDNSRPPVLPPRPPLEHVTAHTRNESASTDDSHALPVLSSPPYHSSPLPDEFLIARSDSPPPPPSNLS # SPPYTVTNFSVSRPELYHDRRDRDHGLPMILAPPSPPPLLYHNANSNHHRLMSLPSNVGSGNDRDPHPDFELPGGDRVTNLQSGLAEHRGYPFEATLS # PRSHFRNFSDDSLTASVRHAQDVTSASVDNRLLFPGAVRAVGYMSTNANNRGLQIQRSYESFQTALSDSQSSDSRRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 Scaffold_11 AUGUSTUS gene 1201633 1202427 0.83 - . g255 Scaffold_11 AUGUSTUS transcript 1201633 1202427 0.83 - . g255.t1 Scaffold_11 AUGUSTUS stop_codon 1201633 1201635 . - 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_11 AUGUSTUS CDS 1201633 1202427 0.83 - 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_11 AUGUSTUS start_codon 1202425 1202427 . - 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MSSPPPSIDAPSLPLDYPLSQIAPSPVVPAEETINDPPPPYPSPRTRRARGTRQNRRAPETLQRISTQHSRIPSNESD # NEVQRSPRTSLRPSVVENPGADASEITPLLAGSSSSRSAILRPRSLSQSSINSFAPSLASLAQTAWVFFSECDSDDEESRSENGHDSEGEENGGPSHV # GRRPPACAVSVEIREDGSIPPESGGFFSSKAWARYFHPVFRGVYWRSLTHLVAVNFPFALLAWVYLFVFTVVRLIYLDEIMYCVAENA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 Scaffold_11 AUGUSTUS gene 1203322 1203831 1 - . g256 Scaffold_11 AUGUSTUS transcript 1203322 1203831 1 - . g256.t1 Scaffold_11 AUGUSTUS stop_codon 1203322 1203324 . - 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_11 AUGUSTUS CDS 1203322 1203831 1 - 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_11 AUGUSTUS start_codon 1203829 1203831 . - 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MARHGIPATDTTRRAALKHGMLRVAVAPPSNDISTSVLIFPTPRPSVTILFQYYNRWANHEQSAKLSVELYAKTEKKM # EDMQITSDLTWIEVQFMKKAVEEVEKCRMTLKWTYAMAYYLARGNEKDLFEDNQRDLEKAVEDLSELLESPIETENIPVLRQKVTDKTVSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 Scaffold_11 AUGUSTUS gene 1204529 1205356 0.2 - . g257 Scaffold_11 AUGUSTUS transcript 1204529 1205356 0.2 - . g257.t1 Scaffold_11 AUGUSTUS stop_codon 1204529 1204531 . - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_11 AUGUSTUS CDS 1204529 1204996 0.66 - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_11 AUGUSTUS CDS 1205047 1205216 0.26 - 2 transcript_id "g257.t1"; gene_id "g257"; Scaffold_11 AUGUSTUS CDS 1205254 1205356 0.75 - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_11 AUGUSTUS start_codon 1205354 1205356 . - 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MSSDYEISDNEGDYYDSDEMMEDYQNDGKFTALLYQDEDDMEMDDYNDDFRINAGPKRKSYEVDYTSLSQSSVEESLK # EDVDHICGILGVDPAVAALLLRHQGWNKESLIEKYMENPTKVLVDSGAAVPEPAREPIVRAHSVDRSAAGPSSRRAIRSNSKLLSSLTSPTRSSAQKS # ISSPVASASKFRKDAKSSEEPESFVCPSASTTLQNSNRSLSIVVIQLALDAGMLTPFQRFVMKANIVFGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 Scaffold_11 AUGUSTUS gene 1205986 1207027 0.33 + . g258 Scaffold_11 AUGUSTUS transcript 1205986 1207027 0.33 + . g258.t1 Scaffold_11 AUGUSTUS start_codon 1205986 1205988 . + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_11 AUGUSTUS CDS 1205986 1206186 0.33 + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_11 AUGUSTUS CDS 1206264 1206391 0.9 + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_11 AUGUSTUS CDS 1206493 1207027 0.91 + 1 transcript_id "g258.t1"; gene_id "g258"; Scaffold_11 AUGUSTUS stop_codon 1207025 1207027 . + 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MLEQSNSTLLQYPTQFTQNIVPKQIHSHNDCRSFRQIIGLKLMLALDWRDVPLLTALSFGVASVEADVGHELAALTPD # RTFESLYIQPLLAILARQNPVNAFTANQTSLKYEDGWEQVAIFLIFVLPYLSGINSTLAPVVQALEPLRQLKYLTTFVNDTLTLSAITAVGTGNTPLD # GIKALSPRDVFFDAPLTELNDPITTYNVTLSPLASTDYEPAIGWHGIGNISEAQLGNLTTFINDAHSRGIKARFWDTPGWPIQARHAVWEQLLNAGAD # WLNADDLEAASQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 Scaffold_11 AUGUSTUS gene 1207938 1208351 0.55 - . g259 Scaffold_11 AUGUSTUS transcript 1207938 1208351 0.55 - . g259.t1 Scaffold_11 AUGUSTUS stop_codon 1207938 1207940 . - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_11 AUGUSTUS CDS 1207938 1208351 0.55 - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_11 AUGUSTUS start_codon 1208349 1208351 . - 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MLIVILNLLPLSGTAVYLFGVTSQNDTGTIEFTLDGNNATTYNPPVIAADDPTVGTPEADHTYNSLFFVATGLANGSH # QLGFTAVLAYNTSQTVLIDYAVVTTDDSTSSGSSSASGSGTSASASESASGSSSLLIQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 Scaffold_11 AUGUSTUS gene 1214156 1215752 0.42 + . g260 Scaffold_11 AUGUSTUS transcript 1214156 1215752 0.42 + . g260.t1 Scaffold_11 AUGUSTUS start_codon 1214156 1214158 . + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_11 AUGUSTUS CDS 1214156 1214687 0.47 + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_11 AUGUSTUS CDS 1215130 1215752 0.65 + 2 transcript_id "g260.t1"; gene_id "g260"; Scaffold_11 AUGUSTUS stop_codon 1215750 1215752 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MFYATQISSHYPKDLFGNSDNPAAAGNAAASSSSSTTNRNSNPHFSTSGGARKGGRRIGTQERPLETVYYDTLGVPVT # ATTDEIKKAYRTSFKSSQISYHITYMYIFYRTPGNQTPPGQKPSDPLAADRFKSIAIAYQTLSDPALRAKYNEFGARESAPEGGFVDPEEVFSAIFGG # RENFHMNPTDPNSYKQSDSYTSPKPNNSSPQTKLSSASAGGYTTFKGNIMFLVKRTSSMYIFYPIIHSTPMHRVSTLRSALELKSVFDQIQAAEKAGN # LSPEERQKLEEQAAEKGLQALFKGAKLEIDSVLREVCDRILLLEAEDPSSSSVGREKAVLRAAALQILGEAYVGVGTRKGGVGIQASSASSADHQYPH # SRTSSPASRNPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 Scaffold_11 AUGUSTUS gene 1216328 1216792 0.58 + . g261 Scaffold_11 AUGUSTUS transcript 1216328 1216792 0.58 + . g261.t1 Scaffold_11 AUGUSTUS start_codon 1216328 1216330 . + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_11 AUGUSTUS CDS 1216328 1216792 0.58 + 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_11 AUGUSTUS stop_codon 1216790 1216792 . + 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MKNRQLSLRYRSFNVDALKKVVVHAAGGNSVLKMEKLAEGSYNKVFVLTLDNGQELIARIPTVIAGPGKLVTASEVVT # MDYARSIGWPVPRVLAWCADASSTPVQSEYIVMEKASGVELGRVWDQMSSDQKDDTVREVVDIEKRIMKPFFKGIW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 Scaffold_11 AUGUSTUS gene 1221673 1223009 0.6 + . g262 Scaffold_11 AUGUSTUS transcript 1221673 1223009 0.6 + . g262.t1 Scaffold_11 AUGUSTUS start_codon 1221673 1221675 . + 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_11 AUGUSTUS CDS 1221673 1222140 0.6 + 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_11 AUGUSTUS CDS 1222257 1223009 0.89 + 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_11 AUGUSTUS stop_codon 1223007 1223009 . + 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MPKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFYDHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQI # TRAWEQGKKLVDDGILTNFRPTTVATPFTAPTRDPNAMDIDATTTRSPDAFRRFMIGDAMDVDLRNIARLMATMSGTSSAAPGTIIAATPDLAATSKF # LLGKLPNYTRIFKLGTRHRCSVFPKSYSRSPSSVYASITSCTISALEFNDISHFRVPIELKGRFRSTTSAAMIDSGATGLFLHQKFVNKHHIYVHPTR # PIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILGLPWLRKVNPDINWRDGQIQIPAKPKVQHHVAIEEIPEPKEPNVGGNTE # QILEPNRAESNGLPHTVPKLSWVQRQLKLARPWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 Scaffold_11 AUGUSTUS gene 1225349 1226059 0.53 + . g263 Scaffold_11 AUGUSTUS transcript 1225349 1226059 0.53 + . g263.t1 Scaffold_11 AUGUSTUS start_codon 1225349 1225351 . + 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_11 AUGUSTUS CDS 1225349 1226059 0.53 + 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_11 AUGUSTUS stop_codon 1226057 1226059 . + 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MARLNELTKKSKDTSGCMLADVRMTGTVFFLLPNSLLTLEYILPTTKHHLKCSTDTPEFSIPIGSWKEYPSITDRLDA # LRHAREDAEAALRMSKQRIADTIAEHPNQPSFEVGQPVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGN # EVNGILPAPPEPEVIDGEEFYDVDRILDSRIHGRWKKLQYLVRGKATTRAMTPGKMRKMW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 Scaffold_11 AUGUSTUS gene 1229880 1230785 0.97 + . g264 Scaffold_11 AUGUSTUS transcript 1229880 1230785 0.97 + . g264.t1 Scaffold_11 AUGUSTUS start_codon 1229880 1229882 . + 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_11 AUGUSTUS CDS 1229880 1230785 0.97 + 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_11 AUGUSTUS stop_codon 1230783 1230785 . + 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MEEEEQFEYSTLYTGDGQPVQVLTPRRGQPPMVAPARGQSTTRIESAILQAIARRTGKQPQRCAASESPRDPPPHFDV # NTGDHDNQDPPVDPKDPGADNNNDDLDNDSGGLPRGEPGDPSGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSDSKSKVKE # PEVFDGSDPQKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDLDLNSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLK # MKETENIRKYNIRFNTLAARTNWDSAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 Scaffold_11 AUGUSTUS gene 1230830 1231348 0.69 + . g265 Scaffold_11 AUGUSTUS transcript 1230830 1231348 0.69 + . g265.t1 Scaffold_11 AUGUSTUS start_codon 1230830 1230832 . + 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_11 AUGUSTUS CDS 1230830 1231348 0.69 + 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_11 AUGUSTUS stop_codon 1231346 1231348 . + 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MAYLPEPARLADYRQEVLCINNCYWKREETRKHEAGKPFIAQNPKKGSSDFKTGSTNQQNNSQPSGSLAPFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSKRERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 Scaffold_11 AUGUSTUS gene 1231680 1232410 0.43 + . g266 Scaffold_11 AUGUSTUS transcript 1231680 1232410 0.43 + . g266.t1 Scaffold_11 AUGUSTUS start_codon 1231680 1231682 . + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_11 AUGUSTUS CDS 1231680 1231699 0.43 + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_11 AUGUSTUS CDS 1231768 1232410 0.74 + 1 transcript_id "g266.t1"; gene_id "g266"; Scaffold_11 AUGUSTUS stop_codon 1232408 1232410 . + 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MANIAVRIGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINTVVQRSLFRYRNFRRRFHRQFWRPLLGTHSL # SLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYA # EFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYLCLKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 Scaffold_11 AUGUSTUS gene 1236233 1236631 0.52 - . g267 Scaffold_11 AUGUSTUS transcript 1236233 1236631 0.52 - . g267.t1 Scaffold_11 AUGUSTUS stop_codon 1236233 1236235 . - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_11 AUGUSTUS CDS 1236233 1236631 0.52 - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_11 AUGUSTUS start_codon 1236629 1236631 . - 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MTTSRTTTTTASSTAGPSRSRPVPPPPPTDPAVHEEEGLEDKDEDDIIRRAQERVEKVRARKAAAAAKKAAEEKAARA # AAARERAVQERESGLVNKRRRLWSGEGSWPRRQPPEVKEGPLQVRCPLLLGGLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 Scaffold_11 AUGUSTUS gene 1238631 1239128 0.76 + . g268 Scaffold_11 AUGUSTUS transcript 1238631 1239128 0.76 + . g268.t1 Scaffold_11 AUGUSTUS start_codon 1238631 1238633 . + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_11 AUGUSTUS CDS 1238631 1239128 0.76 + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_11 AUGUSTUS stop_codon 1239126 1239128 . + 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MHQPRPHCLVDLDHISTSAQLLPETQSALAVMSEFPQEHHHLFHNHPNIPWVHPPPHAPADHSYPMYYAPYPVYQNFQ # PPPASPRPMTPRFKIKYSSIHVTFLVTIKDADSLKDRKSWVKWNEGVWQAVTDGFVLGHICDEPSSGTPWMEWNTPLIRPTVSSQPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 Scaffold_11 AUGUSTUS gene 1241792 1242562 0.52 + . g269 Scaffold_11 AUGUSTUS transcript 1241792 1242562 0.52 + . g269.t1 Scaffold_11 AUGUSTUS start_codon 1241792 1241794 . + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_11 AUGUSTUS CDS 1241792 1242562 0.52 + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_11 AUGUSTUS stop_codon 1242560 1242562 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MTTYDSGTDSTNGPRPRRTAKLMELGKEWREGKMVYDLKIDGTKKARLVAQGFTQRPEDYGNVHAPVTWMVSYRIVMA # WTAQMDLELFSFDVKQAFLNAPLAKEIYVKQVPGRPINNQPNTVYRLHRALYGLHQASAAWYATLCKALDDIGFQRCECNNAVFIGRWTMPPDSSISM # PTNGDPLIMLIPVHVDDGLVSTNSIGLYQWFITQINCRFKVLDLGPTLTFLGLEYIETINGISYGSHRSHTSKNSWNSMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 Scaffold_11 AUGUSTUS gene 1248030 1248353 0.45 - . g270 Scaffold_11 AUGUSTUS transcript 1248030 1248353 0.45 - . g270.t1 Scaffold_11 AUGUSTUS stop_codon 1248030 1248032 . - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_11 AUGUSTUS CDS 1248030 1248353 0.45 - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_11 AUGUSTUS start_codon 1248351 1248353 . - 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MGESPIHQIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANHDKPIKTFEEMVPEQYQDFKKVFSESASE # LPAHQPWDHAINLVPGAPATMQTKITQCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 Scaffold_11 AUGUSTUS gene 1249741 1250094 0.94 - . g271 Scaffold_11 AUGUSTUS transcript 1249741 1250094 0.94 - . g271.t1 Scaffold_11 AUGUSTUS stop_codon 1249741 1249743 . - 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_11 AUGUSTUS CDS 1249741 1250094 0.94 - 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_11 AUGUSTUS start_codon 1250092 1250094 . - 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MSDPAPTTSAAPTANDLMTLLIRQVANLAIAMEERSSSKSSMNKPKVFKGKGSSETRRFMAQFQNWASEQPDLAKSQV # KLIKSALGFFTESAGDWATPHLLHFSAENPPFEEIGICS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 Scaffold_11 AUGUSTUS gene 1256306 1257092 0.67 + . g272 Scaffold_11 AUGUSTUS transcript 1256306 1257092 0.67 + . g272.t1 Scaffold_11 AUGUSTUS start_codon 1256306 1256308 . + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_11 AUGUSTUS CDS 1256306 1256347 0.97 + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_11 AUGUSTUS CDS 1256407 1256721 0.96 + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_11 AUGUSTUS CDS 1256778 1257092 0.68 + 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_11 AUGUSTUS stop_codon 1257090 1257092 . + 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MAVVGVDFGTLASKIGVARHRGIDIIANEVSNRATPCVYQLIVLVQIVTILYRSLVAFGPKQRAIGEAAKTQETSNFK # NTIGSLKRLIGRTLNDPDVQDIEKKFINAALVDVQGTVGVEINYLGERQKFSATQLVAMYLGRLRDTASAELKTTVSDIVIAVPGWFTDVQRRAILDA # ASIANLNVSVSSTTLLLLLWATVLPRLIFQKPTTPSTSRLSTSDTRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 Scaffold_11 AUGUSTUS gene 1257180 1258109 0.55 + . g273 Scaffold_11 AUGUSTUS transcript 1257180 1258109 0.55 + . g273.t1 Scaffold_11 AUGUSTUS start_codon 1257180 1257182 . + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_11 AUGUSTUS CDS 1257180 1258109 0.55 + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_11 AUGUSTUS stop_codon 1258107 1258109 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MLLSNTLLQSSRKSTKLTFYPPKSRFPARSCYRKAQEVLSANAEAPINVESIMNDIDASSKLTRDDLEGLIADELSRI # VAPIQRAIDDSGLNLDEIEVVELIGGSSRIPAVRARIAECFPGKTLSTTLNQDEAVARGATFSCAMLSPVFRVREFSVSDINAYPIKVQWAPVPSDPE # EDTELVVFGEGNAMPSTKILSFYRKDPFDIEAVYAKPENLPGGINPWIAKFTAKEVPLLGQENPADAVQVKLKTRLNANGILGFEGAYVETREDKDEP # APMDVSKVVRLQLRHQRRRKLSNTKSIHCRQFSHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 Scaffold_11 AUGUSTUS gene 1260932 1262732 0.41 + . g274 Scaffold_11 AUGUSTUS transcript 1260932 1262732 0.41 + . g274.t1 Scaffold_11 AUGUSTUS start_codon 1260932 1260934 . + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_11 AUGUSTUS CDS 1260932 1261132 0.41 + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_11 AUGUSTUS CDS 1261590 1262732 0.88 + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_11 AUGUSTUS stop_codon 1262730 1262732 . + 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MQRKANRPAERTGLPSVRAGVEDKENSEGNVEMAAEEVCEAEETIVTTIPRLTITGCACKTLTTPMGCTTLLPGVSRV # ETYDALEGRRAQIDGEFGFRQALVGGGSVPPAGPASNENQIRFVGGQTDRPAPELAGSAARHRSPSSSDGAMDVIQSTEHNSEGRIQEVTTPSFHGQL # DMTAQSSAMLNPNPMMGRSADSQGERREQPEGQGSQTERMEEHLLGEEENQAQRGDNTRGREEDENQGYDSPDNTPPFRPNHQTRWQLEKQQRKSTKA # GLNGVSLNLNGYRGTGPHQKGNRWTRLNTILKENRIGIAIVQETHMTEPKRAQTEHVFHKQMKIFASNHPTNPTTAGGVAVVLNKQFLPTTGAESEEI # VPGRALLVKTDWHRGDQITVLAIYAPNVTANDGTESAAFWEELRSFFERPENRQWRPDLVAGDFNMVEDAIDRLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 Scaffold_11 AUGUSTUS gene 1304647 1305153 0.99 + . g275 Scaffold_11 AUGUSTUS transcript 1304647 1305153 0.99 + . g275.t1 Scaffold_11 AUGUSTUS start_codon 1304647 1304649 . + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_11 AUGUSTUS CDS 1304647 1305153 0.99 + 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_11 AUGUSTUS stop_codon 1305151 1305153 . + 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAIGNIRLRISPSIRILAKEYSDTAKK # LWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLEALILYLSSHHVTLSLSKPCLSLKLQSSRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 Scaffold_11 AUGUSTUS gene 1305180 1306841 0.98 + . g276 Scaffold_11 AUGUSTUS transcript 1305180 1306841 0.98 + . g276.t1 Scaffold_11 AUGUSTUS start_codon 1305180 1305182 . + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_11 AUGUSTUS CDS 1305180 1306841 0.98 + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_11 AUGUSTUS stop_codon 1306839 1306841 . + 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MNAFSGDTIGNSQPQNANKFSNVHRKGNDPKFSQQQHGNGSNQQQKGQNGNDDNKKKRKRGSGKNKKAKKNANAAQAD # ADSMDFSPIGSTVDFGPVRTDLTPSVQDVRKHSIHPPYNPPPNATSLHLHKKTRMAIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPPTKRTR # AMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREILAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDLLSRLYN # YRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIA # PVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAE # GVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKRAELFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 Scaffold_11 AUGUSTUS gene 1306905 1308548 0.68 + . g277 Scaffold_11 AUGUSTUS transcript 1306905 1308548 0.68 + . g277.t1 Scaffold_11 AUGUSTUS start_codon 1306905 1306907 . + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_11 AUGUSTUS CDS 1306905 1308548 0.68 + 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_11 AUGUSTUS stop_codon 1308546 1308548 . + 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MVAENLDPMHLMSSLRTKVSKHNGHLLISTQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTPMR # RHKWKTPYEILYNKVPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHRSTRLPD # RNPDPKDPIPPPGDDDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERP # KRDIQRRAPQPGSSSAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPK # AEREEWLKACQEELEALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDV # RNAYLYGVLHETIYMEQPEGFRIKGKEDKVLLRKALYGLKQAGLVWWRTLDSYMKTLGFKRLSSDAGIFIRRGKDAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 Scaffold_11 AUGUSTUS gene 1318545 1320154 0.32 - . g278 Scaffold_11 AUGUSTUS transcript 1318545 1320154 0.32 - . g278.t1 Scaffold_11 AUGUSTUS stop_codon 1318545 1318547 . - 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_11 AUGUSTUS CDS 1318545 1318897 0.5 - 2 transcript_id "g278.t1"; gene_id "g278"; Scaffold_11 AUGUSTUS CDS 1319025 1319347 0.56 - 1 transcript_id "g278.t1"; gene_id "g278"; Scaffold_11 AUGUSTUS CDS 1319814 1320154 0.92 - 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_11 AUGUSTUS start_codon 1320152 1320154 . - 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MDVWIDFKNASKWQAEALFRNFFPSCEEDSSSGDQEKKASRASTPTPVSPSSSLPSLRSSFSSPSPSYRQSRASSTSP # AEPTDDGTITLDPGSLPPSAPELSAKKKPNLLRWVFLVQAAPEFAQKVPDEEFSVAALQGYLLRNKSRPEEAVKGVEAWVEEERRNKEKQKGGKGKGK # GSEEERKKRREQRKERREKKKKGSAQSNPVSAAVSVNTNQPSDPPIPPESEASTKKIKSKSKSKSRKSKSASKSDDNDGSDSDSSSSSSTDSESSSNS # DSDSDSSSDSSSDDDDENTDPRPRQSTTSMARSPPSPPIPSYDWSVEPAAWESTPANGGWGKGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 Scaffold_11 AUGUSTUS gene 1333771 1334790 0.39 + . g279 Scaffold_11 AUGUSTUS transcript 1333771 1334790 0.39 + . g279.t1 Scaffold_11 AUGUSTUS start_codon 1333771 1333773 . + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_11 AUGUSTUS CDS 1333771 1334376 0.39 + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_11 AUGUSTUS CDS 1334497 1334790 0.66 + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_11 AUGUSTUS stop_codon 1334788 1334790 . + 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MQSHPLNVLTKVCTQWSQLAVGTSELWRDIRIDFVDCDVDYKAGFWNELGKGILEFWFDQSAAHMLQVELIIEEPNYA # DHHWGDPKHQNLDISFPRCMRSFDDAFSMLPWARLPHLGLRELESRPPGACSSRLYQTPLFGLNNIYSWDPNLDHSLPSKSSIILPDLYQLTTSLGVS # DHWEYLEYLHAENLIDLTLHLMARVHDFANTEIIHAIEGSESEAEWAEPFLNEDVFVSLIWEPQWGPVLLPLLQTFTGNGVDIDAFDVAMAIMESRVN # RGLKKVSFNIEAGDSYKDVWENWKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 Scaffold_11 AUGUSTUS gene 1338333 1338773 1 - . g280 Scaffold_11 AUGUSTUS transcript 1338333 1338773 1 - . g280.t1 Scaffold_11 AUGUSTUS stop_codon 1338333 1338335 . - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_11 AUGUSTUS CDS 1338333 1338773 1 - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_11 AUGUSTUS start_codon 1338771 1338773 . - 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MPLTQLSRDIRDPRDAYYDKYDKYDSRPPPSSGGASAYPPQSSIPANYDRPRSPPPPRSAAYPAGYRDPRDVRDSRDV # SDMRDPRDIVRDARDPRDIRDVRDVRDVRDMRDIRDPRDMRDVRDVRDMRYPRDDPRRFSMPPPPLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 Scaffold_11 AUGUSTUS gene 1339766 1341573 0.48 - . g281 Scaffold_11 AUGUSTUS transcript 1339766 1341573 0.48 - . g281.t1 Scaffold_11 AUGUSTUS stop_codon 1339766 1339768 . - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_11 AUGUSTUS CDS 1339766 1340829 0.74 - 2 transcript_id "g281.t1"; gene_id "g281"; Scaffold_11 AUGUSTUS CDS 1341024 1341270 0.95 - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_11 AUGUSTUS CDS 1341340 1341573 0.61 - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_11 AUGUSTUS start_codon 1341571 1341573 . - 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MLPPGKSDLEILENLKERIKKGQHEFFRATPMPELLAGLYLGPSGGSAQDLDAVQEKGSVAVAAAASTNGDGNVGNNK # ASFSTTTMTSPLAISSENSPSKITSMSTFHQETNGPKSSNENGSKSATSMPPNPTDSSSHGLNNSINMGLPAKPPLTNAHGTNTRERDRDNHNNNRDK # DHDSRRSSSVSVSGAEYASVRYGPIRDIRDIRDNKDGITSMRRDGRRPSTAFHYDSASYREEDYLPPSDDYRRLSGPPSTPQALPNERYSRPPRLLTK # DTVWTIVIRSVFPLSSTPSSSPTSSAYGPSFRPDERERHRYDTHSNTNYPANHNHHVPHTGITPPTRPNHVHNSTHVLASRYNENRPQIGESPVAAAA # AAEREQRERAAAEREQREKLERERDRERMGNTRDFRERDMRPPPPPPSQVHQAAPAKLEERIASRAPTLQERLSQPPVGESSRTLSLEERLSNHPNTG # TGTNTVAGPPASPASSKGGSVAPVPPDSASSAASSEFIFTWVLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 Scaffold_11 AUGUSTUS gene 1346798 1348033 0.75 - . g282 Scaffold_11 AUGUSTUS transcript 1346798 1348033 0.75 - . g282.t1 Scaffold_11 AUGUSTUS stop_codon 1346798 1346800 . - 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_11 AUGUSTUS CDS 1346798 1348033 0.75 - 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_11 AUGUSTUS start_codon 1348031 1348033 . - 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MVATERKLRAETESKLQRQQQDLKEELREARAQREALRSALQVVESEMDVLRMGLGGRDLDGGTANVDPVLRRNVIQP # LEIPEPDESSDEGYLPESEYSALPQTASTMSILSAMSSMSAVHGMPGIPSQSESEAPPEPSFTVPHANNHSESHSEETHPHPQSRSRSSSQRGIKSPP # SSRPGSRTSRRSGYSDFAGYSRPNSVVIPFQNDGGRRDIPHGDLSQVKESPPAPSTSGSVPTPATPTVKRNEPNQFSRSSSSHLDQLAHGIPNSNLFT # NKLQTSSSFSTQSHSTLDSALDSTRAISRSPSPVAYSHQPPQSQPPSHSPPSDSQEPSSFVPPSDSKSSDSTHSKLAQAVKVDQEDEEWDNDTSQRTG # TEESKAEEDVSKFASTSSPVLTPTMNFIPGMEEKSPWAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 Scaffold_11 AUGUSTUS gene 1348183 1349377 0.96 - . g283 Scaffold_11 AUGUSTUS transcript 1348183 1349377 0.96 - . g283.t1 Scaffold_11 AUGUSTUS stop_codon 1348183 1348185 . - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_11 AUGUSTUS CDS 1348183 1348815 0.99 - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_11 AUGUSTUS CDS 1348949 1349377 0.96 - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_11 AUGUSTUS start_codon 1349375 1349377 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MFPSTSPSIPSAGKRFDSLNATQRRAPTNNVLSKSRPVNEFGRNNAQGSTRKVFIAKDEGFFMSVEDELHDLRRVHTH # GQEDDLRMALDRCMGRVGELVGLLAAAYSALTDVRVELDVTRSNLQMITANNDMLEDALKSMSNKHGTDPRDVGSVGWRRSGPNPNSTAVTPSSSSTH # INTISNDLTRPMNGEAPIPGTSPPSSPPLPASESTTQPMAIPPAPTPQPAPAPQESRFFKFRFNSTSSSSTNSRPQTPIVGNDTASPTIGNLTGRHRT # ESSSSVSLLAGGGSIASGPDDVANANSFDDLRRDIEALKTQMARDKAELEKLKAELDVEKTRREKEERKWGKQRRRRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 Scaffold_11 AUGUSTUS gene 1354015 1354506 0.9 + . g284 Scaffold_11 AUGUSTUS transcript 1354015 1354506 0.9 + . g284.t1 Scaffold_11 AUGUSTUS start_codon 1354015 1354017 . + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_11 AUGUSTUS CDS 1354015 1354506 0.9 + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_11 AUGUSTUS stop_codon 1354504 1354506 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MYDSKELSMSPPISIDDSIVKKYALTKEEWQAVQFGIDINHLSYFLLFRTKLLESETNQKMFHEWLQTQKLDSLETAA # LACRTFRDVAEFWSDRSTGAESQFKLQHRTGWKLWTKKYQEFSEGALSFMQDLKPLFDIVTGMGIPYVGLAIGTVTMLFTVRNPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 Scaffold_11 AUGUSTUS gene 1377547 1378143 0.61 + . g285 Scaffold_11 AUGUSTUS transcript 1377547 1378143 0.61 + . g285.t1 Scaffold_11 AUGUSTUS start_codon 1377547 1377549 . + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_11 AUGUSTUS CDS 1377547 1378143 0.61 + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_11 AUGUSTUS stop_codon 1378141 1378143 . + 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MSYAIRITTHAVQAVTGADDEVIVSASSSGAKGGLRSKWGGGELRARGKMVRQGSGWTMESNPASPAIGSGYGSYTNT # PLSQSFSPAPSPYLASPSFGSPMMPSSNPGTPIPGASFPASPRPSSLYHSRPPSMSGGLVPGPGASTIGLGGAYPPSIPGTPSFSNFPPTPNPVNGNG # SGFPAGPPPRRTPSGGSGKKDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 Scaffold_11 AUGUSTUS gene 1378964 1379392 0.92 - . g286 Scaffold_11 AUGUSTUS transcript 1378964 1379392 0.92 - . g286.t1 Scaffold_11 AUGUSTUS stop_codon 1378964 1378966 . - 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_11 AUGUSTUS CDS 1378964 1379392 0.92 - 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_11 AUGUSTUS start_codon 1379390 1379392 . - 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MKFLAAVSIIALLTSSTLARPGSNLSQRIASRRANGRKSQPKIKSQSSIVETNSTFHEEYSENWAGVFFESPPSGETY # STVTGTFTVPSISGNGAASAWVGIDGVTYTDAILQAGLDFTISDGTISYDAWYEWYVVFKFLFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 Scaffold_11 AUGUSTUS gene 1381048 1381635 0.85 + . g287 Scaffold_11 AUGUSTUS transcript 1381048 1381635 0.85 + . g287.t1 Scaffold_11 AUGUSTUS start_codon 1381048 1381050 . + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_11 AUGUSTUS CDS 1381048 1381635 0.85 + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_11 AUGUSTUS stop_codon 1381633 1381635 . + 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MTLPIDEFIVWEPGTGSKRSQWSCLACDDHVWRDANLARRHENGKGHQQAVKHHREASHYSAPDPFVPNPGTSRRVSP # PLESLLMDLSEGPYETQGHDEPFDFENVQPSSDRNTQPVYGITFDPTEDFTLQPSDVERGMARFAEEMHAWLLEEPDSENSEDEIEECDDLEDDAFGA # FSHYLPELCSSQNAIHSWV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 Scaffold_11 AUGUSTUS gene 1386879 1387478 0.67 + . g288 Scaffold_11 AUGUSTUS transcript 1386879 1387478 0.67 + . g288.t1 Scaffold_11 AUGUSTUS start_codon 1386879 1386881 . + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_11 AUGUSTUS CDS 1386879 1387478 0.67 + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_11 AUGUSTUS stop_codon 1387476 1387478 . + 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MEPQAPSHAPSLPSPPPASSSSSKRKLDALDGWPSLEDEAESKQRYNNKRRRIRRKEQAALKGVTRGHELAFKKYVLP # AKSQETALRSEELPFASGGYLAVDNAFHGAQVRCDLERMKAEGFRLVTSEDGWEFSTLLRVYIHSMICRMSVPLTDGENRIMACVLYGSSSKSYRDSV # QTMADANPRYGKADQVEASREEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 Scaffold_11 AUGUSTUS gene 1388261 1388794 0.76 - . g289 Scaffold_11 AUGUSTUS transcript 1388261 1388794 0.76 - . g289.t1 Scaffold_11 AUGUSTUS stop_codon 1388261 1388263 . - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_11 AUGUSTUS CDS 1388261 1388794 0.76 - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_11 AUGUSTUS start_codon 1388792 1388794 . - 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MVQYKVAFHHAQKDLRRSQMQLMLQEDEIAENRKFHSDSLHRNKRQVYVIKELGLRLYKSQMEAEVEHREQHLKQLKD # LERRLGTSENNKYLSNIEELKVQLGREKLLRGNVARILLNEHNPAVAVAESLRLLTPSSEIFSKSTAEGLSIKAEQQPNLFHTAVAKQLLELEDEAWR # V] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 Scaffold_11 AUGUSTUS gene 1407891 1409959 0.08 - . g290 Scaffold_11 AUGUSTUS transcript 1407891 1409959 0.08 - . g290.t1 Scaffold_11 AUGUSTUS stop_codon 1407891 1407893 . - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_11 AUGUSTUS CDS 1407891 1408963 0.38 - 2 transcript_id "g290.t1"; gene_id "g290"; Scaffold_11 AUGUSTUS CDS 1409296 1409959 0.11 - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_11 AUGUSTUS start_codon 1409957 1409959 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKTFIAQEYEVPELLNPGNTATRSPQLRSGTSPTVHALAQNSTPPP # RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA # PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLQGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRS # GGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNR # ITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEA # DEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKAARMA # ESLPRVGIST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 Scaffold_11 AUGUSTUS gene 1411242 1411556 0.51 - . g291 Scaffold_11 AUGUSTUS transcript 1411242 1411556 0.51 - . g291.t1 Scaffold_11 AUGUSTUS stop_codon 1411242 1411244 . - 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_11 AUGUSTUS CDS 1411242 1411556 0.51 - 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_11 AUGUSTUS start_codon 1411554 1411556 . - 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVETWDGTTTTEVYLHGLRPTCQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 Scaffold_11 AUGUSTUS gene 1413849 1414550 1 - . g292 Scaffold_11 AUGUSTUS transcript 1413849 1414550 1 - . g292.t1 Scaffold_11 AUGUSTUS stop_codon 1413849 1413851 . - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_11 AUGUSTUS CDS 1413849 1414550 1 - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_11 AUGUSTUS start_codon 1414548 1414550 . - 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MQAQLTSERNIRRKVDQERRDAEFAKREAEHALKETEQRLSDAEQLMSEAEQGRKNAEYALSEVENAKKEVQLSLKEA # VERRREAEQLRRDAEHAKITADDRRKDVEQGRKDAEHDKRKADDRRRDAEQARRDAERATRRAESDKHDADDRRRAAEHRLHDAESAKLEMEQRWKEA # ELARKEAEERRREADAFVADVKRECREPFVVPALMDVFWNVSKVTTQTTSAANEKTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 Scaffold_11 AUGUSTUS gene 1414621 1415064 1 - . g293 Scaffold_11 AUGUSTUS transcript 1414621 1415064 1 - . g293.t1 Scaffold_11 AUGUSTUS stop_codon 1414621 1414623 . - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_11 AUGUSTUS CDS 1414621 1415064 1 - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_11 AUGUSTUS start_codon 1415062 1415064 . - 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MPVVTAVPVTPAVTTGVPIPSFDSGGNINEPRIKEESLNSFINATNVNPSHGEIEASSFVNPGVARIVQLRSELLSLR # NEIRERGKKEKIVLAELAELAENLQTDFVLGEVDGCGFQGFGIGSELGLGLRDDDKIMEKPSSSEIETG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 Scaffold_11 AUGUSTUS gene 1415202 1415663 0.47 + . g294 Scaffold_11 AUGUSTUS transcript 1415202 1415663 0.47 + . g294.t1 Scaffold_11 AUGUSTUS start_codon 1415202 1415204 . + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_11 AUGUSTUS CDS 1415202 1415663 0.47 + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_11 AUGUSTUS stop_codon 1415661 1415663 . + 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MFPSKMKQEHRFVIVLILLRLLLMAPGSCGAGREETAGNALIRELRSDIEIVLELDSPFGTGDNADEVLEIEKESDGE # DDGTTDAVAVENAVRNSVKSTGAMVNKEEGEIAAEEVVTGASLLLSSSFLAGTLATDCDERTWGLYMRRKVLGYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 Scaffold_11 AUGUSTUS gene 1419913 1420722 1 + . g295 Scaffold_11 AUGUSTUS transcript 1419913 1420722 1 + . g295.t1 Scaffold_11 AUGUSTUS start_codon 1419913 1419915 . + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_11 AUGUSTUS CDS 1419913 1420722 1 + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_11 AUGUSTUS stop_codon 1420720 1420722 . + 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MEKEISIVDSTYYETTPYKCVARCPLNLLSLYLFAVLFQPYPETWPRYTPRDKIADWLEQYAVSQDLVVWMKSQLLPA # PSYNKNKMEWAVSIDRDGKIFTINPKHIVLATGTLGGPYTPVIEGRDLFKGQILHSDDYTGAPHFIGKRVVVVGTGNSGADIALDLHVRGAQSVTLLQ # RSVTCVQASETVNGITDQFWRPEVPTEVADYRRAGTPFKLMKQMLSEQKDFYWEKDKHILEGLAKAGMNVNLGPDGSGVFPLVYERLGGRFDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 Scaffold_11 AUGUSTUS gene 1422765 1423986 0.53 + . g296 Scaffold_11 AUGUSTUS transcript 1422765 1423986 0.53 + . g296.t1 Scaffold_11 AUGUSTUS start_codon 1422765 1422767 . + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_11 AUGUSTUS CDS 1422765 1422898 0.53 + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_11 AUGUSTUS CDS 1422990 1423986 0.99 + 1 transcript_id "g296.t1"; gene_id "g296"; Scaffold_11 AUGUSTUS stop_codon 1423984 1423986 . + 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MVFDTSISPSYSSSNTPTRLEEVRSGYPFTTIGISRFQVQEWTHSIPASSLCQGLTASVEASEVLVPKGSVSGTSRPK # FPPRRPIQRALSVSEEDLIPISDLILLTEYPVSVSPLHNPIAAFHEATNYAYFPTSTTEYIDKNQNALISAASPPLFSSANGTQGRGDAAGLLIATVK # SFAERTVHFLYQLIPMKGNWTRWCSRAESEGAQEKQSVRSFCRQDRIDLEARSSLPTDPDRNSAEFWHLESEEDEGHISDIGSPILDDFMLSYSQVER # ASGLEDEDEVCVLLQEGANLPEELMSGLVETSTNEPCSQSVGLDCQIVFPPILNPDDENLSETDSSNNSELDWDGNYAGQTNQSNSVSWDRISVPRTF # PVVK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 Scaffold_11 AUGUSTUS gene 1446811 1447197 0.81 - . g297 Scaffold_11 AUGUSTUS transcript 1446811 1447197 0.81 - . g297.t1 Scaffold_11 AUGUSTUS stop_codon 1446811 1446813 . - 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_11 AUGUSTUS CDS 1446811 1447197 0.81 - 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_11 AUGUSTUS start_codon 1447195 1447197 . - 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MSATSTERPSISKTESKKQKSALSRGNTTQAQKSNPAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTKDLPLDRYRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 Scaffold_11 AUGUSTUS gene 1448286 1448765 0.81 + . g298 Scaffold_11 AUGUSTUS transcript 1448286 1448765 0.81 + . g298.t1 Scaffold_11 AUGUSTUS start_codon 1448286 1448288 . + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_11 AUGUSTUS CDS 1448286 1448765 0.81 + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_11 AUGUSTUS stop_codon 1448763 1448765 . + 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MVLGLVGCGQGMTVPALPSIDQLTADWERMMLQYIHHITDTPLSGTDTQGPMSSVEPATESLPKVLVQQSPEAPAALE # STSSVGPHLRVPLFLPEQESLNSPSPTLPPLFGSVANLVIDLTVDDDELYEPEEVSAGRFSVAREVIGLAAGQDVVKDESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 Scaffold_11 AUGUSTUS gene 1450505 1451347 0.86 - . g299 Scaffold_11 AUGUSTUS transcript 1450505 1451347 0.86 - . g299.t1 Scaffold_11 AUGUSTUS stop_codon 1450505 1450507 . - 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_11 AUGUSTUS CDS 1450505 1451347 0.86 - 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_11 AUGUSTUS start_codon 1451345 1451347 . - 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MWSTLGRSWNDYVPITSTQSRKKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRF # IDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYSPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMIAAELNYDIY # DKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQAQWAELLSGYDFVINYRPGGWELSRTRSPKDQTCTQEGSFKGSGFSRGERV # LISPER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 Scaffold_11 AUGUSTUS gene 1453866 1454657 0.98 + . g300 Scaffold_11 AUGUSTUS transcript 1453866 1454657 0.98 + . g300.t1 Scaffold_11 AUGUSTUS start_codon 1453866 1453868 . + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_11 AUGUSTUS CDS 1453866 1454657 0.98 + 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_11 AUGUSTUS stop_codon 1454655 1454657 . + 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 Scaffold_11 AUGUSTUS gene 1454714 1455262 0.25 + . g301 Scaffold_11 AUGUSTUS transcript 1454714 1455262 0.25 + . g301.t1 Scaffold_11 AUGUSTUS start_codon 1454714 1454716 . + 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_11 AUGUSTUS CDS 1454714 1455262 0.25 + 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_11 AUGUSTUS stop_codon 1455260 1455262 . + 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MMQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 Scaffold_11 AUGUSTUS gene 1455292 1457069 0.3 + . g302 Scaffold_11 AUGUSTUS transcript 1455292 1457069 0.3 + . g302.t1 Scaffold_11 AUGUSTUS start_codon 1455292 1455294 . + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_11 AUGUSTUS CDS 1455292 1456015 0.89 + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_11 AUGUSTUS CDS 1456066 1456468 0.5 + 2 transcript_id "g302.t1"; gene_id "g302"; Scaffold_11 AUGUSTUS CDS 1456552 1456721 0.4 + 1 transcript_id "g302.t1"; gene_id "g302"; Scaffold_11 AUGUSTUS CDS 1456780 1457069 0.68 + 2 transcript_id "g302.t1"; gene_id "g302"; Scaffold_11 AUGUSTUS stop_codon 1457067 1457069 . + 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVDESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYE # DHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNK # LHFNDPNSHKRVTVGTYPRGQKGRNIQINTSQYNEPKNVTPDNEKSTSENDSKGNFHSSMTEHRIRWIQKCEQEKFSKKELSEAYVLASRKHLKSQDD # QAKEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDNQLNNEQFNLNPIKVILPSEWKNQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 Scaffold_11 AUGUSTUS gene 1459203 1460323 0.72 + . g303 Scaffold_11 AUGUSTUS transcript 1459203 1460323 0.72 + . g303.t1 Scaffold_11 AUGUSTUS start_codon 1459203 1459205 . + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_11 AUGUSTUS CDS 1459203 1459499 0.85 + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_11 AUGUSTUS CDS 1459575 1459614 0.89 + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_11 AUGUSTUS CDS 1460232 1460323 0.76 + 2 transcript_id "g303.t1"; gene_id "g303"; Scaffold_11 AUGUSTUS stop_codon 1460321 1460323 . + 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MPQEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVSSPCLGPPFRRSSLLIVFYFTLQVLLETNASYIKGMLNNPSCGPNATINRWIEHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 Scaffold_11 AUGUSTUS gene 1460364 1460615 0.73 + . g304 Scaffold_11 AUGUSTUS transcript 1460364 1460615 0.73 + . g304.t1 Scaffold_11 AUGUSTUS start_codon 1460364 1460366 . + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_11 AUGUSTUS CDS 1460364 1460615 0.73 + 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_11 AUGUSTUS stop_codon 1460613 1460615 . + 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MVPDGLSQITPGGMANQASRSKSKDYVDEDGGNQLILLWEMGKQKSHINLMILKIKLTLEVVYLYETAQEADDIELDV # QEALG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 Scaffold_11 AUGUSTUS gene 1462487 1462819 0.87 + . g305 Scaffold_11 AUGUSTUS transcript 1462487 1462819 0.87 + . g305.t1 Scaffold_11 AUGUSTUS start_codon 1462487 1462489 . + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_11 AUGUSTUS CDS 1462487 1462819 0.87 + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_11 AUGUSTUS stop_codon 1462817 1462819 . + 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSQSSKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 Scaffold_11 AUGUSTUS gene 1466580 1467539 0.99 + . g306 Scaffold_11 AUGUSTUS transcript 1466580 1467539 0.99 + . g306.t1 Scaffold_11 AUGUSTUS start_codon 1466580 1466582 . + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_11 AUGUSTUS CDS 1466580 1467539 0.99 + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_11 AUGUSTUS stop_codon 1467537 1467539 . + 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 Scaffold_11 AUGUSTUS gene 1475765 1476180 0.55 + . g307 Scaffold_11 AUGUSTUS transcript 1475765 1476180 0.55 + . g307.t1 Scaffold_11 AUGUSTUS start_codon 1475765 1475767 . + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_11 AUGUSTUS CDS 1475765 1475806 0.55 + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_11 AUGUSTUS CDS 1475884 1476180 0.98 + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_11 AUGUSTUS stop_codon 1476178 1476180 . + 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MSDIDADLYGGTLLAADEKLTETPVQQPQVKTEVPATPKAPEAIKTASSNNHSVPTTYAFSNVPTTVAPSVQQIPTYE # EVSNDYTSSRLSGIQSISSSEQRPVRPSEMKDDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 Scaffold_11 AUGUSTUS gene 1483024 1484100 0.8 - . g308 Scaffold_11 AUGUSTUS transcript 1483024 1484100 0.8 - . g308.t1 Scaffold_11 AUGUSTUS stop_codon 1483024 1483026 . - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_11 AUGUSTUS CDS 1483024 1483604 0.82 - 2 transcript_id "g308.t1"; gene_id "g308"; Scaffold_11 AUGUSTUS CDS 1483659 1484100 0.81 - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_11 AUGUSTUS start_codon 1484098 1484100 . - 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MWATEDDKAFARLEGLAPPTAGDEDPVIGIRYTADKENIYAHAELRSWPSHASAEIRLVFLWDPVDSSWKYHNIASMP # FPISATLNVTDAVEQQTPSLAIQVKGDEDDDYWNSYGSDVTKEHIPRNKSNGDISGSEDAYWAQYASVQGTADSTVPTPRRETHGEETFDDALARARG # LHNKGHSDMYDRLEDHHEDQEVINISYNTLNIPHPSTHPSRTSAVNGVCPTDLSDRLNSLPPRTSLSPHVDSASPSPVNASSTVLHDDDYIRPAANTG # TLKVAVNGNDRSHSLTPRPPTTANGNDVDEVTKSVIRGVHEMWKATTSQPASVDEFLRLVGEAISS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 Scaffold_11 AUGUSTUS gene 1484564 1484857 0.89 - . g309 Scaffold_11 AUGUSTUS transcript 1484564 1484857 0.89 - . g309.t1 Scaffold_11 AUGUSTUS stop_codon 1484564 1484566 . - 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_11 AUGUSTUS CDS 1484564 1484857 0.89 - 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_11 AUGUSTUS start_codon 1484855 1484857 . - 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MGKVVGVVVVVELELEELDEEPDEAVGVSVTTPEEVIVVVCEFELTVTSVVTAVESWTEVLVLPELELEPEDEPEDEP # EAEVELLFCTNVSVAIGGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 Scaffold_11 AUGUSTUS gene 1487190 1487465 0.49 + . g310 Scaffold_11 AUGUSTUS transcript 1487190 1487465 0.49 + . g310.t1 Scaffold_11 AUGUSTUS start_codon 1487190 1487192 . + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_11 AUGUSTUS CDS 1487190 1487465 0.49 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_11 AUGUSTUS stop_codon 1487463 1487465 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MNLVSDLKSRGIPIDGVGLQGHFIVGEVPTTIQTVMEQFVALGVEVAITELDIRMTLPETDALLEQQQTDYKNVISAC # NAVAGCIGVSCIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 Scaffold_11 AUGUSTUS gene 1488081 1488476 0.98 + . g311 Scaffold_11 AUGUSTUS transcript 1488081 1488476 0.98 + . g311.t1 Scaffold_11 AUGUSTUS start_codon 1488081 1488083 . + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_11 AUGUSTUS CDS 1488081 1488476 0.98 + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_11 AUGUSTUS stop_codon 1488474 1488476 . + 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MNEPQLESAPDSHESMIDDAALPMSAHVPEPEPEPETIQAIQAPVQAQAPDSAMTEPTTEPESVTMESEELEVQLTEA # EKLHLRLRQDPHDTEAWQRLIAEVEESGNLENIRDTYDALLKQYPNTVRFNDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 Scaffold_11 AUGUSTUS gene 1492162 1493379 0.97 + . g312 Scaffold_11 AUGUSTUS transcript 1492162 1493379 0.97 + . g312.t1 Scaffold_11 AUGUSTUS start_codon 1492162 1492164 . + 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_11 AUGUSTUS CDS 1492162 1493379 0.97 + 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_11 AUGUSTUS stop_codon 1493377 1493379 . + 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MAQLLEDTHSPTKAILSDSQLNNSLPSPAGSFVSKESYSTAISSPTHVDLEIHPITKSTPDTNSSSLILPQNLRKSIS # VDSFVHYGRETLSPVVTRPNRGHTGSALEPPTGLVGLRREFNHVNQPGRSRGDSISSVKSSLAEDSDADRSDTYNSSTERYKHTLKPQDQVRSFVPGG # ELPLPSRTPTLSTTSSMSSIMSSTTSSSTQEATPSLRSASSLQSPARPIASAGRTRSGSLGVYSQNTRRIQINTQIASVSIYKFAVPFFPCISQEQNQ # AITLAVVGTAGCGKSVAIRKGLKNNNLSEPSGPLPGPHPSIRRMNFSLHFYIPSAEFSTDTRSTGTFTRDEGVECPLHVIEVDVISEILQSPITPLDY # LPEALKIDGVIVCYDASDENSFRPVEDLLSEFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 Scaffold_11 AUGUSTUS gene 1494454 1495062 0.99 + . g313 Scaffold_11 AUGUSTUS transcript 1494454 1495062 0.99 + . g313.t1 Scaffold_11 AUGUSTUS start_codon 1494454 1494456 . + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_11 AUGUSTUS CDS 1494454 1495062 0.99 + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_11 AUGUSTUS stop_codon 1495060 1495062 . + 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MYAHYPDRICHLLEIWIRDYSYDFAVRGTAGALSALIKSIISKTYLLHYGSDFLPFLEVLPTLVDRDSSWALKVDDAA # DSDDSYSLLEDDDESIKSATKLTSSPPEDPGKTSVSVPSRSRKSSIPLLSAKVLFPSSGAYNGSIDSDNAEFTTKQQLRELVKLANEVNMIDSGEMAQ # EITRIEKQSFLEIEVRTVALSVIRFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 Scaffold_11 AUGUSTUS gene 1496115 1497812 0.22 + . g314 Scaffold_11 AUGUSTUS transcript 1496115 1497812 0.22 + . g314.t1 Scaffold_11 AUGUSTUS start_codon 1496115 1496117 . + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_11 AUGUSTUS CDS 1496115 1496396 0.54 + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_11 AUGUSTUS CDS 1496455 1496796 0.54 + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_11 AUGUSTUS CDS 1496898 1497042 0.47 + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_11 AUGUSTUS CDS 1497190 1497812 0.47 + 2 transcript_id "g314.t1"; gene_id "g314"; Scaffold_11 AUGUSTUS stop_codon 1497810 1497812 . + 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MGIVEFNLSAQVFSKRRLVLYFLFSSSSGLSIMSGYVMTIDSDAEETPLETHSLKEIKDEALNPDFTFDLSGDPYSDL # LEERRNGPDILRGTRPEPISVDDIIARRKVAKRKREHESDEEDEEDSAEEEDGDGEDSDGFDGIHEDVSDEEDDPLATSDEGEDEDSGEENALGPDEA # DLSDAESSFRMILNQKHKRKRNVKQHTLIPKSAATIPVALLGKDIVGGAQTGSGKTAAFIIPMLERLLYREKGKKAAATRCGMSIKSQEASLRNRPDI # VIATPGRLIDHIHNSPSFTLDSLDILVLDEADRMLSDGFADELAEIVKVCPRSRQTMLFSATMTDSVDELVKMSLNKPVRLFVDPKQSVARNLTQEFV # RVRAAKESERSAMLVTLCKRTFKSNVIVFLRSKKLAHQIRIAFSILGMKCDELHGDLTQEQVCDTICTFTHALTSPDIASEGFATISRWSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 Scaffold_11 AUGUSTUS gene 1501924 1503036 0.99 - . g315 Scaffold_11 AUGUSTUS transcript 1501924 1503036 0.99 - . g315.t1 Scaffold_11 AUGUSTUS stop_codon 1501924 1501926 . - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_11 AUGUSTUS CDS 1501924 1503036 0.99 - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_11 AUGUSTUS start_codon 1503034 1503036 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MPGSDYRGSGITAREQSAATSTTKSRKLLESVLAKARTKFGDRIRVSLLPVPPSTTFNSTQYPDNSLGFNQYPASPSV # SFNHQNQPYTSWTQTSSHSSNSPHFVESPTLTSASDMNLIGNRYPDDQKVPLNNLEPTVVPYVFPNSRSISPSSSTPPSSSTTALTSPFPFAFNDAQG # AAQDRPEFEYRRQTTQSHGAEVISLHGGTADISAIASSSGNDGGVRYRLGGNNRRMDAILDRTSLLPLLPPITSGTAGSENDSQQGSQHGSDGGDSSY # SSQHQARPRRITAPSSRSPSPGVAPLSGTLAVIKAQAFGALRRTRVRSKRPADGPAKVSRDVLESRGIVSADSLLQPGPAKRRRMNDDSDDFDAPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 Scaffold_11 AUGUSTUS gene 1506053 1506670 0.47 - . g316 Scaffold_11 AUGUSTUS transcript 1506053 1506670 0.47 - . g316.t1 Scaffold_11 AUGUSTUS stop_codon 1506053 1506055 . - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_11 AUGUSTUS CDS 1506053 1506156 0.57 - 2 transcript_id "g316.t1"; gene_id "g316"; Scaffold_11 AUGUSTUS CDS 1506247 1506670 0.54 - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_11 AUGUSTUS start_codon 1506668 1506670 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MDEVDDANLDSILAVADRSGRLLCFLDGTYPLGSLKLGDSNTTIASLFKNPKSPVLLAHPIHDGVFTDLLPTHVSLSL # LQERKVRDFAKLSTTARELCWYALRVVEEMRAAWIGSDTNSGARDLGPKWIAAYETKQQDDYHLTDRPSEALGDYLGSGPQMSERVKYPFSFEVEDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 Scaffold_11 AUGUSTUS gene 1516685 1517203 0.84 - . g317 Scaffold_11 AUGUSTUS transcript 1516685 1517203 0.84 - . g317.t1 Scaffold_11 AUGUSTUS stop_codon 1516685 1516687 . - 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_11 AUGUSTUS CDS 1516685 1517203 0.84 - 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_11 AUGUSTUS start_codon 1517201 1517203 . - 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MYKQNDWPIPSVIWTSLRDIPGELTTKPTNSSSSTVPFLGLLSSSTKTRSEAAQETQIQARYEEERGEREQTMMRVRE # TQDRIGRAQGYGRGNGDEELLGTGASGRYRSADQLAARKEQRKRFQFEATASDDELEDELDDNLDEIGDMTKRLKALGMTMNQELESQNKQLTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 Scaffold_11 AUGUSTUS gene 1518045 1520105 0.21 - . g318 Scaffold_11 AUGUSTUS transcript 1518045 1520105 0.21 - . g318.t1 Scaffold_11 AUGUSTUS stop_codon 1518045 1518047 . - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_11 AUGUSTUS CDS 1518045 1518437 0.99 - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_11 AUGUSTUS CDS 1518493 1519017 0.64 - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_11 AUGUSTUS CDS 1519097 1519407 0.36 - 2 transcript_id "g318.t1"; gene_id "g318"; Scaffold_11 AUGUSTUS CDS 1519463 1520105 0.83 - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_11 AUGUSTUS start_codon 1520103 1520105 . - 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MDDDQIWSQLDLRTNNICEVLDKILDKEPDEEDLEKEDSGFEEGDDEEDDEEFDEKLEEAIRRMKSGEDVDFAELGLD # ESLKELVLEGAFDDDEDDSDLDDDGEEEGDRSIDSEDDNVEEEVALRDSSSDRGDVITRKSSIQNRKRARPGHPELDDSFFDLNAFNSQTEQFEAKNA # SSGILDDENQEYAEEEVDLFAPIDLQEGEDSDSENNSNMLYYNDFFKPPKQSKQPLKPTTVRFRDEVRVKKIKAQGKNLPLSGLYGDDEEEEEEEEEE # EEENIAWAGDGSSEDEDADMGVEDEDDGDGSEHFADHQRDAISRLLIRSKDLSTHEKRMAALKRQILELETENVGPKDWVLMGEADSRSRPQNSLLEE # DLEFDRVMKAIPVITEEVVKSLEERIKARILENRFDDVVRIRPLDDKPFLPSRFFDLKDTKSTQSLAQIYEDEYVAAQTDGVKGDDRDGKLKKEHEEI # ERLWESISYKLDALCNTHFTPKQPKATISTVSNVSTATMESALPTTQSVSTMLAPEEVFAPSSSTLRARSELTPAEKQSLRRKERKAKKKTRDALNLS # TDKYARAHKGGSLKKQKEDALKSVVKAGKGVTVVGKKKKDILGKKDRNHKQSNGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 Scaffold_11 AUGUSTUS gene 1520795 1521663 0.85 + . g319 Scaffold_11 AUGUSTUS transcript 1520795 1521663 0.85 + . g319.t1 Scaffold_11 AUGUSTUS start_codon 1520795 1520797 . + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_11 AUGUSTUS CDS 1520795 1520845 0.85 + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_11 AUGUSTUS CDS 1520926 1521663 0.98 + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_11 AUGUSTUS stop_codon 1521661 1521663 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MKVDQLTRIILLYSKYRDEAHSASLKLQRFSFDASVAQDRVIKLERENALLKTELATLRANPHPDLSPTSHPAVLQSQ # ELTLSLRRLSDKLSFTEQTLLERTTELTHVASELAKSNLIIEGAYALAARTRGREEDGKVRERALEMKIQELKEEVKMEDLVVKQYADLVRSLEGRNS # SVNAEPTSMHNNSSATLVDGISEDKVGLQKLFAEFSAQFEPLQAEVEKLKGELAVTNMRLEAERKGTEADHKLLLRPPERTSNAQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 Scaffold_11 AUGUSTUS gene 1524009 1524656 0.63 + . g320 Scaffold_11 AUGUSTUS transcript 1524009 1524656 0.63 + . g320.t1 Scaffold_11 AUGUSTUS start_codon 1524009 1524011 . + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_11 AUGUSTUS CDS 1524009 1524656 0.63 + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_11 AUGUSTUS stop_codon 1524654 1524656 . + 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MDTSKSGHWESRIPTLDKLGVKDLGQIDELKIAQDWFQVFSSYVTAGNVEEIVGLFCDDSLWRDLLALTWNMRTFDGS # SKIRTFLKDRIPHVHMQGFKLKEFVRLQKPFPDLTWIVGMFEFETGTGMCSGVFRLVPTAEGPWKAYTIFTVLESLKGFPEKIGALRDPSALTGRQWR # EKRDLEIAFEDGDPAVLIVGGGRAPFSLPPVSSSLTSPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 Scaffold_11 AUGUSTUS gene 1533346 1534055 0.8 + . g321 Scaffold_11 AUGUSTUS transcript 1533346 1534055 0.8 + . g321.t1 Scaffold_11 AUGUSTUS start_codon 1533346 1533348 . + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_11 AUGUSTUS CDS 1533346 1533506 0.99 + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_11 AUGUSTUS CDS 1533650 1534055 0.81 + 1 transcript_id "g321.t1"; gene_id "g321"; Scaffold_11 AUGUSTUS stop_codon 1534053 1534055 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MLQYYPRGGAKGSGARGDGNPNQNGVEEAESAPKKCKIIAVLSIFDLDLISRTHDSEKKIHQGWGGDEGKSELQVETE # ATVDAAAEQAGADAWGATGGNASAWDTPAGEAAPVAATEDKPERENRRREEEEEDNTLTFDQYLAQKKENDALPKPQVRQANEGADGDIWKDSVALQK # DEDAYFVGKVNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 Scaffold_11 AUGUSTUS gene 1536879 1538048 0.28 + . g322 Scaffold_11 AUGUSTUS transcript 1536879 1538048 0.28 + . g322.t1 Scaffold_11 AUGUSTUS start_codon 1536879 1536881 . + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_11 AUGUSTUS CDS 1536879 1538048 0.28 + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_11 AUGUSTUS stop_codon 1538046 1538048 . + 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MPSLESVLRTGTPASSSTHPIEEAQTKRDNSMAHVSTKEADLTVVKDQEPVKSKEREVKKKEKKSLRTKEVSQLGPVA # LKLEDGISRPTLTPSSTSAPRQIAPPPSVSLTSQTNQQRHQDEDPHEWLLEHYADDDRRKIKRPSSTLSSVAVITNSDPGRHSTTSPLTRKPTRSPVM # PSTSSVSKRDDAQNDKDGDDAMMALEQELDAELAKGVVDQKESTYDNDTMDVDVDLAVAELVDETLGIDASATVIISGRQHLTDEESKLGIRDEDGSG # REPAHKPQPNVDDKAMDVDVEDELLSLLDDRPNSRMSASAQSVAPSAPEPQRTSKPIVTAALRMKHEEPTSRPSSPLAVSTGSPFRSSSTTGARQSSA # KPSEQDDRASMPPLLHQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 Scaffold_11 AUGUSTUS gene 1538195 1538599 0.99 + . g323 Scaffold_11 AUGUSTUS transcript 1538195 1538599 0.99 + . g323.t1 Scaffold_11 AUGUSTUS start_codon 1538195 1538197 . + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_11 AUGUSTUS CDS 1538195 1538599 0.99 + 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_11 AUGUSTUS stop_codon 1538597 1538599 . + 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MVGAPPPKPRGKPGPKPKPRDEFGNIIRTPSTSATPAPPTTTVTQSGRASSSSTPAPTLVSRTASGSGAAVGSTSGAR # SRSTSAHPAGSVGPEVEGQTKEEEKTEDKEEEVDDKLYCLCKTKYDEDKPMIACDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 Scaffold_11 AUGUSTUS gene 1539063 1539428 0.4 + . g324 Scaffold_11 AUGUSTUS transcript 1539063 1539428 0.4 + . g324.t1 Scaffold_11 AUGUSTUS start_codon 1539063 1539065 . + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_11 AUGUSTUS CDS 1539063 1539428 0.4 + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_11 AUGUSTUS stop_codon 1539426 1539428 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MQVDGVGTDILKPVIKEVKPTKTKQEREIDRLNGLLADIERIRDELHRDMDIILSREKLLQLATDRSENLGQCGWDQR # LCFSDGDWADYGEGVLESYTEQDSSAEAEWWCPGDQECERHAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 Scaffold_11 AUGUSTUS gene 1544939 1545490 1 + . g325 Scaffold_11 AUGUSTUS transcript 1544939 1545490 1 + . g325.t1 Scaffold_11 AUGUSTUS start_codon 1544939 1544941 . + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_11 AUGUSTUS CDS 1544939 1545490 1 + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_11 AUGUSTUS stop_codon 1545488 1545490 . + 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MVRPSAFGFTTSIKTTPPGISEWYSPVVPNTGLHPRPASASALKAYISEIDSDAWSSIYYPTRKGEDVDQIHERAHSI # LSDLISEVESRFPNHRRVLLVSHAATVIALARDLAGDRELPLRVGCCTLSEFSRKVGGAGSGSWEVKKLAEAGFLTGGVQRDWGLEDIQIADGKVNLQ # SGDVVTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 Scaffold_11 AUGUSTUS gene 1546285 1546773 0.86 - . g326 Scaffold_11 AUGUSTUS transcript 1546285 1546773 0.86 - . g326.t1 Scaffold_11 AUGUSTUS stop_codon 1546285 1546287 . - 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_11 AUGUSTUS CDS 1546285 1546773 0.86 - 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_11 AUGUSTUS start_codon 1546771 1546773 . - 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MGTHPDSSDSEFKLRSNSLIEQQPGLTLDSVPCRRFRTNAITGAAWVTSKIRSCFAGDKVDSTLGMNRERNVDILSVI # WETFSPVEGGYHRLDQASASISGKSTRRISALGGSGCLIALLAVKSEYHSEIPGHDMSRSRDWRSIQKETHSDQHISEHQGQWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 Scaffold_11 AUGUSTUS gene 1549912 1550703 0.75 + . g327 Scaffold_11 AUGUSTUS transcript 1549912 1550703 0.75 + . g327.t1 Scaffold_11 AUGUSTUS start_codon 1549912 1549914 . + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_11 AUGUSTUS CDS 1549912 1550703 0.75 + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_11 AUGUSTUS stop_codon 1550701 1550703 . + 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MLSTPQLDLAFDNDDWTPQIAPRLFRSTSSASSVSSWGVTSIGRGFEWDQNDDENSIKSAPPQKFEKDDYRLAFDLNN # DEEEKPRKLSPNSAGSSSNIMRPVTNVTPITTTSALLSEPFCMSPSQSRSTSPVIYSPTPSSAPSSSSPRPGYPSRTPSTPRPRRRSSQQRVSLVAGR # VMIAPRDSPTQSSLEPQSLNGLQRANSNSSFLSVASSTRAPSPTSHESFLGNRKISEFEIEGEIGRGAYGLVKRGREKLENGSLGVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 Scaffold_11 AUGUSTUS gene 1559822 1560304 0.46 - . g328 Scaffold_11 AUGUSTUS transcript 1559822 1560304 0.46 - . g328.t1 Scaffold_11 AUGUSTUS stop_codon 1559822 1559824 . - 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_11 AUGUSTUS CDS 1559822 1560304 0.46 - 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_11 AUGUSTUS start_codon 1560302 1560304 . - 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MSSSPNPPFHFTPSQSRSGSPMSPMIFVSPTASNRTPPAIRTEYQSYSFSSDEDGEYDDSGLLRLGSPSLPASLPSTP # RSSTFSSPARAWRQNVSVVNISPISEDLNSSTEGLQVSSQRRLTSLSLPGSINLDDSIPDVAPFPSRVTMNTHNQTRIGLSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 Scaffold_11 AUGUSTUS gene 1569996 1571708 1 - . g329 Scaffold_11 AUGUSTUS transcript 1569996 1571708 1 - . g329.t1 Scaffold_11 AUGUSTUS stop_codon 1569996 1569998 . - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_11 AUGUSTUS CDS 1569996 1571708 1 - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_11 AUGUSTUS start_codon 1571706 1571708 . - 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MSREELVEGDGGFETIEARWLEGLTDDNSRRAYMRAKGLPVSLVQYCHWTDFCHKDYQSQYLPNSLPSDITLSQFLSI # QEKGVSAWSFEPDLETLNSLLVHARTEITFLPDPASASCVQSNLPLPKLNEVYYWEVKMFDLPESTNVAIGLATKPYPSFRLPGFNRYSIAYHSNGDK # SHNYPFTAQNFGSPLKEGDVLGVGYRPRSGTVFFTRNGRKMEDAFTGLNRYNLFPTIGADGPCSVHVNLGQAGFVFVEANVKKWGLAPSVGTLAPPPA # YGSERGSILLDVGGRRRSPRDSSASSPSGTASPTPSRRTHRSRRPRPNSGDPIVSSPLRTAEPITPPPPITPIDEEPTSGSNVSTSPRYISPTDLPFH # APPNTNLPPSPGPHDGFDSDDDDYSSAASTSRPSSPDVAGAINPFSTPRRMRRSLTHLATSLSDSGAETYIQVHPPPDSPLSPPPVTPNPHDIHLQAL # TRSDHRRTGSSGSQTLSHGPDGDSNRLNSSESLSRRDPPAYSPLDAFTYADGVHIDLPAEVITAAPGRKYITSQRNGSGEWLTVQRTTKQKTLITQTP # RA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 Scaffold_11 AUGUSTUS gene 1575979 1577070 0.98 + . g330 Scaffold_11 AUGUSTUS transcript 1575979 1577070 0.98 + . g330.t1 Scaffold_11 AUGUSTUS start_codon 1575979 1575981 . + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_11 AUGUSTUS CDS 1575979 1577070 0.98 + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_11 AUGUSTUS stop_codon 1577068 1577070 . + 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MTAIQSVHISGHQERLEPKTHTVYQIDIRGNVRSWSIWRRYSEFDDLHVELVKGTGSPPPVPLPPKHKYSILRSHNNP # SLLEERKTGLEAYLRAIIGAKEDKWREAFVFKEFLGIPVGRQGGVVGGPPTQFTLTSWLDEHQELQNRLRDVRADINKREALSNQGDVSASHKSNVSA # KQKLAGVLSRIGTLGKGLHDLAMNGMSEGELQRRTDMVARLQDDCEKLGKMVTVARQFNRSGTDPTAPYSPASMNPASASDREALLGPTNTFTRVTRV # FGQPSKPQETEVTRPLDDLGLFGLQKTQMQQQDDQLSQLTTILSRQKQLGHAINSEINEQIAVLDGLANDVDNVGDKLSKASRQMHRLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 Scaffold_11 AUGUSTUS gene 1578673 1579143 0.99 + . g331 Scaffold_11 AUGUSTUS transcript 1578673 1579143 0.99 + . g331.t1 Scaffold_11 AUGUSTUS start_codon 1578673 1578675 . + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_11 AUGUSTUS CDS 1578673 1579143 0.99 + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_11 AUGUSTUS stop_codon 1579141 1579143 . + 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MVSALNGPTLAASRAALSAAMADDNPNISDDAESIEPGEIQEVNMEAQAEGIRTVFSDPTNFNVKVCRVAFFIFLESK # SNIFIDAQHPLYSPWTLWFDSPMTKNRNLPQTPISAVPQTPGPLPQTPGVAAAQGWMEDIKRVISFDSVEEFWGYAVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 Scaffold_11 AUGUSTUS gene 1579407 1579808 0.98 + . g332 Scaffold_11 AUGUSTUS transcript 1579407 1579808 0.98 + . g332.t1 Scaffold_11 AUGUSTUS start_codon 1579407 1579409 . + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_11 AUGUSTUS CDS 1579407 1579808 0.98 + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_11 AUGUSTUS stop_codon 1579806 1579808 . + 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MWLYTVRIEHACLLLHIAEPIRQQMLAAIGETFDPSLTTLDPSGSPPNSLITGVIVSTRPQFYRISIWTRLAPGMPDD # DDGLRERIEGVGRHFKVNVLGYTESAKLAGPLATDVEFVSHKDSEKKGKSKKITI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 Scaffold_11 AUGUSTUS gene 1582867 1583654 0.86 - . g333 Scaffold_11 AUGUSTUS transcript 1582867 1583654 0.86 - . g333.t1 Scaffold_11 AUGUSTUS stop_codon 1582867 1582869 . - 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_11 AUGUSTUS CDS 1582867 1583580 0.86 - 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_11 AUGUSTUS CDS 1583634 1583654 0.93 - 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_11 AUGUSTUS start_codon 1583652 1583654 . - 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MNNESTSPYYFLESPTSSESSYSSSHSVFQNHSMVAQAATSDYGLGYAWAPHYQQALNQRDLNDHDYCGPQYPAPPQA # TSNWDGGSESYSYPQDPSVQSQGCQLPLHAPVPLPGPSSILFTDVESTHYSQPSPHLANRPISSQTCQTRTPPDAHKEQSIYDSAAAPPQIQTFMNRF # SVKSPVQATFPTPCELLSELGVGSDPSSASPGSMSDSSSVEVAGPSGNADIPSHKRDLKIPTLRPPEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 Scaffold_11 AUGUSTUS gene 1587303 1587734 0.97 - . g334 Scaffold_11 AUGUSTUS transcript 1587303 1587734 0.97 - . g334.t1 Scaffold_11 AUGUSTUS stop_codon 1587303 1587305 . - 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_11 AUGUSTUS CDS 1587303 1587734 0.97 - 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_11 AUGUSTUS start_codon 1587732 1587734 . - 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MDEVEEADTGSSDEVESEESEDDMQDVPELSSKKEIVDTASVHSPPPLQNRSISPTASDEEPPESDHESTRNLSRSPP # RSRSISPAADHSARNVKDIVKSNLDKSRARQQRKYHSKRSTRQAGRAQGSKAKQDTRVKLDSTWD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 Scaffold_11 AUGUSTUS gene 1592948 1593608 0.4 - . g335 Scaffold_11 AUGUSTUS transcript 1592948 1593608 0.4 - . g335.t1 Scaffold_11 AUGUSTUS stop_codon 1592948 1592950 . - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_11 AUGUSTUS CDS 1592948 1593379 0.66 - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_11 AUGUSTUS CDS 1593537 1593608 0.41 - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_11 AUGUSTUS start_codon 1593606 1593608 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MALKSTEDERALLRARSAVQRFPVPSQPAWDQQSGLASPMGSPRLNNSTDSLAMDDPAHAPPRLLNSNSVGDEGDSVS # HGSHNSSADYDDFLSRANRIIARDQRNAPDPFLEAPNGDFKRPARPFSSHSRNSSASSLADVADEHSSSPLNKAIASVSIVIHSSPLTY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 Scaffold_11 AUGUSTUS gene 1594051 1597019 0.75 - . g336 Scaffold_11 AUGUSTUS transcript 1594051 1597019 0.75 - . g336.t1 Scaffold_11 AUGUSTUS stop_codon 1594051 1594053 . - 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_11 AUGUSTUS CDS 1594051 1595681 0.97 - 2 transcript_id "g336.t1"; gene_id "g336"; Scaffold_11 AUGUSTUS CDS 1595731 1595970 0.96 - 2 transcript_id "g336.t1"; gene_id "g336"; Scaffold_11 AUGUSTUS CDS 1596050 1597019 0.76 - 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_11 AUGUSTUS start_codon 1597017 1597019 . - 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MPTSRQAMPGNLAWKRHGCYQLGSQQYYNMPLDKSTLGCHDDWNALDHFDPTADSRRLFAQFNYLRSQFVALQDGYAL # TELGNWTYYIQREGSNNTATEMGLWSISRSEMSGVQNLTGTNTNSVWMFFTNENSTNTWTYDCNDTLWISSPYVSGTVVRNLFYPYETYTLEQSSSSF # NNDSQAPWFGCLGSITMDGYGFKALVPVANWLSPPPALTAFTPGHDYRINSETSGTSVDISLEFSTEMDCNSVTNSITLAMSSSSTGSIPTISNANCA # SMNSSANVVVQGVSRTQWVWNATLTNFGDGILNITVNNPSSSSGNSTGVSLPGNVMVFPENDYNASALTKNGDDYIFTHSAYGADMFRYSWNFGQNWT # NWTNWEDTTTLDLSSFADANLFWEGDHVVVQYWSAATLSSSHVVHSDYGWSGYARRVPQLIATGVFNEWGSNKGIANTFSQSGDGLWEFTFMYYWPSY # FQVNVWGEDNYFYGDTDGDGVLDRLPPNSAAANYLNMSAPPLPHLSWTVFIDDSTMTWYLEPHGREGVAATLYALLVSIPLITGTLAVLIFMWSFYGI # RYNQYGVKAKTSYFPILGALGGKSDAKDGAVVSEKKVHRQNMDIIGWPEDKNKRRKVLIATLEYEIIDWKLKVKIGGLGVMSSLIGKAMSDVDLLWVV # PKVKDIEYPAGDPADPIEVIIFGEPYLIEVETHTLDNITYVILDSPVFRAQTKADPYPARMDDLSSAIFYSTWNQAIAATVRRNPTVDIYHVNDYHGA # LAPIYLLPKVLPVCLSLHNAEFQGLWPLRTKEEMKEVCSAFNISKEHCTKYVQFGNTFNLLHAAASFISVHQKSIGVAGVSDKYGKRSWARYPALWTL # KHVDSLPNPDPTDIAALDESPTDAKKVQIDQSAEAARPEHKRQAQEWAGLKQDPDADLFVFVGRWSKQKGVDLIADVMPSLYVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 Scaffold_11 AUGUSTUS gene 1597861 1598884 0.09 - . g337 Scaffold_11 AUGUSTUS transcript 1597861 1598884 0.09 - . g337.t1 Scaffold_11 AUGUSTUS stop_codon 1597861 1597863 . - 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_11 AUGUSTUS CDS 1597861 1598064 0.39 - 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_11 AUGUSTUS CDS 1598272 1598426 0.34 - 2 transcript_id "g337.t1"; gene_id "g337"; Scaffold_11 AUGUSTUS CDS 1598512 1598884 0.42 - 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_11 AUGUSTUS start_codon 1598882 1598884 . - 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MGAFAFAVGALALFSSLVKASPYRDDLTAWNLNTNKDATDPTQYSTTRSNTTYTPSPDNWRSLPVYTILLDKWADGDP # SNNDYFGTMYEWDYRETQLRFGGDLKGLVARLGYLKNMGIKVIYISGYSPLDMTVLDPHWGTWDDWVAAIDEIHAQGMYFMADLTVGTMGDLLGFTGS # VGNTKNTSCVMPTFYDDDGSVIDPDTIGATYCMESDFDQYGDMEAFGVHSRLATSTVQVCIGARSTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 Scaffold_11 AUGUSTUS gene 1602185 1602577 0.3 - . g338 Scaffold_11 AUGUSTUS transcript 1602185 1602577 0.3 - . g338.t1 Scaffold_11 AUGUSTUS stop_codon 1602185 1602187 . - 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_11 AUGUSTUS CDS 1602185 1602577 0.3 - 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_11 AUGUSTUS start_codon 1602575 1602577 . - 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MITGAAQMDGAIIVVSATDGQMPQTREHLLLARQVGIKKLVVFINKVDMINDPEMLELVDMEIRDLLSTYNFDGENTP # IVMGSALAALDGRDKEIGVDKILELVKACDTWLDLPARGLYFCPFSILMTFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 Scaffold_11 AUGUSTUS gene 1604049 1605821 0.2 - . g339 Scaffold_11 AUGUSTUS transcript 1604049 1605821 0.2 - . g339.t1 Scaffold_11 AUGUSTUS stop_codon 1604049 1604051 . - 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_11 AUGUSTUS CDS 1604049 1605158 0.88 - 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_11 AUGUSTUS CDS 1605282 1605821 0.2 - 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_11 AUGUSTUS start_codon 1605819 1605821 . - 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MHSNEILFPLIHPALNVVPTTSHIGRRNARRPLQSSPLTGPALSSEGAVIQEDHVLGRPRPSRISSLPEFSKSTDYWV # ESIPPLPVSESHQRKSLPPAHLTISNSTPLLPKTSSSCPSKPPRPSSGGNIHSLSQNISHAPHRTSSSLHDTGETWLITSTYEETPRFSRPNKGSNVV # MPVSPRRSLSSLPSKVRQRANAIMSLDTDVADSCGNAIPRQPYSRSVTSRPSSTKNISDNDSFISSPPPLPPSDSAHSSESFISNFVIVDDAETIQPD # STDLILPGSADLLPLQPPDHQRSASNTTSKSRTVSIDSRNSFGAFKWRTKDVLRKSRSFVHSRASSSVDPILGSTVSSPFVAPRKHVKGFSFLSFSSS # DDSHSFHVPPVPGSLPDGIGMTTISDTSSDSDLATDDTHIDYQKEAGQLLYDAFPRPPSIDYNAISSMLPAPLGDHNRSNLHALPKTPPPELDMNERL # GSPLPRTPTPSSPTGSSSRTLVSPPTPTFKAFKRGTPDQILPQNIGFGGRPFASTLDLSSTSPLRDSPTASFLSIGMIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 Scaffold_11 AUGUSTUS gene 1608349 1610905 0.39 - . g340 Scaffold_11 AUGUSTUS transcript 1608349 1610905 0.39 - . g340.t1 Scaffold_11 AUGUSTUS stop_codon 1608349 1608351 . - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_11 AUGUSTUS CDS 1608349 1609038 0.99 - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_11 AUGUSTUS CDS 1609103 1609573 0.95 - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_11 AUGUSTUS CDS 1609787 1610905 0.52 - 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_11 AUGUSTUS start_codon 1610903 1610905 . - 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MFSQFRHAVETLAPHPRISTDEPPHSDGDSPSSNPRSQSIDLTSPTQLAENALSSLSSLRKSFSPTLPGTPSPPNAKS # PSTPRPSTPRPYKSTLEERLRAATAFTIGEASNTTTPQPSARASPAPSIAPRDQPLSPVSPLSTPLPESPISSQPSTESEPPQDLLGNLSLDVNPSGR # GEPPTDATVSVDPAVGNSETSEKRSRSHPGPDPDVIGTTRENSSNTKEHVDGIVEGIAQDEVIAPIELNASKDTKEATDTEAPEEPPISPINKVQALD # SEGSSSTSVTLVPSSTTTTVEELQQRLKLVEQRFTGKVLRIYRCRHFTVPLLDVSTSFKRLQAEKTAADTVLREFTPLESLRESDALRDYLQNVLLKT # EIDQIDNLKKQLEESELLIKASQANSDEVTKLKAENERLNGEVAQGKELAKDEEEKRMKAISLLKTVRQKLTRAEKDRDDAVKEVSALKEKEKGERAR # EETERSKHQSEIDSLNTERDRAIAGLRTQFDKELVVARERHEKELAALRAELELETVTVKATFEKEVSNKNSRITQLENSLNSVVRDKNSFFEQVQIR # QAEVESSQAHLESLQSQNAELQYQLREQSDRIILLNEELLEARREHDTVSSKYSSISTSPEDTAHLLSSVEVKYEAKLTELKRVLKNTEKERNESDAE # WSRKLREKNQEMEKLSTRLGTAIQSKAQDHGLVENLKVEISHLQQQIQISQNEVTQVRMHIAQLKENEVSFSSLLSLWEVLNVGHLLEYVQYP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 Scaffold_11 AUGUSTUS gene 1614750 1615040 0.38 + . g341 Scaffold_11 AUGUSTUS transcript 1614750 1615040 0.38 + . g341.t1 Scaffold_11 AUGUSTUS start_codon 1614750 1614752 . + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_11 AUGUSTUS CDS 1614750 1615040 0.38 + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_11 AUGUSTUS stop_codon 1615038 1615040 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MFVNPWGRLKRLKNAHDSMHSPEDHIPDLQDIELDTRYLRRSSEDILSKSHLKCIDLSDSPSVVPLEYVFSHTLVEWC # WNEYHDDEEPLVFWQQQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 Scaffold_11 AUGUSTUS gene 1617536 1618150 0.32 + . g342 Scaffold_11 AUGUSTUS transcript 1617536 1618150 0.32 + . g342.t1 Scaffold_11 AUGUSTUS start_codon 1617536 1617538 . + 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_11 AUGUSTUS CDS 1617536 1618150 0.32 + 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_11 AUGUSTUS stop_codon 1618148 1618150 . + 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MLIKSLASIPQGLSLLHLLHTVKKLIEELIHSLASHQLTFSSILEELPLKVHTNPLLSAFLGEFSTVSPNTALGSASA # LPPSFSALDLNSGGLTKNLEHIVDALDNYRNEEGNLAYLSRQIARERAKADNYVMKRKEESAARVAQGLAPLPEEDVTRLFKIPPEPSRLESMLLLGQ # VDAYAKSLAETTSTGLVKMYAATAGSGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 Scaffold_11 AUGUSTUS gene 1618486 1619052 1 + . g343 Scaffold_11 AUGUSTUS transcript 1618486 1619052 1 + . g343.t1 Scaffold_11 AUGUSTUS start_codon 1618486 1618488 . + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_11 AUGUSTUS CDS 1618486 1619052 1 + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_11 AUGUSTUS stop_codon 1619050 1619052 . + 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MSFTKSVVILLSAFTCVQALATPHAIRDVHHHRAVAARVAQPTSGLDNIPPLVLPKKRDLSKRSLRKRCQARPAPSAS # SSVAVVSSSSSSSSEAASSSAAPVNVGSDPTSIIISSSSTLFTTSDTPTPTPTPTPTPTPTPSTSSEAPATTSSSSEAAATTSSSSSSSSDSSAANFL # AGTNSGQGVNYF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 Scaffold_11 AUGUSTUS gene 1625937 1626378 0.74 + . g344 Scaffold_11 AUGUSTUS transcript 1625937 1626378 0.74 + . g344.t1 Scaffold_11 AUGUSTUS start_codon 1625937 1625939 . + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_11 AUGUSTUS CDS 1625937 1625942 0.86 + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_11 AUGUSTUS CDS 1625992 1626378 0.79 + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_11 AUGUSTUS stop_codon 1626376 1626378 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MHIYLYVVISSYSSAQQQDHIKYDALNDPTNPLNGEGIPMNSRDPWDARTSTDYPGGYTHGRQASASSMNDVMNQPVR # QPRDGFSYSDAAAPYVPQPNYEGSLSHPNNAYTQDPGPTPKFNDPYYDDSSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 Scaffold_11 AUGUSTUS gene 1635806 1636453 0.94 + . g345 Scaffold_11 AUGUSTUS transcript 1635806 1636453 0.94 + . g345.t1 Scaffold_11 AUGUSTUS start_codon 1635806 1635808 . + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_11 AUGUSTUS CDS 1635806 1636453 0.94 + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_11 AUGUSTUS stop_codon 1636451 1636453 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MGTIIGRNGLKIKAIQDGSGARMIASKEMLPQSTERIVDVQGSPEAIGLAIEEIGKCLLEDWERGMGTVLYHPGTSEE # RTGSRRSTNGLSSSSYSGSRRPNGDAPRRATSPSSQQASVAAQPTANLRTQNISIPSDMVGCIIGRSGTKITEIRRLSGSKISIAKAPHDETGERMFT # IVGTPEANEKALFLLYNQLESEKERRVGREAQQQQELQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 Scaffold_11 AUGUSTUS gene 1637202 1638243 0.32 + . g346 Scaffold_11 AUGUSTUS transcript 1637202 1638243 0.32 + . g346.t1 Scaffold_11 AUGUSTUS start_codon 1637202 1637204 . + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_11 AUGUSTUS CDS 1637202 1637512 0.32 + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_11 AUGUSTUS CDS 1637568 1638243 0.64 + 1 transcript_id "g346.t1"; gene_id "g346"; Scaffold_11 AUGUSTUS stop_codon 1638241 1638243 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MSSTYDPNAYVNNNQNQYFTQSTAGPSFSRPQNQSNEGIKIQSFNQANSAWYQAGYERCTYRGCKFTGSAKCVEIHMM # DRHLIYPPGWDSRKKKDWDADPSLKGKPILIQGTNLTLDTPDAIDAWVEERKKRWPSSTLIAEKKRKFEQASARGELSVESLGLFSTKKRRVQDPYEG # NERNDHARGGRARGRGNDWTPRGSSDSGWRGRGARGRGRGSSFGPRGDNTINRALVLEREVSPQVQIHEPLKEEKDRDGSASDSDSEPEVLSSKPPPV # PEKQVNVPQITSSVPTQSNPKTVAKNPRPQPKKPPPNPFAPRTSLLRNVSLASF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 Scaffold_11 AUGUSTUS gene 1638556 1639073 0.48 - . g347 Scaffold_11 AUGUSTUS transcript 1638556 1639073 0.48 - . g347.t1 Scaffold_11 AUGUSTUS stop_codon 1638556 1638558 . - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_11 AUGUSTUS CDS 1638556 1638966 1 - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_11 AUGUSTUS CDS 1639047 1639073 0.48 - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_11 AUGUSTUS start_codon 1639071 1639073 . - 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MGAFKAASTVTLDDTTVDAAKSSIVYGVTKTVSTASRAAIVSFTNQALKGVPQNHQMELLEKFQAVTKEDIISVFRSH # FLPLFESQSSVAVVVTAPSKADEIDAGLAGYGFEVERRTLDIDPNEMAGSDESDSESGSESDESGLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 Scaffold_11 AUGUSTUS gene 1639650 1639877 0.38 - . g348 Scaffold_11 AUGUSTUS transcript 1639650 1639877 0.38 - . g348.t1 Scaffold_11 AUGUSTUS stop_codon 1639650 1639652 . - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_11 AUGUSTUS CDS 1639650 1639877 0.38 - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_11 AUGUSTUS start_codon 1639875 1639877 . - 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MKRDGSTVLSSLWADLMFSEKSTSRAGGVLPQVEFVPKLAKELQESPERVIADFDEIRKHSEKPRATYLLSSKFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 Scaffold_11 AUGUSTUS gene 1640266 1640766 0.49 - . g349 Scaffold_11 AUGUSTUS transcript 1640266 1640766 0.49 - . g349.t1 Scaffold_11 AUGUSTUS stop_codon 1640266 1640268 . - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_11 AUGUSTUS CDS 1640266 1640766 0.49 - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_11 AUGUSTUS start_codon 1640764 1640766 . - 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MKHRRYYIDPSSVVVIGRPSAALAAKLEKDEKKRLAAQVKRLGPEGIKAAAKELEEAKAEHDKPIPTEVLTQFQIPSV # KSISWIPVQSVQQKGRGRSALPTPSSSDLAKIIASDGDELPFFVQYDHVEVDTFFQISSYFILTNIKSDFVSITAFFSLENLPQRLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 Scaffold_11 AUGUSTUS gene 1644156 1644683 0.55 + . g350 Scaffold_11 AUGUSTUS transcript 1644156 1644683 0.55 + . g350.t1 Scaffold_11 AUGUSTUS start_codon 1644156 1644158 . + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_11 AUGUSTUS CDS 1644156 1644683 0.55 + 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_11 AUGUSTUS stop_codon 1644681 1644683 . + 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MPNASVIEFQPKIRPDFNFTPDDPVYSLIVGDPVLPVQEEKLRPSYVVHTTIDPVVATGASETTDGNNENEEEGADPD # KVITNARAARPVDGLLSLSELKNLFLSSGPPLKSAYDSSLRGYLESFSESNKPTRTFGDRVSIPSSRLGGYEPEWTSYTFYWKLVLGAFQPRESFHC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 Scaffold_11 AUGUSTUS gene 1645149 1646486 0.75 - . g351 Scaffold_11 AUGUSTUS transcript 1645149 1646486 0.75 - . g351.t1 Scaffold_11 AUGUSTUS stop_codon 1645149 1645151 . - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_11 AUGUSTUS CDS 1645149 1646486 0.75 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_11 AUGUSTUS start_codon 1646484 1646486 . - 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MNDFRECIEFASSGRKFSLRIFCCLCSRLVGPVSKQAPPPVPPLPVMGGLPRSPVPIASPSGHSQASSPPISRTSSPP # SQPSPGMESIASRTSSFNQQSPRSSESGSLSDQFSRMGMSNVASPPSAPKRLPSFHDQRPTSANSGSVGIGQVFPVSRNPSLGSQHQAYPPYGPGPGR # GAPGPPPPPMKGPMQHPYPGGPARNMAAPSMQGGPPFDHPQPRAPFMDGLPPRPPSEPPMQANPPGRRSPSTRSLSAQQDHPRYNNMPPNGYPPNNMN # VNDTMTRQQSFGTPLHAPQPRPLMPSATFNRALAETSFADPSPPNSPVAESSSLPTGPVTSSITATFKCKVFLKQQHAQWKSLGTAKLKLYKESPTNV # KQLVVEADDKNNTVLISTIVLTDGVERVGKTGVAVELSDRGARTGIVYMIQLRNEKSAGGLFDSLLDGSDRAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 Scaffold_11 AUGUSTUS gene 1647142 1647540 0.37 - . g352 Scaffold_11 AUGUSTUS transcript 1647142 1647540 0.37 - . g352.t1 Scaffold_11 AUGUSTUS stop_codon 1647142 1647144 . - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_11 AUGUSTUS CDS 1647142 1647540 0.37 - 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_11 AUGUSTUS start_codon 1647538 1647540 . - 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MSSSNALSTGNEVWTLDTLFLLPKARLKYYKKLYGRLLKSTAPGRSDYKLLVGAVDKLERLLDTLEQRESIRVGYPDD # SPAPQYAAHELEDEVVLDMRTESGPPVLPHRISEVEVTPGSGSDSTRDSGVSAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 Scaffold_11 AUGUSTUS gene 1660791 1662325 0.62 - . g353 Scaffold_11 AUGUSTUS transcript 1660791 1662325 0.62 - . g353.t1 Scaffold_11 AUGUSTUS stop_codon 1660791 1660793 . - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_11 AUGUSTUS CDS 1660791 1661749 0.93 - 2 transcript_id "g353.t1"; gene_id "g353"; Scaffold_11 AUGUSTUS CDS 1661890 1662325 0.68 - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_11 AUGUSTUS start_codon 1662323 1662325 . - 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MNQLFNINYSVDEVYTAIWLADGSPTGSNCASQALLIDTPGLSSATTPNRTSWARSAMLWNLVQSQDITAIHNLQSFT # NSAPWSTLSSDGPITGKSSSFSVTVSGFTFDFADQTITQPAVSFTDNGQPVSAQISRIGSTALAALNRQRASDLSNFRSAVISSSILIPFDATYNASS # QALANQMTNSTTQAFPVPLSCYPGLNSTQIQQINDIEQTVYGLSTVSPVSSFDTSCYPDRPLYGVLDVLRLRLPFVDSRTGVAMQAVSLQHVVSPRAV # VRRGEVLSALPLSSNASAFTAATSNPRSYGTLNNFDHVLLDYLYSIPDVNVATALASFLLSTSNAAPPSNTSTLANSIGTIPSLEVAIFGSVLPSDIN # SVISSFVTPTGALFFGSTQGQSMRDWAIIGTGTSVVWAESAFSTQVVRDSSLSDTTFEAIWDNAALAIDNNVQNVGVGNITSSLQSTGKFSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 Scaffold_11 AUGUSTUS gene 1662436 1664076 0.69 - . g354 Scaffold_11 AUGUSTUS transcript 1662436 1664076 0.69 - . g354.t1 Scaffold_11 AUGUSTUS stop_codon 1662436 1662438 . - 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_11 AUGUSTUS CDS 1662436 1664076 0.69 - 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_11 AUGUSTUS start_codon 1664074 1664076 . - 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MSQLPTKPQNSSPDAQLLQSRPTAQRHLTSGSIDTNASGLADSTISFAGSLHLGRFPAPPLSIPGTPAQSEYSPSIAG # SGFSYRTGSTTPILPRRKKSNAVTPASGSPTIVHRPLPSPKSNFSAGHNRKPTEAVKSPPSSLKSRTISPYDWHEGASSIDVDAAEDRLLPTNFITSL # LQENTTVRRASISSDAYSGFSEMTYPPVMRYPGPSERPPPLPTPLSQRAPLSKPQGARPPPSAFSPIPEAVGHVSDDSDTLASNSEFTTTVIRSASIS # RGLSLVGASVVGVAPARLQSYSSGTPIDVRDCLTPSDDRTLSYGPFGNISSHQQSAALPSSSMQANFPPDYPRVSPSRQSIRSTKSFVPSVISRISET # GRSIARGLPWKRKPLPPVPTIPHIPIAAENQSRLEESRVPLPQLVARADMLNGLLEKGYHPHQSIDSYYGALPKEDSHTSALEGSDGYVHVQDGGSLS # TDLSGQLKPNRAMKPPNPNRKRYLIVLAIFIVIAAAAIGAGVGVSISRKGSSTVPVCSNANTTGLSCDLGQFIYTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 Scaffold_11 AUGUSTUS gene 1666398 1667973 0.56 - . g355 Scaffold_11 AUGUSTUS transcript 1666398 1667973 0.56 - . g355.t1 Scaffold_11 AUGUSTUS stop_codon 1666398 1666400 . - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_11 AUGUSTUS CDS 1666398 1667005 0.58 - 2 transcript_id "g355.t1"; gene_id "g355"; Scaffold_11 AUGUSTUS CDS 1667517 1667973 0.92 - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_11 AUGUSTUS start_codon 1667971 1667973 . - 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MDPSPVDADVVFIHPPFDNFPDAQNFPEGLTYKVMAENPEWFLDAADYIRVEDSSPCVPTSVAAEKSSLIPYPSHLEP # PRGWCPAKKKDLKDLGSEGWPDGEEPRLRCTFCRRTYAGVNAKSMWRRHVFEKHKIAMSNRRDGGDRPRGRGSTRSLTVDSPSPIPSLMRDDISSPSS # SLISKKSFFADLNTPNSVTNRRLTGLKSSTSTRPALSEESPLGRGIVGRSSHHRNSSELSLDDWLSLPVTRTFLTSLNDWDSENNSSPVAHGLINPAL # NPTESPVVRRDNPLDRSGLGIGLLEPFTLPGNRGHANDSSSDIEDEFEIMDNLTSSRPNLESGNTETMTPPPKKRRTSAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 Scaffold_11 AUGUSTUS gene 1670602 1670946 0.76 + . g356 Scaffold_11 AUGUSTUS transcript 1670602 1670946 0.76 + . g356.t1 Scaffold_11 AUGUSTUS start_codon 1670602 1670604 . + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_11 AUGUSTUS CDS 1670602 1670946 0.76 + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_11 AUGUSTUS stop_codon 1670944 1670946 . + 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MDVLPRNVSAEIFVVCREFLAPKFIDPKFLDPKHVFKDLSASIPDSSDKLARAHNAEANVFQPEKKRRKRDGYEDGNY # TLFKSIPVSELIHSTIRYLYLGLPTRSRSKPTRKKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 Scaffold_11 AUGUSTUS gene 1671397 1672923 0.9 + . g357 Scaffold_11 AUGUSTUS transcript 1671397 1672923 0.9 + . g357.t1 Scaffold_11 AUGUSTUS start_codon 1671397 1671399 . + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_11 AUGUSTUS CDS 1671397 1672923 0.9 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_11 AUGUSTUS stop_codon 1672921 1672923 . + 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MQLQMTAPMDIGLELQDASLGGQDDFFDLQGAEKGMRKRGGVSNLIGTEGVLSQESDVDNDSDNASDEEILDSEEERE # KKTRGLENELDGMYDSYRSRLRERDAKYKVREGREKNKEREAWSGIKKNDSSDEEDSDAEGGGWEEMERAKGHNDNSSSSGDSDDEPEGPKTSTKKRS # LPTTGSSRDSKRARLLTKLKEPIPSGSQASKVWFSQDIFAGISDDVKDIEHEVREEQDVEMVDVEDKTVDIEEENTDTDWDDDEVRVIAGPKCLYLTV # SSHVQDDFEVVPQVGEDVDMWDVANADEDALKQAHIKSLKILLISCALLLMIASEHGLTTAEAVTLAQQLVNREKTKTQLINDGFNRYSLNAKDGLPS # WFLDDETKHYKPNIPVTKEAIAALRAKQRALDARPIKKIAEAKARKKYKAAQKLEKAMKKAEGVNDTSDMSEREKASQIEKLMRKGLSKGKPKKEVKL # VVAKGVHKGVKGRPKGVKGRYAMVDSRMKKEVSYIHFQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 Scaffold_11 AUGUSTUS gene 1675222 1675839 0.51 - . g358 Scaffold_11 AUGUSTUS transcript 1675222 1675839 0.51 - . g358.t1 Scaffold_11 AUGUSTUS stop_codon 1675222 1675224 . - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_11 AUGUSTUS CDS 1675222 1675839 0.51 - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_11 AUGUSTUS start_codon 1675837 1675839 . - 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MSLALPFLKRQLCSNSRLRNVPAYGRAQSTLLERLAQLTSQPKSSPSSVPNSSTSTAISVTSPDALSEHQKAKKELKN # SDATKLKGPSRNLLEESKIQSYLDRIAETGNTVTLADITRLRPNIHSDPETPEYEEEYNALIDRLCRSFSKKQLYSFVKMLEIEGSRRGSAKRHSAVQ # IVEDGWNWPSLAKVKARKRDWSEVLSQCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 Scaffold_11 AUGUSTUS gene 1676029 1676430 0.33 - . g359 Scaffold_11 AUGUSTUS transcript 1676029 1676430 0.33 - . g359.t1 Scaffold_11 AUGUSTUS stop_codon 1676029 1676031 . - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_11 AUGUSTUS CDS 1676029 1676359 0.46 - 1 transcript_id "g359.t1"; gene_id "g359"; Scaffold_11 AUGUSTUS CDS 1676411 1676430 0.33 - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_11 AUGUSTUS start_codon 1676428 1676430 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MGLVSVESYPTAIRGTCYGISAALGKVGAAVGTQAFTPIETNLGKKWTFIVAAICGVFGILVTYFFIPDMTGVDLADE # DAKFMEYLAVNGWQGRVGEDDDAELTVAVETGSLDEKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 Scaffold_11 AUGUSTUS gene 1680027 1681465 0.2 + . g360 Scaffold_11 AUGUSTUS transcript 1680027 1681465 0.2 + . g360.t1 Scaffold_11 AUGUSTUS start_codon 1680027 1680029 . + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_11 AUGUSTUS CDS 1680027 1680321 0.23 + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_11 AUGUSTUS CDS 1680743 1681017 0.53 + 2 transcript_id "g360.t1"; gene_id "g360"; Scaffold_11 AUGUSTUS CDS 1681073 1681465 0.76 + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_11 AUGUSTUS stop_codon 1681463 1681465 . + 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MFLHEKKSLKIEGVVDFEWCPLSDKDRDEVEKVASVGAKGAKKAPENMIAYWTPEVANQPARVTLLSFPGRTILRQKN # LFNVSEASALFCWYPVPINSQTLPNRTSNAIRWSPRGRFVVLATVGSSTKSELEFWDLDFTLEDRRDGQVVKEDWGSSIQSLGIADHYGVTDVEWDPS # GRYLATSASAWTHTLENGYALWDFRGQELLKQIQDRFKQFLWRPRPRTLLTREQQKQIRKNLKEFSRVFEEEDQRESENVNTELLALRRRLVDEWNAW # RARSTKELAEDKGHDHVKEKQSEEDKEEIEVWVEDIIEQIEEEVED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 Scaffold_11 AUGUSTUS gene 1682374 1684113 0.27 + . g361 Scaffold_11 AUGUSTUS transcript 1682374 1684113 0.27 + . g361.t1 Scaffold_11 AUGUSTUS start_codon 1682374 1682376 . + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_11 AUGUSTUS CDS 1682374 1683648 0.38 + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_11 AUGUSTUS CDS 1683922 1684113 0.51 + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_11 AUGUSTUS stop_codon 1684111 1684113 . + 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MFCTDTITRFRAAQRAFRERKQSQLAELQARIQLYEQGEIERNVALQNIAKRLKEENEALRRENAQLKERLDTAEREL # RTIDKRHWRDDSPTSSIGSGASTRKRQRIDDRVQDDALLSHLTTTFSSASPPSMASSPGSNDTSDTPFSPIPLDHHHLTAAHSSILNLSTTDKYDSYA # DHSVFMSCGFCSEHLPCVCRDAFPSSTDMVPKSEIFENTAPGIIRIGSPVPHGTPSILDELPAFQPAVPLRRRQAAASVPVKPVVLVPAPTCSGDPSN # CLACADDSFGKAFCDALGKSVAAQASSGSTSENLSINPAEVSLGSHELIDQQPEGESISTSDAWKQLKSHPNVAFSDLALLADVVARRSKCTGPRVVI # SPAPGSITPERIASPDPLVNSPEKSNDSEAVVLTDPHALFRKQEKARSSPPRLNLSDESNVFHAAISCRNCLYNLFQCDWVNSELVTPWSFLCKSLNC # VASSFREADSNSFGKGCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 Scaffold_11 AUGUSTUS gene 1696825 1697421 0.68 - . g362 Scaffold_11 AUGUSTUS transcript 1696825 1697421 0.68 - . g362.t1 Scaffold_11 AUGUSTUS stop_codon 1696825 1696827 . - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_11 AUGUSTUS CDS 1696825 1697421 0.68 - 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_11 AUGUSTUS start_codon 1697419 1697421 . - 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MMSRTSSRTPSISRASTPGPSNPSGIGYHRSPSKLAVAPALRQSPSLSNLRVHSYNAGTTTTDTNADVPPVPPIPPKL # MSIGSHSSASSVINLELDNTNGNRILVQDVEAEVDSINEDVYQNKPGNESKEGESKKILRDQLRRTLTSNHATTETSSTNRGTARWLPDSRRSFNSKL # SPREYFILTDAGKPVYIRSGMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 Scaffold_11 AUGUSTUS gene 1697609 1698743 0.65 - . g363 Scaffold_11 AUGUSTUS transcript 1697609 1698743 0.65 - . g363.t1 Scaffold_11 AUGUSTUS stop_codon 1697609 1697611 . - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_11 AUGUSTUS CDS 1697609 1698095 1 - 1 transcript_id "g363.t1"; gene_id "g363"; Scaffold_11 AUGUSTUS CDS 1698148 1698743 0.65 - 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_11 AUGUSTUS start_codon 1698741 1698743 . - 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MAAKASSETPKETAKEPEPPKTESEPSKDTSPPPPSETKRSKPEIPVGDRIFASPIAKKIALERGIPLSKVKGSGPEG # RILREDVEKYKPSAEAAPSTAASQPPAAQLPDYVDTPISNMRRTIGSRLTQSKQELPHYYVTVDINMDKVLKLREVFNKTLSEKDKSAKLSVNDFIVK # AVACALSDVPEANSAWLGEVIRTYKKADISVAVATPTGLITPIVKDAGSKGLATISAETKALAKKARDGKLAPSDYQVRETLGYSSTFCLILESQGGT # FTISNLGMFGVSHFTAIINPPQSCILAVGSTEPKFVPAPEEERGFKVVQNMQVTLSSDHRTVDGAIAAKWLSAFKGYLENPLTFML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 Scaffold_11 AUGUSTUS gene 1700043 1700902 0.81 + . g364 Scaffold_11 AUGUSTUS transcript 1700043 1700902 0.81 + . g364.t1 Scaffold_11 AUGUSTUS start_codon 1700043 1700045 . + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_11 AUGUSTUS CDS 1700043 1700169 0.81 + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_11 AUGUSTUS CDS 1700274 1700902 0.94 + 2 transcript_id "g364.t1"; gene_id "g364"; Scaffold_11 AUGUSTUS stop_codon 1700900 1700902 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MNDWNPDESTFIESKSSQAAPVVKIFPETPPSASLHSVRSPPLDDDDNDSPRTTSQTVQQIDTDANGFDFHDPLSTMN # DQTEHSPPSSVHSGLLSPVEFSDLQLKHFSHLHSNSHSRTPSLDPGFYDSIGATNLQWVSPSPMVLSPPRSPAMSSTFELLASPFGSPSARLIVNSAA # GMMSPRLGAFTPRIPVSPSPLASKFDDFEEEDAQDVQPDLGLDSPTEYYQKKKEEAESVSRLIQAQEEENVAHQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 Scaffold_11 AUGUSTUS gene 1701774 1702310 0.63 - . g365 Scaffold_11 AUGUSTUS transcript 1701774 1702310 0.63 - . g365.t1 Scaffold_11 AUGUSTUS stop_codon 1701774 1701776 . - 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_11 AUGUSTUS CDS 1701774 1702310 0.63 - 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_11 AUGUSTUS start_codon 1702308 1702310 . - 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MRCPWKRPGALLANAGGVDGECTGGVRTLAVGGDDGGEDSEIEGEVLDREDLELGKEFLGREDREPGKVFLANAGGVD # GACTGGVKTLAVGGDNGREDRELEKGFFGEKDLELEKEFLANAGGVDGAFTGGVKTLAVGGDNGREDRELEKGFFGEKDLELEKEFLANAGGVDGACT # VG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 Scaffold_11 AUGUSTUS gene 1702872 1703968 0.49 + . g366 Scaffold_11 AUGUSTUS transcript 1702872 1703968 0.49 + . g366.t1 Scaffold_11 AUGUSTUS start_codon 1702872 1702874 . + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_11 AUGUSTUS CDS 1702872 1703412 0.66 + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_11 AUGUSTUS CDS 1703547 1703968 0.71 + 2 transcript_id "g366.t1"; gene_id "g366"; Scaffold_11 AUGUSTUS stop_codon 1703966 1703968 . + 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MVQLADPLSSTDPFSDDNRSSIASTSVLSASASMESALSNNPLVCISFHWENINFIVLISQLSSTLSPSSIYSGQIQH # GSLDPTVSSSIPLSAPPAATGGHLMQSPPISAPMSSSFKIPPSQKRSSIYYIRNETNGLRDSPPNSSGIHEPKSAPLARPPTWERKDSIRSGSVRSFS # TSASRLSEKAPVLQDASLSLAHDSSPARADTPPHSSTPRPTLLFAIASDDPKAVERVLEHGDDESKGLIDANDTIGPQAQSALEFTLENEGLKNKLGI # VKKLLGYGADPSKAKLNDSTSNDDAELDPATRYLRSAIFPVHHGIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 Scaffold_11 AUGUSTUS gene 1708670 1708975 0.72 - . g367 Scaffold_11 AUGUSTUS transcript 1708670 1708975 0.72 - . g367.t1 Scaffold_11 AUGUSTUS stop_codon 1708670 1708672 . - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_11 AUGUSTUS CDS 1708670 1708975 0.72 - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_11 AUGUSTUS start_codon 1708973 1708975 . - 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MAQTFELLVGRWLFDPEDAQPDWSVEDDHLAKMMELTGQKFPDTMLARAKERDKYFDKNGEPFQNFPIDFEADMGQAI # SSEFLILCQSSSRMPWRTITSLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 Scaffold_11 AUGUSTUS gene 1710782 1712429 0.84 + . g368 Scaffold_11 AUGUSTUS transcript 1710782 1712429 0.84 + . g368.t1 Scaffold_11 AUGUSTUS start_codon 1710782 1710784 . + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_11 AUGUSTUS CDS 1710782 1710964 0.84 + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_11 AUGUSTUS CDS 1711040 1711536 1 + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_11 AUGUSTUS CDS 1711646 1712429 1 + 1 transcript_id "g368.t1"; gene_id "g368"; Scaffold_11 AUGUSTUS stop_codon 1712427 1712429 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MGNDDLERTERAVSSTLADVEGKYTRALEEKILLEHELIDKQTWRNSANDSETSFEYGVIILTTRSSTASSDSSHSSG # PSFPRMSAPSTEDLLSTPAPPDLQLSELDLSTETLQDSSTSEDEVTPRKQIPNSKGHSALLQRAGFMPAKTSSLSTPPSSSSIPRSRTIPSFSSPRTP # TSPTKRAAVARNPSTMSTSSTTSTASKSRGVQMVTEMRARVKILNKRFTLGRTSWDNPLLTRRSSESKRSTESESEKSKKGSGDTSGWVLIMEDSPSP # PKERRRASSPKKTFRAAASTSSSPTFGSSRASPLFQSTANIGGPGTKRPQSRLSGGSTATTTSIPTPTSRPATPTFLPLPTATSTTMLGQKRSTGPGG # ANPYAYQPKRSSLGASNAAMPPPPGYVGIRSGSSTPSDNGKALPHLPGGHANVTVRSHNAKLPASNSAALLGQSRIGRPSGTRRKSAEASPDNTLRSE # PARTRPGSAAAHRKSNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 Scaffold_11 AUGUSTUS gene 1715695 1716203 0.63 - . g369 Scaffold_11 AUGUSTUS transcript 1715695 1716203 0.63 - . g369.t1 Scaffold_11 AUGUSTUS stop_codon 1715695 1715697 . - 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_11 AUGUSTUS CDS 1715695 1716063 0.97 - 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_11 AUGUSTUS CDS 1716123 1716203 0.64 - 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_11 AUGUSTUS start_codon 1716201 1716203 . - 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MTRRERELEERRLARMIPDVNERRQVQAIFENNAHIQQRFPGGIVQFAQAMELLPPDALEDMFAAAAIGAEQDNGDRG # MPGQMPGLDDFFFGGADNNGAREAFNDRPIGEEDAREDEDEEDDDEENEDEDEDIAVSFAAFLGCPFNALT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 Scaffold_11 AUGUSTUS gene 1716730 1717023 0.84 + . g370 Scaffold_11 AUGUSTUS transcript 1716730 1717023 0.84 + . g370.t1 Scaffold_11 AUGUSTUS start_codon 1716730 1716732 . + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_11 AUGUSTUS CDS 1716730 1717023 0.84 + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_11 AUGUSTUS stop_codon 1717021 1717023 . + 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MLADSITSNLSASKGMTEGNESAASISAAVPALSPPSLSDNFNASALAYAHPGNTLGSTRNDFWGEVDDFSTKFDSNR # ANTSNSHCDIPALSARKSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 Scaffold_11 AUGUSTUS gene 1723309 1723760 0.44 + . g371 Scaffold_11 AUGUSTUS transcript 1723309 1723760 0.44 + . g371.t1 Scaffold_11 AUGUSTUS start_codon 1723309 1723311 . + 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_11 AUGUSTUS CDS 1723309 1723397 0.44 + 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_11 AUGUSTUS CDS 1723457 1723760 0.85 + 1 transcript_id "g371.t1"; gene_id "g371"; Scaffold_11 AUGUSTUS stop_codon 1723758 1723760 . + 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MFLDSLREREEAEEKARQERDGEEVKGFKEAVAARMQLSNAPPPSIGSSSAAKSTVSKKDPKAPAIVKKDLKKLSLKG # VVVKKKKIASAGKTDVPVIVEAAKTVRSWDTDSNTGDGPSTKKRRISESSES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 Scaffold_11 AUGUSTUS gene 1725616 1726665 0.41 + . g372 Scaffold_11 AUGUSTUS transcript 1725616 1726665 0.41 + . g372.t1 Scaffold_11 AUGUSTUS start_codon 1725616 1725618 . + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_11 AUGUSTUS CDS 1725616 1726665 0.41 + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_11 AUGUSTUS stop_codon 1726663 1726665 . + 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MAPTLRIGVDVGGTNTDACLIDPFATTSPNRGILSWHKSVTTPDPSHGIENVINALIKQANVDAGDIASITIGTTHFI # NAVIEKDRSRLAPVAVLRLCGPFSRSIPPGIDWPADLRELICAHAAYLDGGLEIDGSVIRDPSEAQVKEECTRIRSLGIRSIVVNGIFSPADVLGECQ # EEKVGEWIKSYYPEADVVLSKEGELVVRPLVSWYNSSILVANLGFIERENAAMLNASILPFARHTISSFQFAIYHRLKLSCPVFLTQNDGTILKAEDA # ARLPIRTFNSGPTNSMCGAAFLVKENVEKECMLVVDIGGTTTGNRVYTICTLYKLFLRCWHASCQWVTQTSLSFH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 Scaffold_11 AUGUSTUS gene 1726868 1727242 0.33 + . g373 Scaffold_11 AUGUSTUS transcript 1726868 1727242 0.33 + . g373.t1 Scaffold_11 AUGUSTUS start_codon 1726868 1726870 . + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_11 AUGUSTUS CDS 1726868 1727242 0.33 + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_11 AUGUSTUS stop_codon 1727240 1727242 . + 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MVFGGDIPTATDYAVASQENLQTSIGTRQLSVDRLNQVVESKEYTLPELLTAYQTTTKRKLEEVIDRMKTSAENVPVL # LVGGGAIIIQSYANDGKVTLKGASKVITPEYAGVANAIGAGEVVTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 Scaffold_11 AUGUSTUS gene 1727299 1728003 0.41 + . g374 Scaffold_11 AUGUSTUS transcript 1727299 1728003 0.41 + . g374.t1 Scaffold_11 AUGUSTUS start_codon 1727299 1727301 . + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_11 AUGUSTUS CDS 1727299 1728003 0.41 + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_11 AUGUSTUS stop_codon 1728001 1728003 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MVDTVLNTEGRTTQSVLQEVSKTAIERTVTAGAVCDTVEIAEMDAIPIPVSLIDSTPLLTSYVLTFYHQYVANKCRVI # VKAVGDFDFSRVSNTTLASLDLKVSSVTEYSEKNMSTKASTTFDTPRSTVDAASYIPTIVPTLGRSTTSSLSKESSNYEWHLSELDLEWISVGCYILG # TGGGGTPYPHFVRLREMIRSGATVTIVEPGWVGDEDIVACGGAKGSPTVSLEKPPGNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 Scaffold_11 AUGUSTUS gene 1728437 1729165 0.33 + . g375 Scaffold_11 AUGUSTUS transcript 1728437 1729165 0.33 + . g375.t1 Scaffold_11 AUGUSTUS start_codon 1728437 1728439 . + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_11 AUGUSTUS CDS 1728437 1729165 0.33 + 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_11 AUGUSTUS stop_codon 1729163 1729165 . + 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MLSATSERQIERAFRAALSEMGSHVGCAKGPCLGKDMKTWVIENTISLSWRIGRSIALCRARNDIDHVAEAIIEQVGG # KEAAKVLFKGKILEAERKTVKGHSYGEVVISAADITGNVAGVAGKTAEFNGKMKIPFKNENIVAIAISESGDEVVASVPDLICVCDALTGEAIGTPEY # RYGLLVFVLGIQGSERWTSSMRGIQIGGPRAFGMDIDYKPLEYLRDLAASSRSTCMLFISAIEYLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 Scaffold_11 AUGUSTUS gene 1736851 1738835 0.47 - . g376 Scaffold_11 AUGUSTUS transcript 1736851 1738835 0.47 - . g376.t1 Scaffold_11 AUGUSTUS stop_codon 1736851 1736853 . - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_11 AUGUSTUS CDS 1736851 1738653 1 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_11 AUGUSTUS CDS 1738812 1738835 0.47 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_11 AUGUSTUS start_codon 1738833 1738835 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MTSTPNRVTSTFDAERQAFYDNEQHLKSRIQSLSQVRRKPESPTYPEVESETEYEEEETEVNTSPEDVASKQDMSDPE # QEPAEMTALRLELSTLSTSYSSLQSTCVLLQTQLIDLNRVNKQLQEDNESYMILLQERTLNGQFDLLKQVGGGDDDDEESDRGDVGSLRSTGRSTLDR # VEEEMPETTGSLADELSARIMPEGSDSHHGRVRQGRSHESSTSHSPDGPRGESLADLPITGPGLDLAAELGRAENKDILEGNVDEPLVNSKGKRSRKD # SKGASGFLEPSVSTSDVLALRSEVKALKDANKALSLYASKIIDRIIAQEGFEHVLAIDYENEPPTPSTAAPKTAKARPQSVIVGRSASVSSGSESLHL # NSPGFNVPKLGNPTPPSATTKASRRSLSFDWKGFSLFNNAEKKPESNLRPLTLKPGASPVTSARKLDTTEDENDRRERERINATMKLMGIETPASPAP # MQKAFSSPGPAPPPSAGTNRRFSIFGSRTPASEPSSSPLLTFTPSLSANSSRIGLGIEGTELTQEALEHAEAENTLAALDAHERSLSSEIAKGSSGGF # TEIRRSNRRGRRSAGGSDSGRSGRSTVWSAGMSATGEDDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 Scaffold_11 AUGUSTUS gene 1739652 1740635 0.43 + . g377 Scaffold_11 AUGUSTUS transcript 1739652 1740635 0.43 + . g377.t1 Scaffold_11 AUGUSTUS start_codon 1739652 1739654 . + 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_11 AUGUSTUS CDS 1739652 1740635 0.43 + 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_11 AUGUSTUS stop_codon 1740633 1740635 . + 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MTFHYLSESIPLNIYASEPDALHPSMRQGMPSNFPRLGDVLEIQGPPASGKSHLLCLLMIICIIPTTYASTSLGGWGK # VTILYDTCATFDLARFKQLLTSHLATTLKNKDSNDIQILVKRSLQNLHIFRPSSSIQLAATLFRLPSYHQINLPDSEIGILAIDSMSAFCWADRFTAE # QLRATPTSRVNESHNPLKHVIVALQRFHHTHKPLIVFTNWGLTPEVIEDERGSFSYRQHLNPPPALFPAVEVSATSEYSFASALPLTFHITLSMAKVP # QFPVDLSFTDTSIQRSFATRQITGIIRSARSSQASRIAFKIEADHMDLPIVLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 Scaffold_11 AUGUSTUS gene 1740783 1741066 0.5 - . g378 Scaffold_11 AUGUSTUS transcript 1740783 1741066 0.5 - . g378.t1 Scaffold_11 AUGUSTUS stop_codon 1740783 1740785 . - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_11 AUGUSTUS CDS 1740783 1740899 0.72 - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_11 AUGUSTUS CDS 1740971 1741066 0.55 - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_11 AUGUSTUS start_codon 1741064 1741066 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MKVDRYVEPSEFDKWKQVAEDLGFLYVASGPLAGEYYIENVLRGKGSEKKSNKLAAQEIASGDLETNISS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 Scaffold_11 AUGUSTUS gene 1747220 1748049 0.78 + . g379 Scaffold_11 AUGUSTUS transcript 1747220 1748049 0.78 + . g379.t1 Scaffold_11 AUGUSTUS start_codon 1747220 1747222 . + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_11 AUGUSTUS CDS 1747220 1747711 0.98 + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_11 AUGUSTUS CDS 1747765 1748049 0.79 + 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_11 AUGUSTUS stop_codon 1748047 1748049 . + 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MSLSRILNDEPSPALSARSSFVPPSRSISAAAGHTDVSSSSSVMPAPPLRPFLHRSHSEAFGGPGPSSASSHSENEIW # EPYPPTTQWIHDPNALPPNNVPFGSSHNGHDRGSHLQPISPIEHLPPPPPVLKGSDQSKNEGPSTKKRRKGAKNDIDTAASNGQRRSSRKSQRSTKQT # QPDVDAPPQRFASAASDDIPGILRQDEQASVSSDLEDCKELWMDEVDHYMLESTKRYQRVEDWFHASLKVCSCPSSGIHMPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 Scaffold_11 AUGUSTUS gene 1748353 1749426 0.16 + . g380 Scaffold_11 AUGUSTUS transcript 1748353 1749426 0.16 + . g380.t1 Scaffold_11 AUGUSTUS start_codon 1748353 1748355 . + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_11 AUGUSTUS CDS 1748353 1748841 0.42 + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_11 AUGUSTUS CDS 1748925 1749237 0.4 + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_11 AUGUSTUS CDS 1749317 1749426 0.97 + 2 transcript_id "g380.t1"; gene_id "g380"; Scaffold_11 AUGUSTUS stop_codon 1749424 1749426 . + 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MIADGVDEIGVLSSTTKHAIKKRKLESGTIDLVADEEQLFDSEVPKLQPIPPSVKLVRGKLVPFTPRDTSLDIVPPGK # YSRKKPGPKKKVPIAPELVQEMPSVPPSVAGDVTPVASRAATPAPVHSGVIFEMDEVIPSLKKAKKMDDSAIQKRVKALEDAQRKVYKYHSTGHQARV # AQLERIAKLASLQARRPYTKTVKTGKEVQAKAKRLMREMQVFWKKNEREERDVRKREQKEAMDRLKIEEERREAARQARKLEFLISQTELYTAEVQGD # EISAAQVPAGAEVTDVGPDDLKDINFDDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 Scaffold_11 AUGUSTUS gene 1751558 1752857 0.23 + . g381 Scaffold_11 AUGUSTUS transcript 1751558 1752857 0.23 + . g381.t1 Scaffold_11 AUGUSTUS start_codon 1751558 1751560 . + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_11 AUGUSTUS CDS 1751558 1752150 0.6 + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_11 AUGUSTUS CDS 1752202 1752358 0.33 + 1 transcript_id "g381.t1"; gene_id "g381"; Scaffold_11 AUGUSTUS CDS 1752489 1752857 0.96 + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_11 AUGUSTUS stop_codon 1752855 1752857 . + 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MKFTILPSLVNLNVAECMPDLRSISILSWQESCLSRPLLKWSIPPVVAPPVTMYCKDRAFVESQLRVLEDPVDSLALY # GLPPSLKDSQEAYVRFQQQYPGVPPFGLFAASPSDQIPLSKMQVPEAKRLIYDSAKLARLDALLQELKAGDHRVLVYFQMTRMMDLMEEYLVYRQYKY # LRLDGSSKIEDRRDMVIDWQTRPDIFVFLLSTRAGGLGINLTAADTVVFYDHDWNPSNDAQAMDRAHRLGQTRQVQDIVVGSKNFTDVAKPSEIVQLL # LNDEQLASLDTSSSQGAANSKGKGVPDSTRDLWIEEGDEFFAGPQSTAVGASGIEAAEDENGVSMKKRKKPGPKPGTRRKAPVKNSKPTTEVQTVEEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 Scaffold_11 AUGUSTUS gene 1758137 1759612 0.98 + . g382 Scaffold_11 AUGUSTUS transcript 1758137 1759612 0.98 + . g382.t1 Scaffold_11 AUGUSTUS start_codon 1758137 1758139 . + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_11 AUGUSTUS CDS 1758137 1759612 0.98 + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_11 AUGUSTUS stop_codon 1759610 1759612 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MARTPRTPAEFLIPSTPTPASKYFKKKPSSNLDANAPVFIPSWKSTVENELTSDSASALHTSPLPVISLEADEDHSDI # SIVKSRILASFGNGSGSDTDSSSENDLNDEYVRLNLKIASLSTHRDVSTTLQLQELQKRLLILRKNYVFDEQEAEKLYAVARKKADIASLDARLRGVK # ADTDVTNTSKSPKKRPVEIQTSTPEISSTVDVFDQEDNAEGGLLDILEEMPNSEITTEGVTVSVRDMALPKHWSGRTSKTLLAETVAKSDRYAVVTYS # IISGPSRVKRASVSVRWEGRKTDEWFMVDVACHDEGQAEQYVATLALHALTFPSTEGFAAGSSGGPQTFFRLLPPVYRDLWSELTDARKLKDDAINRG # VWANLRSIVEPKLSVPSKDQGSIKIQRATNENLEVASNRRLYPNGQAFSEQLMSNFRARQSTSAYQEMLVRMPYPLLDHYTKSALQVHRNALPIASYR # DIIIDTLEQSQVLVLSGETGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 Scaffold_11 AUGUSTUS gene 1762994 1763162 0.78 - . g383 Scaffold_11 AUGUSTUS transcript 1762994 1763162 0.78 - . g383.t1 Scaffold_11 AUGUSTUS stop_codon 1762994 1762996 . - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_11 AUGUSTUS CDS 1762994 1763021 0.78 - 1 transcript_id "g383.t1"; gene_id "g383"; Scaffold_11 AUGUSTUS CDS 1763077 1763162 0.78 - 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_11 AUGUSTUS start_codon 1763160 1763162 . - 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MNPDRTNVILFSVVATTKDSYTLKFFNISTDNDEDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 Scaffold_11 AUGUSTUS gene 1772175 1772726 0.2 - . g384 Scaffold_11 AUGUSTUS transcript 1772175 1772726 0.2 - . g384.t1 Scaffold_11 AUGUSTUS stop_codon 1772175 1772177 . - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_11 AUGUSTUS CDS 1772175 1772441 0.81 - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_11 AUGUSTUS CDS 1772592 1772726 0.2 - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_11 AUGUSTUS start_codon 1772724 1772726 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MAPTVTSIQPRYIKDGSEAITALSFSMDGHYLASASKDTYLRVYDIAIGMIYDNDINQISQRGEKAELIYESSSPINA # VELDKTRRMMLICAGAYVNVMEQQEGINSTGTFIPISTYNRSHLDNTESHKLHWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 Scaffold_11 AUGUSTUS gene 1773259 1774770 0.74 + . g385 Scaffold_11 AUGUSTUS transcript 1773259 1774770 0.74 + . g385.t1 Scaffold_11 AUGUSTUS start_codon 1773259 1773261 . + 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_11 AUGUSTUS CDS 1773259 1774770 0.74 + 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_11 AUGUSTUS stop_codon 1774768 1774770 . + 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MPNFFVPGWVTSSFPFMGFAPSSNPFKCDFLRCLDFSAQTLPIVGDADCGYSLKPSLKTDWDSLERNLRVFLRACMKV # NGVGVPDDLRLWSFPLQYGYSRTYTTLDDARAAAYRSRQAFIPLIASVSFFLHLLYHMQNKWVTLIATDIRVSLPKSNPFWSARQNAEAERRRGPVPS # KWDWQDRLQKETFISTEWLSYFYEIMEIPMVGVFMDVHNSGCLPWLNIFLETKMPVVLFWGTVQNWRIPRELSPALPVPTGVMVKSLISKQSPYSPIE # PVLDNTQYSSTRTRQLRLPRIDGGTQPRRNEGIFEFLKRRASDKARAIATESAKDRQSRLQREEHASKDMPPGRKGARVYYWDLVEGIRVRNPVGRSN # YEDIWERYGPRQRCYDAVADEWDICTELDPNDEPSFGDDDEDDDDDYFITPQSVMSQEIDHHHGPSSSNAYLTRLQSSSHSRDPVIFSEEIDNVVKHR # FGFLPRDNHSDRPVKFSASVWFKHCSDWLWTAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # # ----- prediction on sequence number 2 (length = 1789215, name = Scaffold_8) ----- # # Predicted genes for sequence number 2 on both strands # start gene g386 Scaffold_8 AUGUSTUS gene 2239 2568 0.62 + . g386 Scaffold_8 AUGUSTUS transcript 2239 2568 0.62 + . g386.t1 Scaffold_8 AUGUSTUS start_codon 2239 2241 . + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_8 AUGUSTUS CDS 2239 2568 0.62 + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_8 AUGUSTUS stop_codon 2566 2568 . + 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MSGPSLATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSA # DEGTSSQVGGSIPMELDLPAIESLAEPALVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 Scaffold_8 AUGUSTUS gene 3727 5049 0.55 + . g387 Scaffold_8 AUGUSTUS transcript 3727 5049 0.55 + . g387.t1 Scaffold_8 AUGUSTUS start_codon 3727 3729 . + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_8 AUGUSTUS CDS 3727 3891 0.61 + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_8 AUGUSTUS CDS 4531 4666 0.83 + 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_8 AUGUSTUS CDS 4748 5049 0.99 + 2 transcript_id "g387.t1"; gene_id "g387"; Scaffold_8 AUGUSTUS stop_codon 5047 5049 . + 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKSA # VNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSR # QDSGSDSSASDASFATAQSIPTWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 Scaffold_8 AUGUSTUS gene 5433 7897 0.33 - . g388 Scaffold_8 AUGUSTUS transcript 5433 7897 0.33 - . g388.t1 Scaffold_8 AUGUSTUS stop_codon 5433 5435 . - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_8 AUGUSTUS CDS 5433 6016 0.98 - 2 transcript_id "g388.t1"; gene_id "g388"; Scaffold_8 AUGUSTUS CDS 6144 6546 0.93 - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_8 AUGUSTUS CDS 6695 7897 0.34 - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_8 AUGUSTUS start_codon 7895 7897 . - 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIK # KFQVDDQGRLYHRNTDQPDQPQLVVEKKSTDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDD # IICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGRLESTWLVNPPNRILTRDELIGYRAQALSKHNSF # IEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRN # EPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 Scaffold_8 AUGUSTUS gene 8616 10150 0.92 - . g389 Scaffold_8 AUGUSTUS transcript 8616 10150 0.92 - . g389.t1 Scaffold_8 AUGUSTUS stop_codon 8616 8618 . - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_8 AUGUSTUS CDS 8616 9703 0.99 - 2 transcript_id "g389.t1"; gene_id "g389"; Scaffold_8 AUGUSTUS CDS 9778 10150 0.93 - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_8 AUGUSTUS start_codon 10148 10150 . - 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNS # QRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEK # PINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFA # WEPSEAGPLKMNSFHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 Scaffold_8 AUGUSTUS gene 10470 11556 0.17 - . g390 Scaffold_8 AUGUSTUS transcript 10470 11556 0.17 - . g390.t1 Scaffold_8 AUGUSTUS stop_codon 10470 10472 . - 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_8 AUGUSTUS CDS 10470 10747 0.63 - 2 transcript_id "g390.t1"; gene_id "g390"; Scaffold_8 AUGUSTUS CDS 10858 11123 0.3 - 1 transcript_id "g390.t1"; gene_id "g390"; Scaffold_8 AUGUSTUS CDS 11270 11556 0.29 - 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_8 AUGUSTUS start_codon 11554 11556 . - 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPY # DHVQPRTYRVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRICL # KS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 Scaffold_8 AUGUSTUS gene 11687 12761 0.24 - . g391 Scaffold_8 AUGUSTUS transcript 11687 12761 0.24 - . g391.t1 Scaffold_8 AUGUSTUS stop_codon 11687 11689 . - 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_8 AUGUSTUS CDS 11687 11921 0.41 - 1 transcript_id "g391.t1"; gene_id "g391"; Scaffold_8 AUGUSTUS CDS 12007 12761 0.28 - 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_8 AUGUSTUS start_codon 12759 12761 . - 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGTLIYRLLQIKFDPKGIDGEQQQMVALNKDLM # EANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMIKFDTTEWSLESI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 Scaffold_8 AUGUSTUS gene 17230 22268 0.51 + . g392 Scaffold_8 AUGUSTUS transcript 17230 22268 0.51 + . g392.t1 Scaffold_8 AUGUSTUS start_codon 17230 17232 . + 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_8 AUGUSTUS CDS 17230 19030 0.51 + 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_8 AUGUSTUS CDS 19123 22268 0.93 + 2 transcript_id "g392.t1"; gene_id "g392"; Scaffold_8 AUGUSTUS stop_codon 22266 22268 . + 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MLLWIVTCVIHCIHSISLTSSYEAALSLKPTLNNSDLLPYRGGGRKSKATAYSTMCSSFHALPNAVPTAPFTFRSRLP # SHNFSVNPSDSLLSSSNPHDSPLDAAAGSNGHSSSANAPAFQATFLNNEDQGPNLSLQHDNAIDCTTPSVSGTTDFPPPPIVQSLQDDIIRRWCAASQ # PSQFEEAGCAVCSLLKLKSDLSLLKHVQNMLHVLEVPGVTRVARKKASDPIRERSGPVIDNTCNMICNSCRSAVRTGKVPRFALCNGLWLGQVPPELN # NLTFYERILVSRVRHSKCFVRVQRGGSNGNGHSKLVSNVIAFENPTPKIYDILPPPRKDNEEVLAIMFSGTGSPTDDDYKRALLLVRRNVVADAIHWC # ILNHCDYSDVLFSPDNLQGYAEDSPIVSIEFFEKHSNRNAEGVSVHDNLDDDGIEGGDCVFTVHGIVGEDLQHMSSEAQKAQAIKHLDAGGKFLRMSH # AQKPESLYNNPHLYPKMFPWLFPFGLGGIGGTRLPSNKLSDEKHKSLLMLYHDKRFQTDLSFPFIAFSHEQVKAGTTQSYLVANSKKFDSITSRMLSI # DKETLQDLASRMAVGEYVKPSTAQEKDCFALLGGPVWYFTLAPCDQKHPICIYYADTNESFDVPLRTSAERRRLLSNNPAAGAWFFHFMVSLFLEIIV # GTKSSKPGVFGPSAGYYCTVEQQGRLTLHLHGLIFSKKTLSPLEMKHHLIDPSSDFQHRLIAYLESVRIGEFLTGEKAQVKAAVADAEKSDLYVSPEL # VLPIPPPLSCSCSQPDCVACASYTQWFKQYQFTIDDLLTKSNLHDCLRAFYPDGSIRSLDKWAVSCLNNKFKKCKARFPRAAYMSSSVDSDSGHLTLK # KLEPWLNDISPLITYTMRCNTDVTCLLSGTAIKAVVAYVADYITKVGLKTHVVFDSLRAIFDRNTHIMNGPQSDKDKSRILMTKMVNLLATKLELGSP # MICMYLLQNPDHYTSHLFIPFYWKPFVTEAQKFWNPNDAQIDNKVLLIKRKDAYIGLSSTYDYTHRPKQHEVYNLYDWILTFHRIRRSRRAKKKEANV # SDDEFESEISANQLHELNLPFLSGHPLSSTHTVAMRRNRDRVIPNFIGPPLPRPDKEDREYYCCAMLTFFKPWRSGADLKGPAESWHDAFTSHPFTDC # ENLYIKNMNLRYECLDSRDDFRQKMKEGNAVSSLTNALPFNLDCIDDTLHASLYTKPSFDEDIVDNENDETIVLYDPDTGMQKGKQYIARERAMKVMR # DILFTAGWTNSLPIVLNADKPTPLRISIPSCSPTEWNTIIKTMRQEILLKRKEHLFDNKCSDKNEANTYKCRPNIVEICDKTYFDKLGIEYGSIKKLT # EFIINDFHLNSEQERAFRIIAQHSAANCMDPLKMYIGGMGGTGKSQIIKAVLEFFQLQKRRHAVIIVAPTGNAAALLGGSTYHFLLGINGKFEEAPIS # TMSEVCSRLQGIEYVILDEVSMVSCVEMYCISERLAKVRNEAELAFGGINMIFAGDFAQLPPIGGESVSLYTHHAGMDPKSLNGQRVAIGKALWHQVT # TVVILRKNMRNQGHSEEDTQFRKALENMRYKACTKEDIRCLDHLVSANKPGRHYVGSVPWRNAPIIVGKNKQKDEINRIGAMRFASDTNQKLILFTVK # TL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 Scaffold_8 AUGUSTUS gene 22313 23461 0.88 + . g393 Scaffold_8 AUGUSTUS transcript 22313 23461 0.88 + . g393.t1 Scaffold_8 AUGUSTUS start_codon 22313 22315 . + 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_8 AUGUSTUS CDS 22313 23461 0.88 + 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_8 AUGUSTUS stop_codon 23459 23461 . + 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MKKTKVNTMSHDLQKILWDLPPSTHEYHAPAVLPLCYGMPVIIRYNMATELNITKGQRGTVYSWQCKKGKHGQTVLDV # LFVELDNPPSPIQIQHLPPNVVPIIRRENKGYVYLPDDTKINIARNQVDVLLGFAMTAHASQGQSLLVNTTDLNTLDGHHAYYTALSRSKSYYNTAIL # QGFDAKYITGGASGALRKEFRELEILDEITRLRYEGKCDNTVQGTTRLVLIELFRKWKGIYYNPPLTHTSIRWTARDPYVVEQHDVIPWSIIASKTKE # KSVTVASKAKITSVNSAPLLATNTLKRKATEANLNENGKSPSKKVRYVKEHSIRHLKATEPAGPSTVEFAFQAMGTVTPTATLAIPSSIDHVVPSPSP # LKSSVLNVRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 Scaffold_8 AUGUSTUS gene 27921 28760 0.85 + . g394 Scaffold_8 AUGUSTUS transcript 27921 28760 0.85 + . g394.t1 Scaffold_8 AUGUSTUS start_codon 27921 27923 . + 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_8 AUGUSTUS CDS 27921 28760 0.85 + 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_8 AUGUSTUS stop_codon 28758 28760 . + 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MTTSDDTNQPYHQWWADRLLRLAKGAEVEKTKQSIGTVWKNLPYALKKMVDEEHNTWTEFTDAIKKVKWSVLKVEAEH # EASKVVPLVIPETPRTKLATSFAATRITSPPSPSPSRVRPAYTANTGMRRPRRLFTALDDLQKGALRRGIAAKVQHPNTPEGIAAWKAELLEWASRHG # VDGALSEITIIPLKPGTEAVCSGECFKCGSPRHGFEVPCPRPGTIPPVESDWRAYCQRELGGKPARVNAVQLVGPEAIFEGMCEAPAQKACSGLTQTG # PKRTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 Scaffold_8 AUGUSTUS gene 30797 34099 0.95 + . g395 Scaffold_8 AUGUSTUS transcript 30797 34099 0.95 + . g395.t1 Scaffold_8 AUGUSTUS start_codon 30797 30799 . + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_8 AUGUSTUS CDS 30797 34099 0.95 + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_8 AUGUSTUS stop_codon 34097 34099 . + 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MPKGLQVDSVGGFDVPPSREVSSEDSPGDPQHADQTQTVPICVLQPDGNHPDQGDMGFDFFPDALDQSDNVNLFTRNE # GATGAFRPERVQEILRKVKIGKDLSADQRARVEHLLSEYADCFALSVGEVRPVKGAVHRLNIPEGATFPKKVRQKSLTPPQCKYLHAKVDELLEAGVI # ERCNPEDVKCVSPLTLAQKAHEGMGLTVEELMHRLNDECVAAGLPASFDLPTRPIQPSEPSERAEPAKPAKWRICQNFMAVNKLTEIAPMPQGNIRSK # QQSLSGHTYICLFDFASGFYACEVERESRPYTAFYVEGKGYFWCAKLPFGLTGAPSTFANMTALHLDDLIADGTIELFVDDGGSADDDFDSMFAKLRR # ILDRVRSRDLSLSAAKSEFFMSEGIFAGGKISKDGVTVDPAKLTAIVEWKQPEDALNLASFVGLTGHFRDLIRNYARIEGPLRNLLKSVPLPQNYTKS # TYQKAMESFKLTHRWTLEHTKAFLALKKALVTEPVLKAPRWDGSSFIITTDGCKEGFAAVVAQRFEVVHPNGTTTYKTHPVGFASKRTLTSEQNYKPF # LLEFAALKFGLDKFSDMIWGFPVEIETDCQALRDVIANDKLNAAHSRWRDGVLAHHIVDVRHIPGKLNVVADGLSRMWEGQDRVVGDGSEWTVSEDWE # AVTGLINDVFGVSTAEGIMEGAEVTDWRALSERFVEEPVFLEVLNTLKVLEDSTDEKAKQRAKHKAARYMVEGNRLWKVGGNKGVRERARVECITRKE # AVELAKKQHGDAGHWGRDAVKLALMDRIWSPKLDESVMEAITNCPECKNFGAAHIHALLNPITRRHPFELLVGDYLSMSKGKGGYKTVGLYLDTYSQR # VWAFKFKVAGSGATTTSSLTSLFNGYLPPETFMTDNGSHFANKEVEALCAKWGTKQHLTPAYSPWVNGLVEGTNKILLHVLKRLCAPKLGEDSEKFKE # MNWETLPEKWPEYLDEAVRIINNRILPSVKFSPNELLLGAVVNTRRTPVVDATSILQPQQVEVQAAYVEQQQLDGYGLFVRHAVKRKGVFDRRVLKKE # GKEVVFEKGDLVQVYRSDLYLQDYQEDHSEMVSTLSSRSAGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 Scaffold_8 AUGUSTUS gene 41457 42134 0.8 + . g396 Scaffold_8 AUGUSTUS transcript 41457 42134 0.8 + . g396.t1 Scaffold_8 AUGUSTUS start_codon 41457 41459 . + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_8 AUGUSTUS CDS 41457 42134 0.8 + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_8 AUGUSTUS stop_codon 42132 42134 . + 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MYGTGSQFTTYEAILLFWTYDEHYYIWSPPEFEHNSANTFKAIWHTSPSPNTACTRRCSVDVPLTVFKHRRRQFQFPA # EVTHHEADRSDKEADVRQPVADTPNEALTSEFTSLVTTLSSISSLSSLSPSPPPIVPTRIPFMSTPPPRAATKGPAYMPAPGSTRAPDKFKGNSSQLR # DFLGSLKDMLSRQELTDDEKVRSILKYVDGMTRSYWKTLDSYEDEIGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 Scaffold_8 AUGUSTUS gene 59910 60497 0.84 - . g397 Scaffold_8 AUGUSTUS transcript 59910 60497 0.84 - . g397.t1 Scaffold_8 AUGUSTUS stop_codon 59910 59912 . - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_8 AUGUSTUS CDS 59910 60497 0.84 - 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_8 AUGUSTUS start_codon 60495 60497 . - 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MLHRQNRRYATPKNLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMH # NPVIDWKELCLTFQDRNFRISAALASEIVQPGAEGGTEELGRGVNGKEIHEGTLQPPPEAPQQPPEALQQPLEASLKAPRTRVKLEEVKDEEYKASVK # SMPWASIPPLGTPKIHSLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 Scaffold_8 AUGUSTUS gene 71277 71651 1 + . g398 Scaffold_8 AUGUSTUS transcript 71277 71651 1 + . g398.t1 Scaffold_8 AUGUSTUS start_codon 71277 71279 . + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_8 AUGUSTUS CDS 71277 71651 1 + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_8 AUGUSTUS stop_codon 71649 71651 . + 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MLLLKVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSAS # DASFATAQSIPTTGSEDTVVTPSEIAVPVPKTVEQPLLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 Scaffold_8 AUGUSTUS gene 72584 74023 0.95 - . g399 Scaffold_8 AUGUSTUS transcript 72584 74023 0.95 - . g399.t1 Scaffold_8 AUGUSTUS stop_codon 72584 72586 . - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_8 AUGUSTUS CDS 72584 74023 0.95 - 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_8 AUGUSTUS start_codon 74021 74023 . - 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDPM # TGENDTMGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 Scaffold_8 AUGUSTUS gene 74053 74601 0.53 - . g400 Scaffold_8 AUGUSTUS transcript 74053 74601 0.53 - . g400.t1 Scaffold_8 AUGUSTUS stop_codon 74053 74055 . - 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_8 AUGUSTUS CDS 74053 74601 0.53 - 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_8 AUGUSTUS start_codon 74599 74601 . - 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 Scaffold_8 AUGUSTUS gene 74685 75449 0.91 - . g401 Scaffold_8 AUGUSTUS transcript 74685 75449 0.91 - . g401.t1 Scaffold_8 AUGUSTUS stop_codon 74685 74687 . - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_8 AUGUSTUS CDS 74685 75449 0.91 - 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_8 AUGUSTUS start_codon 75447 75449 . - 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 Scaffold_8 AUGUSTUS gene 79664 80207 0.91 - . g402 Scaffold_8 AUGUSTUS transcript 79664 80207 0.91 - . g402.t1 Scaffold_8 AUGUSTUS stop_codon 79664 79666 . - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_8 AUGUSTUS CDS 79664 79978 0.93 - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_8 AUGUSTUS CDS 80085 80207 0.91 - 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_8 AUGUSTUS start_codon 80205 80207 . - 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MNDILIFTDNIEEHRVIIRKVLDILEANKLYLKPEKCTFDRDVFDQLKNRIIEDVTLIIPRETGKLWVEADSSDYANG # AVLSQNINGKWRPVAFRSRSLNEVEQNYEIYDKEMTAIMDSLADWRQNLLRSSQTTRTSSTSGNLRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 Scaffold_8 AUGUSTUS gene 82669 83043 0.39 + . g403 Scaffold_8 AUGUSTUS transcript 82669 83043 0.39 + . g403.t1 Scaffold_8 AUGUSTUS start_codon 82669 82671 . + 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_8 AUGUSTUS CDS 82669 83043 0.39 + 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_8 AUGUSTUS stop_codon 83041 83043 . + 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MSSAQDIRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDCKKKIT # STITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWCHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 Scaffold_8 AUGUSTUS gene 84430 85353 1 + . g404 Scaffold_8 AUGUSTUS transcript 84430 85353 1 + . g404.t1 Scaffold_8 AUGUSTUS start_codon 84430 84432 . + 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_8 AUGUSTUS CDS 84430 85353 1 + 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_8 AUGUSTUS stop_codon 85351 85353 . + 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MIDSGATGLFLHQKFVNKHHIYIRSLPRPIELYNIDGTANLAGRITHSARLLARVDQNQPQILEFLVTNIGSEDVILG # LPWLRKVNPDINWRDEQIQIPAKPKVQHHVAIEEIPEPKEPNVGGNTEQILEPNRAESNGLPHTVPRTELGPETAETGTSLEDELVFEESGSPLYRLT # GNRKRRRAWLRAGFIQEVTEELWCAAGYTYSQQLAEAANKDKPQKTFEEMVPGAISASCESIFPRKNPNDYLNQTLDHAIDLKPDAPETLCTKIYPMS # VNEQKELDRFLEDNSGKDISDHPNHHFPHLSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 Scaffold_8 AUGUSTUS gene 85499 86431 0.65 + . g405 Scaffold_8 AUGUSTUS transcript 85499 86431 0.65 + . g405.t1 Scaffold_8 AUGUSTUS start_codon 85499 85501 . + 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_8 AUGUSTUS CDS 85499 86431 0.65 + 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_8 AUGUSTUS stop_codon 86429 86431 . + 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MGYNNVRIKEGHEWKAAFSTNRDSLNHCHVLRPHQLPATFQALMNSILLTLSRQESSCVSGRYPHLFASLQEHRKIVH # EVLERLAKNDLYLRPEKCEFEQTSIEYLGLIISEGEIRMDPVKVEAVKNWPAPTCLRDVRGFLGFANFYKRFIDGFAKKARALNDLTKKGVGWSWGTN # EQVAFEALKEAFTTAPILVLWDPDKPTRIEVDASGFATGGALLRQQGDGLWHPVAFRSASMDPAERNYEIYDREMLAIIEALKDWRHFLEGLPNPFEI # VTDHRNLEYWRTAQDLSRQQARWALWLSRFDFYSYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 Scaffold_8 AUGUSTUS gene 89115 89543 0.99 - . g406 Scaffold_8 AUGUSTUS transcript 89115 89543 0.99 - . g406.t1 Scaffold_8 AUGUSTUS stop_codon 89115 89117 . - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_8 AUGUSTUS CDS 89115 89543 0.99 - 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_8 AUGUSTUS start_codon 89541 89543 . - 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MTTQAEEQPVRYEPNTPEWVAQRLQMDKLPMAIGILRAWMPESRVREALEETVLAIQNLNHATATEAVTNLKSHKRFV # RGTQGRELKLRTTIENINNSVQIETEALLDSGATGSCINKDFVEQHQLTVTTRQEAGGERSRYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 Scaffold_8 AUGUSTUS gene 90966 91559 0.87 - . g407 Scaffold_8 AUGUSTUS transcript 90966 91559 0.87 - . g407.t1 Scaffold_8 AUGUSTUS stop_codon 90966 90968 . - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_8 AUGUSTUS CDS 90966 91559 0.87 - 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_8 AUGUSTUS start_codon 91557 91559 . - 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MIKLSVEQQQQLNFKEWHHTLFAYICDPTNRIATYSERIDIAVLYMRGPKVSSWVQNYMGNNFNDDKEEWKVTWKGFK # DALNASFLDKGLTENAQEKLEYLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYIIRLIEMNVKLKLIDQVYGTSNEQIEKFDELKQKIISIDDMWLSA # TGSSNRCHQVSHSRKPQIAER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 Scaffold_8 AUGUSTUS gene 92490 94015 0.6 + . g408 Scaffold_8 AUGUSTUS transcript 92490 94015 0.6 + . g408.t1 Scaffold_8 AUGUSTUS start_codon 92490 92492 . + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_8 AUGUSTUS CDS 92490 93100 0.61 + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_8 AUGUSTUS CDS 93211 94015 0.96 + 1 transcript_id "g408.t1"; gene_id "g408"; Scaffold_8 AUGUSTUS stop_codon 94013 94015 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPLRLTNRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIR # AVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDS # KRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGK # K] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 Scaffold_8 AUGUSTUS gene 94045 94685 0.59 + . g409 Scaffold_8 AUGUSTUS transcript 94045 94685 0.59 + . g409.t1 Scaffold_8 AUGUSTUS start_codon 94045 94047 . + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_8 AUGUSTUS CDS 94045 94388 0.76 + 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_8 AUGUSTUS CDS 94454 94685 0.59 + 1 transcript_id "g409.t1"; gene_id "g409"; Scaffold_8 AUGUSTUS stop_codon 94683 94685 . + 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPR # TKTNNYVSTLSEERN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 Scaffold_8 AUGUSTUS gene 94753 96367 0.43 + . g410 Scaffold_8 AUGUSTUS transcript 94753 96367 0.43 + . g410.t1 Scaffold_8 AUGUSTUS start_codon 94753 94755 . + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_8 AUGUSTUS CDS 94753 95464 0.92 + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_8 AUGUSTUS CDS 95539 95779 0.51 + 2 transcript_id "g410.t1"; gene_id "g410"; Scaffold_8 AUGUSTUS CDS 95872 96367 0.88 + 1 transcript_id "g410.t1"; gene_id "g410"; Scaffold_8 AUGUSTUS stop_codon 96365 96367 . + 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKD # EEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDS # EITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEE # IIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRG # TESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPV # TRRLTYKGNVTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 Scaffold_8 AUGUSTUS gene 96543 97229 0.63 + . g411 Scaffold_8 AUGUSTUS transcript 96543 97229 0.63 + . g411.t1 Scaffold_8 AUGUSTUS start_codon 96543 96545 . + 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_8 AUGUSTUS CDS 96543 97229 0.63 + 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_8 AUGUSTUS stop_codon 97227 97229 . + 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 Scaffold_8 AUGUSTUS gene 97343 99512 0.48 + . g412 Scaffold_8 AUGUSTUS transcript 97343 99512 0.48 + . g412.t1 Scaffold_8 AUGUSTUS start_codon 97343 97345 . + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_8 AUGUSTUS CDS 97343 98273 0.93 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_8 AUGUSTUS CDS 98399 98592 0.48 + 2 transcript_id "g412.t1"; gene_id "g412"; Scaffold_8 AUGUSTUS CDS 98694 99512 0.99 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_8 AUGUSTUS stop_codon 99510 99512 . + 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASFIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKTQHVKSSVGIYESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLG # HKGTDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWL # EEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTR # DELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 Scaffold_8 AUGUSTUS gene 99551 99808 0.93 + . g413 Scaffold_8 AUGUSTUS transcript 99551 99808 0.93 + . g413.t1 Scaffold_8 AUGUSTUS start_codon 99551 99553 . + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_8 AUGUSTUS CDS 99551 99808 0.93 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_8 AUGUSTUS stop_codon 99806 99808 . + 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 Scaffold_8 AUGUSTUS gene 102567 102917 0.96 - . g414 Scaffold_8 AUGUSTUS transcript 102567 102917 0.96 - . g414.t1 Scaffold_8 AUGUSTUS stop_codon 102567 102569 . - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_8 AUGUSTUS CDS 102567 102917 0.96 - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_8 AUGUSTUS start_codon 102915 102917 . - 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTVHVDENGHLVESSPPPDSATEAFEGLNEVEKGSADEGTS # SQVGGSVPMELDLPMIESLAEQTLSPEKGAEPAQTLES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 Scaffold_8 AUGUSTUS gene 108486 109295 1 + . g415 Scaffold_8 AUGUSTUS transcript 108486 109295 1 + . g415.t1 Scaffold_8 AUGUSTUS start_codon 108486 108488 . + 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_8 AUGUSTUS CDS 108486 109295 1 + 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_8 AUGUSTUS stop_codon 109293 109295 . + 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MSLSFHPETDGSSERSNKTINQAIRFYVERNQMGWVNALPKIRFDIMNSVHASTGMSMFELRYSRSPRVLPPLLGDFD # VGHFDPSESSNDAKEFLQRIALTVREARDNLTLAKVVQAFQADKSRGPCELFEEGDLVMLSTYHRREVFKKSGEKRAAKFFARFDGPYEVIKAFPETS # HYTLDMPNQPGAFPSFYVDQLKRYVPNDASLFPGRERIVPEPTIVDGHEEFFIERILDSRRRGRGWQFLVRWIGQGPSRIVGFPIHPYMTAAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 Scaffold_8 AUGUSTUS gene 115398 116015 0.49 - . g416 Scaffold_8 AUGUSTUS transcript 115398 116015 0.49 - . g416.t1 Scaffold_8 AUGUSTUS stop_codon 115398 115400 . - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_8 AUGUSTUS CDS 115398 116015 0.49 - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_8 AUGUSTUS start_codon 116013 116015 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MIQTGLITSAHSDLLTCLAYDYYGANIASCGLDQKIVVTAVNAEQSPTVKYEWRAHSAPITCVAWAHPEFGEVLASAG # MDRTVRIWERGEEKAVLLDARAGVRQVEFAPQAFGLKVATVAADGWVRVYECLDLGKLDVWALADAVEVAREEQQQGAAGGKEVEGGWGVSWCKERYW # GQVVAAVAGASDVVKVLSPLSPLFNSHFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 Scaffold_8 AUGUSTUS gene 117742 119055 0.39 + . g417 Scaffold_8 AUGUSTUS transcript 117742 119055 0.39 + . g417.t1 Scaffold_8 AUGUSTUS start_codon 117742 117744 . + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_8 AUGUSTUS CDS 117742 119055 0.39 + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_8 AUGUSTUS stop_codon 119053 119055 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MHASTYPTSPLPSPSPTHPNTHSSLSNSKVPSPTPTSLPSPTSILRTLLSLSLSPTIYHYTEMARWWAWQGHESKVWI # VLDRLESEGGGVALERGGVGGGVGESKGGSVGGGVEGKSVGGGQGRGTGTIHKDHQVLQAITSEDNQITKTIKTMKTVSRLPLLPLSLQTALTSLPSP # SPSPAPPPPPLPLSPASSPSPSSPSNPNHTPLPPPDLPFYIALMRAFLSSPNYSSASPSPPSSPTPSPSLSSSPSSLSSSSPLSSSFTPSPPPLQTSH # PTPPPPPTPAPSAASPPSPASGHTWSCVSGARIFWSSSGSVLGSVLGSGVGWWGWGYSGCSGVGSGSVTRGVGSGTGIGTGTGRRSGGSGSPRVVDDD # TVDDDHGDRDRDDDAPPPPPPPPPPHPPHPNPYLSKAVSNWRALAGVPSPRISPGISPREPIHKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 Scaffold_8 AUGUSTUS gene 123411 124320 0.86 - . g418 Scaffold_8 AUGUSTUS transcript 123411 124320 0.86 - . g418.t1 Scaffold_8 AUGUSTUS stop_codon 123411 123413 . - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_8 AUGUSTUS CDS 123411 124087 0.86 - 2 transcript_id "g418.t1"; gene_id "g418"; Scaffold_8 AUGUSTUS CDS 124149 124320 0.86 - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_8 AUGUSTUS start_codon 124318 124320 . - 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MYEHEWTLVRAEYISDAKYTVTSSAPPPIQTPSSKTTSSSTSQKPFPTGNKERTAAPYLSARLETSKASLACLEVRLS # AGTRTFKGNAEAATRSTAALHTMHSNGNSLPNLPLPKENLRESLTSPPLIFHDFADSIITCQAPPDTSAEHVGLYKQIITPYNANTFEHELKTYNLLD # QHPLLVNILRNSAPLGEMPQLTKSIIIPNHASVAKFPQVVKDYLADEKLKGQMSGPFLQKEIKSIMHGPIVSSLLIVAKQVQAPGIPTKFRVCQHLSK # EGKDTEGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 Scaffold_8 AUGUSTUS gene 124726 125151 0.49 - . g419 Scaffold_8 AUGUSTUS transcript 124726 125151 0.49 - . g419.t1 Scaffold_8 AUGUSTUS stop_codon 124726 124728 . - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_8 AUGUSTUS CDS 124726 125151 0.49 - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_8 AUGUSTUS start_codon 125149 125151 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MHRTDEISALFKKMDIGLKLKLNFKIDKENRKRREKSLKFQLGNCTDDTSDIASFVTIDPISLENIRKDQTIFERLKE # FLTMETLDFFRQRNEEEEGDRMRDREEETEEGARKKQKLGKIFSTTNCWSMYDNLRHSPFQHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 Scaffold_8 AUGUSTUS gene 130037 130582 0.94 + . g420 Scaffold_8 AUGUSTUS transcript 130037 130582 0.94 + . g420.t1 Scaffold_8 AUGUSTUS start_codon 130037 130039 . + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_8 AUGUSTUS CDS 130037 130582 0.94 + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_8 AUGUSTUS stop_codon 130580 130582 . + 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MSKDALTSRSNLLGVIAALRALSGETEAGGGALAKGVKGVEIVLGKKQVGGWIRAGMPAGAKVTLKGSAMYDLIATLT # EFVLPRLREFHGIPMPAAVSSHTSYLPASSNAVKASDVAGVVSFGLPAPAMGFWPQIEVNQDAYPKMYGMHIHFITNAVGVGAQERARALVSGFQIPF # VRKSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 Scaffold_8 AUGUSTUS gene 135564 136055 0.67 - . g421 Scaffold_8 AUGUSTUS transcript 135564 136055 0.67 - . g421.t1 Scaffold_8 AUGUSTUS stop_codon 135564 135566 . - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_8 AUGUSTUS CDS 135564 135982 0.97 - 2 transcript_id "g421.t1"; gene_id "g421"; Scaffold_8 AUGUSTUS CDS 136034 136055 0.68 - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_8 AUGUSTUS start_codon 136053 136055 . - 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MRFLSVIDFVDPQERIKELSQLIASLPITNYSLLRALTAHLILIVQNSAVNKMTMRNVGIVFSPTLGIPAGVFSLMLG # EFNRVFNVDAGRSPSESNEDLELEPDRRNSLHSEAAADKLLGLSGRSLSSKRCVSYPRTCPITYATTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 Scaffold_8 AUGUSTUS gene 138222 138668 0.39 - . g422 Scaffold_8 AUGUSTUS transcript 138222 138668 0.39 - . g422.t1 Scaffold_8 AUGUSTUS stop_codon 138222 138224 . - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_8 AUGUSTUS CDS 138222 138668 0.39 - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_8 AUGUSTUS start_codon 138666 138668 . - 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MGESPAPSPRVEMFNKTSSSHSSVPVSPVRGKDRFWTWKRNDDNDDGDEEDDESGEDLDEEYEVVDPSSAAPNSAPAP # SPSASAESSQDRLPNQSGSSSTSFSGPLSQAPARSSSNRQYVSINDFPFLHPQCRLTMLRPEQKPHISAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 Scaffold_8 AUGUSTUS gene 148357 149176 0.33 - . g423 Scaffold_8 AUGUSTUS transcript 148357 149176 0.33 - . g423.t1 Scaffold_8 AUGUSTUS stop_codon 148357 148359 . - 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_8 AUGUSTUS CDS 148357 148919 0.53 - 2 transcript_id "g423.t1"; gene_id "g423"; Scaffold_8 AUGUSTUS CDS 148975 149176 0.33 - 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_8 AUGUSTUS start_codon 149174 149176 . - 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MDNSHVALVAVKLVQNGFKKYRCDRPMPLGVNVGSLTKVLKCAKDDDVCTLRAADEADVLNLVYEAKNSDRISSYDLK # LMDIDAETLGIPKTSYEARIVLSSAEFTRIVRDLSLLGDSVRIEVSKEGVRFASDGEAANGNVLLKGQGPIGKVERGPQGDDSDEDEDGEGVKKEKKN # GGEEEDEEANGEEDEEGEKKKKTKVKKEKTDDGDVEMDEDDDDGEEEKEDEEDEEEEDGDGKKRKKKARFRLSYTLKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 Scaffold_8 AUGUSTUS gene 151081 151791 0.92 - . g424 Scaffold_8 AUGUSTUS transcript 151081 151791 0.92 - . g424.t1 Scaffold_8 AUGUSTUS stop_codon 151081 151083 . - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_8 AUGUSTUS CDS 151081 151791 0.92 - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_8 AUGUSTUS start_codon 151789 151791 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MTLGPSAEITPPEFSSASQSEEPIAHSMTIDLDDVLDASFMAASEPTAVSNTDEEYPAGSSVAVSNSDADPSTGQYIK # SLNRWDVISVGALRKTGVLTDSTVGRGSDSGPDYTAYSNVMKSSPLSTMLWHNRNGASKHQRSLGYILSPELGPVRDGDRTPTHGSQKHNGSPPFNTK # SRKELRRERKLKRKGYGPVNNHKHTHLHHQHSHHPNSKTRSTSSFQRSNSFNSPVPSLSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 Scaffold_8 AUGUSTUS gene 151947 153911 0.97 - . g425 Scaffold_8 AUGUSTUS transcript 151947 153911 0.97 - . g425.t1 Scaffold_8 AUGUSTUS stop_codon 151947 151949 . - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_8 AUGUSTUS CDS 151947 153911 0.97 - 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_8 AUGUSTUS start_codon 153909 153911 . - 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MSPPHPHTVTIVAEDDDDNDICPVCDGQCTCSNNTPSFYQQAPPTTRIPSPAHDPPRPILKIKLPPNLLKRKLPPTSK # TASGSSSLPSYSAHDSSIQAQRIPKRRGRPPKNLVSHSGPGVAGPSTSAYQRPKAKSVASQNRSLQKKTSKSAARDSDLRKRAIKKRKRVDSSHESSS # SELTDLDLYTSNNNYHRSVEDHDDARSVQFPTFVSALSSDSSASSSDSDSLSGFETDSSIEAEEENFILTEERARVRRELLNGSGEESLQKRRDPNWV # IRPRQMSVDAPSDVDMDEDSEATEDDDDDDDEDEKEDDDEPDGEDTEDMNTRRHGYVGLVSAWSEEEESSFDADLFFANLSDKESGSSGSCTQSDDGE # DGDYSDPELDLGQTASSLIPHLRQGVGIGIPNLAFELTEGWDGQVVFTNGHIESSSRDGLQSLLEASFLPPGPDTSPSPGPDGDVDMFSTDADGEADE # EGYEQDVDQDTAEAEYEGDTTDEELVGEDDLPNELAMSLFNTPFAFSNAPSINPMSMISPSSSFRRQSDFGVESPHPSDILSQSMTWGTNDLEERFEG # DEPDEEEENAFICEQRNKDRAARGGLPRTGFFEAVEEARQIVIDGERKEIPSSYPRFTGRKGKGVKSKSLSISRGGRSGGVSVLIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 Scaffold_8 AUGUSTUS gene 157321 159220 0.23 - . g426 Scaffold_8 AUGUSTUS transcript 157321 159220 0.23 - . g426.t1 Scaffold_8 AUGUSTUS stop_codon 157321 157323 . - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_8 AUGUSTUS CDS 157321 157589 0.41 - 2 transcript_id "g426.t1"; gene_id "g426"; Scaffold_8 AUGUSTUS CDS 157706 157970 0.44 - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_8 AUGUSTUS CDS 158063 159220 0.57 - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_8 AUGUSTUS start_codon 159218 159220 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MGLPDVDEDVVAREWRSVMRGAEDVLTGFMKSEGDEAKKKLQDIVGKTIGLLITQMHTSDFIKSTIDLMTFDVCWFVI # EMLLRAGFGLSSSKLLSDACKILVQYLLEVDPGLRDVMTLIRDQSSEKREEFNDSISIVQREAELWVCLIHVLRPGAPDGPSCEHPLWDIIKKELGRR # SSAAAKWTLQSNEVIWQTIAGVCALSQFSEHGLCKDKPSISEGWKIVFFALKSVQLKADSAIDQQLNSAPLRMKDRYFALIVRRCFFLVNRWKWAIES # SFPVLNIFSGAFGTRKFRNLLHEKADFPEFLRTQRWGSCFEYSRRDSAFVLFVKLVVQRGIALKQSERPSPHSLEKNLTLITPLSSVEMFSKVHPPQG # NELSMLYNRMAAIADGLHTKLDVCYPDDDIRKLPLEQTEVNAWYIEIVEVLIKEYKELSGKEEKSLNRVRFLLNAVLGSLRHILNAYNDPEMEAQYPD # LSLFAVIRTFLSLRDKVVSPPERPPIEPLLDNGVESNDNQESQEYGEVDIDMNDPALDELLGGNAISNASNRLHQDIEVKDRVVGKVSFAEFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 Scaffold_8 AUGUSTUS gene 159889 161239 0.31 - . g427 Scaffold_8 AUGUSTUS transcript 159889 161239 0.31 - . g427.t1 Scaffold_8 AUGUSTUS stop_codon 159889 159891 . - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_8 AUGUSTUS CDS 159889 160203 0.8 - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_8 AUGUSTUS CDS 160341 160489 0.44 - 2 transcript_id "g427.t1"; gene_id "g427"; Scaffold_8 AUGUSTUS CDS 160630 161239 0.52 - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_8 AUGUSTUS start_codon 161237 161239 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MAFFNDWKSDSSSHSNPPRVDQFDYDDNVGSGPGSASPLPHLLNSPPPSMISRPRSRSRFTSQTTVNSGHVDDSDNDS # SSDSGDAKENRQLKTLGRLYPRFMLPAFGVNTRARLSSQPGEQGNQRQASLRISSDDEEDSDNLRPGLARVRVRRGNIRPIKGDTESEDDGTEMAPAT # FKSSFFPSSPRSPSPFNSRGQRNILRRQDSSSDETDVDDEEIAEFLQRSANPGRSAVKPSRKTVRNELLIDYMLARNTSLLKAFDSNKSSAGTGGYRL # DVVRPGHGGGRQSLLSFNDHRKAQEASRSRAADVDGYSQSDRRDDEDEDDDDDDESQDESLRMESDEERSRKKGNKISLGNRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 Scaffold_8 AUGUSTUS gene 161869 162969 0.81 - . g428 Scaffold_8 AUGUSTUS transcript 161869 162969 0.81 - . g428.t1 Scaffold_8 AUGUSTUS stop_codon 161869 161871 . - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_8 AUGUSTUS CDS 161869 162591 0.99 - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_8 AUGUSTUS CDS 162949 162969 0.81 - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_8 AUGUSTUS start_codon 162967 162969 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MESKRGEISHVYENASKGSAQSPRPSQSNDSPGPARVRDSAPDPLFSDFESQSPVTDFTEPLSVLFEPMADSGVETPL # SFPPSEDEKGNDDRRENEDIVAGVAGDDLEMSQDPLNLLDHDRELNLSPLPPSSAPRILPSPQHSTVEDAGDLLHFHDGPEISPVPAHSPSPPPFDRA # PSPLSPPTFPPSTHSPLFSPPPRPQSTDGDAELARVLHDDDAVGTNKRNLRKRGNTNDVHIHSIKYCTCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 Scaffold_8 AUGUSTUS gene 179514 179942 0.89 + . g429 Scaffold_8 AUGUSTUS transcript 179514 179942 0.89 + . g429.t1 Scaffold_8 AUGUSTUS start_codon 179514 179516 . + 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_8 AUGUSTUS CDS 179514 179942 0.89 + 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_8 AUGUSTUS stop_codon 179940 179942 . + 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MTSIHPIQTSIRLARPNEYPAAIRVLTRAFAQDPAFNWYGGVKQAVPHYESNSADAVKTMRNLRYFQEAVLKMTVISG # GYVVVVVVPNGTKGIQQPGLEEKEMIIGVTLWLKPGQSLDLGILDMIRSGGLKALWGGDSWVSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 Scaffold_8 AUGUSTUS gene 198730 199350 0.43 - . g430 Scaffold_8 AUGUSTUS transcript 198730 199350 0.43 - . g430.t1 Scaffold_8 AUGUSTUS stop_codon 198730 198732 . - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_8 AUGUSTUS CDS 198730 199350 0.43 - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_8 AUGUSTUS start_codon 199348 199350 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MSEPSQLSSAVPTTTIETQSNQKSKPKSKAKPKKKKGRKRSSSNAQWADKIMYAELLEMSDSDVAASTMYLDNNGFDG # LPPNLHTSWVALSPVPIGKRCLAITRDGPGRNPVPRNKNARNSRNQENNTSLRSRLHGKHISLFPDTSASIDPNSDKSDSWFFPSPLPPSTILDCILD # VNWTQNGVLHVLDVLRWKGQEVGECEAGMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 Scaffold_8 AUGUSTUS gene 202874 203947 0.7 - . g431 Scaffold_8 AUGUSTUS transcript 202874 203947 0.7 - . g431.t1 Scaffold_8 AUGUSTUS stop_codon 202874 202876 . - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_8 AUGUSTUS CDS 202874 203947 0.7 - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_8 AUGUSTUS start_codon 203945 203947 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MRLQTENRRQSVQITPLDLSRANLNSLSLSPPSKRTSFTPLTGSFNGRPANAHRRISSVSDSGLQALTNLNFGLALSP # EHNTQVLTFPGENSNPTPSPMSNRRMSGFFAAHSSGISPSMDVFSSHNSAEIQALRKEISTLKSDLEETRHELTEAVEAREASETCVSALRTFIEENN # VGSGPRLNGSDNASIKLPHPPASSADNEADASSIKSGWGFKLWNTKATPTLNNLHSPASASVDSPTLPSAAMQTPTQITKKIGGFFSRQASISSVTAV # APSASVTAPSLQARESMYSYESKSSSRSDTSSIAEPLSPADDEDDSMNIMVREGSSRSMPQDPLDLVAVDLRESGKKSLEVNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 Scaffold_8 AUGUSTUS gene 204006 204500 0.97 - . g432 Scaffold_8 AUGUSTUS transcript 204006 204500 0.97 - . g432.t1 Scaffold_8 AUGUSTUS stop_codon 204006 204008 . - 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_8 AUGUSTUS CDS 204006 204500 0.97 - 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_8 AUGUSTUS start_codon 204498 204500 . - 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MDTLTSPQPSLQFEVPPSADSSTSFAPIRPVSASHKRPFSIDLSLELERQLDMESLPPTPAHNATVHANSAPVIAHLR # DSLDPDVLAHIISQLRRSLSDLSKEKDDLVSLLSSAHSREAELEDALQHMTDKATHMEEELMEVRQKNKDDEEAISMLRTKVEESR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 Scaffold_8 AUGUSTUS gene 207479 208530 0.31 + . g433 Scaffold_8 AUGUSTUS transcript 207479 208530 0.31 + . g433.t1 Scaffold_8 AUGUSTUS start_codon 207479 207481 . + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_8 AUGUSTUS CDS 207479 207765 0.79 + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_8 AUGUSTUS CDS 207911 208045 0.31 + 1 transcript_id "g433.t1"; gene_id "g433"; Scaffold_8 AUGUSTUS CDS 208230 208530 0.84 + 1 transcript_id "g433.t1"; gene_id "g433"; Scaffold_8 AUGUSTUS stop_codon 208528 208530 . + 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MRKQSIPTVNCRRFVLASTQELHEKIHELSNRVRELEDGLRSDHIQLTNEPHPLLSEELLKIKAPLQREPPAARSLNG # AIKDEESNPDVVDAFGSFDILMLGLNNASLLKQNETSEDDTPDPSQTILQLQAYLPPQILARAYNPVSEDMFNYEVWSQFYEPNAGLSADYPLVSHRL # SVMFMILAIGSLVDTSLSPYNVDAEKYHQLAKAALFQDSFLDAPTINAVQALVGHFFALIYPSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 Scaffold_8 AUGUSTUS gene 210189 210545 0.53 + . g434 Scaffold_8 AUGUSTUS transcript 210189 210545 0.53 + . g434.t1 Scaffold_8 AUGUSTUS start_codon 210189 210191 . + 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_8 AUGUSTUS CDS 210189 210545 0.53 + 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_8 AUGUSTUS stop_codon 210543 210545 . + 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MYGLTSLPTNGYHSESSNYQPMTSSSHSMMPTPDSSFHHHRQHSSQGSVANDSAGLPSFPPYFPVYDYGSSNSNSYAP # MLDSPIPAHAQRRSSSGSPEQNLMHTVWQDFVTSNGYVPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 Scaffold_8 AUGUSTUS gene 210944 212119 0.83 - . g435 Scaffold_8 AUGUSTUS transcript 210944 212119 0.83 - . g435.t1 Scaffold_8 AUGUSTUS stop_codon 210944 210946 . - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_8 AUGUSTUS CDS 210944 212119 0.83 - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_8 AUGUSTUS start_codon 212117 212119 . - 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MQPALPSLEDFYNTIKLSPALHSLKIRHYIRIPSDVQHLPVISLPVLRLLDLNMDIQIISSILRFLVFPPTTQTSFIA # RPTQHDDYIQGVKSLMIHVRRHLRHKDAPVLRSANIVCGNYLAFSFSQNDTCPNPLFVSDSEKPLHHILLYPASQRQNRQMIVKIINALPLQKLVVLN # AIQVTCDNIEPDTESSQQQFSQETWRTLVRLLPVGITIRIGVNNAMLALLSGAIDAMKRAPDTFPSGRRLKRLHRQQGVGSLPLSNLVLLASHNIPFR # LHGTVDTPDQERLYNGLLDHLVKYRDLNTQLKPKGQPLEALSFEDLRLPFARQFAERLYEVTGKLSYDDILWDPVKIRQEVRHSRKKMRRLRRTYPEL # GFSESDPDLSSLSSDSEIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 Scaffold_8 AUGUSTUS gene 218566 219357 0.45 + . g436 Scaffold_8 AUGUSTUS transcript 218566 219357 0.45 + . g436.t1 Scaffold_8 AUGUSTUS start_codon 218566 218568 . + 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_8 AUGUSTUS CDS 218566 219357 0.45 + 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_8 AUGUSTUS stop_codon 219355 219357 . + 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MLTSSSRPPLDKVSPLKMEGNSSIPQHCGEYCGKQGDTFFQTAISRVWSRRFPLLPRDEDARYYNRPGKELDHKLALL # GAQRVLDLHLGDAQDADGPETQYKVWEAQIWKVFGVDTVEVSEKEPDPITLEHVKVASNFLRGTIAEGISDVCTGGLAPSDPPLTKYHGIWQQDDRDV # REEHQAQGLDLAYNFMVRTRMPGGSCTPVQWLKLDRLSDEYGNGTMKITTRQTLQFHGILKRFLKKSIQDINRALLDTLEVGGDVNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 Scaffold_8 AUGUSTUS gene 225086 225487 0.27 + . g437 Scaffold_8 AUGUSTUS transcript 225086 225487 0.27 + . g437.t1 Scaffold_8 AUGUSTUS start_codon 225086 225088 . + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_8 AUGUSTUS CDS 225086 225487 0.27 + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_8 AUGUSTUS stop_codon 225485 225487 . + 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MGVVSSSAHRRVVASLEKANQAVYFPPDRVFSAATSLPKPTSKPDPAIYLFACEKLGAPPATCVAVEDSKSGATSAVR # AGIPVIAYVGSYETPEKRNEMAKSLKDIGAAAVMYDWAEFENCLEQAGCNVSDAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 Scaffold_8 AUGUSTUS gene 227274 228308 0.38 - . g438 Scaffold_8 AUGUSTUS transcript 227274 228308 0.38 - . g438.t1 Scaffold_8 AUGUSTUS stop_codon 227274 227276 . - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_8 AUGUSTUS CDS 227274 228308 0.38 - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_8 AUGUSTUS start_codon 228306 228308 . - 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MHKHRDDVAGVPFLFLTPTRRPISRPSSRASTPSARLPSGRSETPNSAPSSPLAQIFRRPLLTSPLASGVQATSYMSA # RSDYSASPSSSPILPYAHATHFHAQFTASLPASPLSSPRLLNAKASEFKPIPRPLSAASSNPGPVRSESPDLWAHSPFRATSNLAIAAPLLPDQPGLS # RSTTPVRSPLRQDTGDEDEDDPFDPFGPNGDHPPSFQVSDFDINQWEPDYNVHPPLNPYAFEFTPPFLPPEGSEDTLGMSGMLNDMTIEPDTDPDAAA # ALLTNFDVLTSVFGSTLAPLNSKRRWPRMHMISTALWPGSLTVLSLCSSSSSSRQTDLHPNNVCSLLVGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 Scaffold_8 AUGUSTUS gene 229293 229613 0.58 - . g439 Scaffold_8 AUGUSTUS transcript 229293 229613 0.58 - . g439.t1 Scaffold_8 AUGUSTUS stop_codon 229293 229295 . - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_8 AUGUSTUS CDS 229293 229613 0.58 - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_8 AUGUSTUS start_codon 229611 229613 . - 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MKKNKRWEESISLSKQDKLYKDAMITAATSATHEVAEELLGYFVDIGNKECFAAMLYVCFDLLSQDVVEELSWQHGLN # DFYMPYKIQNSRTLVEKASFTLSVDVQD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 Scaffold_8 AUGUSTUS gene 230759 231382 0.61 - . g440 Scaffold_8 AUGUSTUS transcript 230759 231382 0.61 - . g440.t1 Scaffold_8 AUGUSTUS stop_codon 230759 230761 . - 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_8 AUGUSTUS CDS 230759 231382 0.61 - 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_8 AUGUSTUS start_codon 231380 231382 . - 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MEIAKIATEHGLFEEALTIYKKYDQHAMAMTVLVEHIVSLDRGVEYANKVNQPEVWSRLAKAQLDGLRIKESIDSYIK # AEDPSNFIEVIEIADRAGKHDDLVRYLQMARKSLREPKIDTELAFAYARTDRLHDMEDFLSMTNVADILEVGERCFEVELYQAAKLLFQSISNWARLA # TTLIYLGENQAAVESARKAGNTQYVASVSVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 Scaffold_8 AUGUSTUS gene 232865 234574 0.22 - . g441 Scaffold_8 AUGUSTUS transcript 232865 234574 0.22 - . g441.t1 Scaffold_8 AUGUSTUS stop_codon 232865 232867 . - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_8 AUGUSTUS CDS 232865 233601 0.79 - 2 transcript_id "g441.t1"; gene_id "g441"; Scaffold_8 AUGUSTUS CDS 233687 234185 0.67 - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_8 AUGUSTUS CDS 234284 234574 0.38 - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_8 AUGUSTUS start_codon 234572 234574 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MVTESSVYHWSNNGSNFPPQKIFDRHATLAGTQIINYRVSSDEKWLVLIGISGNSTNPSAFKVKGSMQLYSRDRGVSQ # PIEGHAAAFAEVKLDGNQHLHVVQIDHAAPDPPFVKKAVDVYFPAEATNDFPVSMQVSKKHGIVYLVTKYGFIHLYDLESGACVYMNRISGETIFVTA # EHEATNGIIGVNKKGQVLSVNVDDQTIVPYVLTTLNNTELAFKLASRANLPGADDLYIKQYQSLFQSGQYGEAAKIAANSPRVGIILSPTPPGGLSPI # LQYFGILLEKGELNHLESLELARPVLQQGRKQLLEKWLKENKLTCSEELGDVVRLHDMTLALSVYLRANVPNKVIACFAETGQIEKIVLYAKKVGYSP # DYVALLQHVMRVNPEKGAEFASQLVNDEMGPLVDVERVVDIFMSQNMIQPATSFLLDALKDNKPEQGPLQTRLLEMNLMHAPQVADAILGNEMFTHYD # RPRIANLCEKAGLMQRVSIMSLTTILHFYHHMTGPRAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 Scaffold_8 AUGUSTUS gene 236457 237559 0.61 - . g442 Scaffold_8 AUGUSTUS transcript 236457 237559 0.61 - . g442.t1 Scaffold_8 AUGUSTUS stop_codon 236457 236459 . - 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_8 AUGUSTUS CDS 236457 237081 1 - 1 transcript_id "g442.t1"; gene_id "g442"; Scaffold_8 AUGUSTUS CDS 237129 237559 0.61 - 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_8 AUGUSTUS start_codon 237557 237559 . - 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MGFRSGARNIPQPPGMDRAGATTGAIHEGSTGSMTLRFAKMELDLMGSGSPWPQDLPPLPRGPGSGFSNSQSFSRPTS # AHPPSSSPRHSHTQSQPQTHSSFANVKISNHSAPRGKAERTIPDYDLDEPPPRPASVSFRWVSRFFPAGSTASSTSGALERFKRNTQQPAQPQPQHAS # YPRLNDRPESIGHSIAYAGVKIESPSPLGGKEKMADVRKMENDSKSTSHSQPIPAIRFENNDRRSQPNQSEVPRITFGDDENESSGIQITGQGTSTPR # NIIGNDSDDSDDDNSNASPFGPLIRVSAENEGQQSTPNPPQIMFEVPGMGVDSQFGGPIIHVSDESDQDTHEEEVKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 Scaffold_8 AUGUSTUS gene 237589 238161 0.62 - . g443 Scaffold_8 AUGUSTUS transcript 237589 238161 0.62 - . g443.t1 Scaffold_8 AUGUSTUS stop_codon 237589 237591 . - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_8 AUGUSTUS CDS 237589 238161 0.62 - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_8 AUGUSTUS start_codon 238159 238161 . - 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MTNSHSYNSPHPSHTHAPQTSTSQSRVATSSLQTAPQSNSTFSSIPSAAVRQQNPIFETKFPSTRSGFNATSGSETKF # VPLWKRDKPINNIGGSSRETERGRSTTVPPTSPGRPLPQPTPNRFPAPYTVEEPDDAAANTSLESETTSSEVSGVSAASGISGNSQRSGASSGPGILD # LRGSIPQPPVWIVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 Scaffold_8 AUGUSTUS gene 238198 238779 0.29 - . g444 Scaffold_8 AUGUSTUS transcript 238198 238779 0.29 - . g444.t1 Scaffold_8 AUGUSTUS stop_codon 238198 238200 . - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_8 AUGUSTUS CDS 238198 238779 0.29 - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_8 AUGUSTUS start_codon 238777 238779 . - 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MGYPQTSANYAHVPSMHTNRVGGMPPQHARSSSASPTRKPLPSPSPASPIESTRPLTITQSSGFAPLSPNHPHSRDLS # AFSRFNQERMASGAISPGTVRNVGPVKAFPNSYAPQQSQYQYKDPVTTMSSVSSFSAPPSQQMPSLQASNPVTINTPTRRRVSPPRFFGNSSISSSRN # HSPEKANIVGFRYHLIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 Scaffold_8 AUGUSTUS gene 241299 241956 0.28 + . g445 Scaffold_8 AUGUSTUS transcript 241299 241956 0.28 + . g445.t1 Scaffold_8 AUGUSTUS start_codon 241299 241301 . + 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_8 AUGUSTUS CDS 241299 241631 0.31 + 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_8 AUGUSTUS CDS 241687 241956 0.92 + 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_8 AUGUSTUS stop_codon 241954 241956 . + 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MLWVDRQGSSCPPIGCTSPSISTQQVVFSLIGNLQGLTGTRYSFNATINASTSISKFWFEINENDGSDPIVVDNGGSG # FVIEQDSVFIDNSRSENVLLSSSFNEYRKVVVAVRGDTSSSVSITTFDPNSDASAPPYLLTVITTNLQLDDSNPSEGGFTFFTVNISETVNFVSISGN # IGGVSYVQENFDMTVVNFAFVTIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 Scaffold_8 AUGUSTUS gene 244661 245337 0.44 - . g446 Scaffold_8 AUGUSTUS transcript 244661 245337 0.44 - . g446.t1 Scaffold_8 AUGUSTUS stop_codon 244661 244663 . - 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_8 AUGUSTUS CDS 244661 244939 1 - 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_8 AUGUSTUS CDS 245053 245337 0.44 - 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_8 AUGUSTUS start_codon 245335 245337 . - 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MLWADRQGSFCPSTGCTTPAIDNIQVFFTFIGNMQGLTADRYVFNATINPATSISKFWFEINENDGSDPIIVDNGGSG # FVIEQDSVFVDDRRSENIRGDASSSVSITTFDPNSDATTPPYLPTITTTNLQLDDSNPAEGGFTFFTANISGSVNFLNISGNVGGVSYTQENYDMTVV # GFPVVTVVQSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 Scaffold_8 AUGUSTUS gene 248738 251797 0.91 + . g447 Scaffold_8 AUGUSTUS transcript 248738 251797 0.91 + . g447.t1 Scaffold_8 AUGUSTUS start_codon 248738 248740 . + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_8 AUGUSTUS CDS 248738 251797 0.91 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_8 AUGUSTUS stop_codon 251795 251797 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MSLSTVARIAYLASETLVDSQPPLPLNSEFASSFNSVSLSSRRRPNVIAVPHGGDPAAALLRATGSALTSFTALSNSQ # TIARLVLRLPELASSPLVLHIALLNDLSDVLLLRSVVPYFLVSTNAQQAHDNALLATKLARSQKKAVVHAFFSTKDDSDTTTELSEENLLTLLFDEKG # LVNGSNGRTNGVNGHSNGTNGHSNGVNGHAHGTNGYDSPEVVEDDRVALQLFKDYEVAALSVLKAVRRPILPLTSTGSSEPTTIIFTLGQVTFDAYVE # GVSFVNVFLLSPLLPSRILGVIPPTVTSVIVLEQVQNWSLKWTPLYLEVVSALQQRNPVVRPAVHSGVLGDSPPVREGDILKLLSKASNPTSHSRLQL # GSSSADKVASQGPHIPKHELSYTKILTHLFRERLEISNSPDLIPVQGDLATSPEFALGRVRGQIDERAKLLVAVRDLLQSGNVDGELHSLLSKWVLAK # DDGIKSRSLGEEITEKLELVNTSVEVQRVLALKSHFPSVSRWIIGSDAWSYDLGSSGLHHAVASGLNINILILDTLPYSQRNSADPTRRKQDVGLYAM # NHGDVYVASVAIYSSYAQVLQALIEADKFDGPSVIVAYLPYENEDAPALNILKETKLAVDAGYWPLYRWDPSKELNGGEPFTLDSDAVKNDLQAFLDR # QNHLSQLVRSKPQLATELVGSLGETVKEIRKKKALQSYNDLLTNLDAPPLTILYASDGGNAEKVAKRLSNRAQARGLSTTLATMDTMSLDSLQQEEFV # AFISSTAGQGEPPQNGRQLLKAINAAAVREQVLLPKLRFSVFGMGDSHYWPRPEDAHYYNKPGKDLDARLEKLGGTRVAVLGLGDDQDADGYQTGYKT # WEPQLWKALGVDSIEITEAEPEPITNEHIKAASNFLRGTILEGLEDNSTGSLAPSDGQLTKFHGIYQQDDRDIRDERLAQGVEPAFAFMIRIRMPGGV # CTPEQWLTMDQIADEHGSGTFKITTRQTFQFHGVIKRHLKSAIQDINRVLLDTLAACGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 Scaffold_8 AUGUSTUS gene 251884 252880 0.26 + . g448 Scaffold_8 AUGUSTUS transcript 251884 252880 0.26 + . g448.t1 Scaffold_8 AUGUSTUS start_codon 251884 251886 . + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_8 AUGUSTUS CDS 251884 252257 0.3 + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_8 AUGUSTUS CDS 252415 252880 0.85 + 1 transcript_id "g448.t1"; gene_id "g448"; Scaffold_8 AUGUSTUS stop_codon 252878 252880 . + 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MSKLHAQVHQFAVTVSQHLVPRTTAYHEIWLDKKMVAGEALKDFEPLYGEFYLPRKFKVAIAVPPTNDVDVFANDLGF # IAIVDDNGELAGFNVTIGGGMGVTHGNKKTYPRTGDLIGFCTPEQGNVSKNARVKYTIDRMGLDVFKAEVEKRLGYQLQPARPFTFDRNVDDYGWSTG # EDGRHHFTMFIENGRIQDETGKEFKSGLREIAKIHKGAFRLTTNQHLLISDIPTENLPQIKAILSKYKMDNLSHSGLRLSSSACVAFPTCGECRAWKL # LDSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 Scaffold_8 AUGUSTUS gene 260057 260458 0.37 + . g449 Scaffold_8 AUGUSTUS transcript 260057 260458 0.37 + . g449.t1 Scaffold_8 AUGUSTUS start_codon 260057 260059 . + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_8 AUGUSTUS CDS 260057 260458 0.37 + 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_8 AUGUSTUS stop_codon 260456 260458 . + 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MTQDALEAKREQLEELEKSEHEARRLEAALGGRSAVSLPSSPDQEPTEEESNIQTHSASYVPPHPGPNPARRNARAPG # MGFLNALSYTLHGMMDVDPETARRNGISKTKETISQVIFRFLFETNKISIHSIDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 Scaffold_8 AUGUSTUS gene 262032 262454 0.99 + . g450 Scaffold_8 AUGUSTUS transcript 262032 262454 0.99 + . g450.t1 Scaffold_8 AUGUSTUS start_codon 262032 262034 . + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_8 AUGUSTUS CDS 262032 262454 0.99 + 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_8 AUGUSTUS stop_codon 262452 262454 . + 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MGLSVLSRFARDLSVPSANEGFHCMVSLKPVDTKVEYLDSDIVTILDRVRSSEAVMQSRPKPMRISWAERRRQSRGGP # TRDIKTQSSYLSRAWQQGTVFPTQNTSSSIQPATEVDGDIGVQAGHTHGEGSPLLKDLLGVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 Scaffold_8 AUGUSTUS gene 268871 269513 0.46 + . g451 Scaffold_8 AUGUSTUS transcript 268871 269513 0.46 + . g451.t1 Scaffold_8 AUGUSTUS start_codon 268871 268873 . + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_8 AUGUSTUS CDS 268871 269137 0.46 + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_8 AUGUSTUS CDS 269211 269513 0.95 + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_8 AUGUSTUS stop_codon 269511 269513 . + 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MFKYGLYEVFKDTYMNAAGPDISEKYKGAIWLAGSASAEVFADIALCPLEMTKVKIQTSPTGTFPIPFATALSEMNKL # KVETRFPFGSLIPYTMAKFFFFEKIAQLFYTHVFTNPKETYSKTTQLGITFASGYIAGVVCAIVSHPADSLVSLLGKAENKGKSVGTIAGEVGFATLA # TKGLSTRVVMIGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 Scaffold_8 AUGUSTUS gene 275777 276776 0.8 - . g452 Scaffold_8 AUGUSTUS transcript 275777 276776 0.8 - . g452.t1 Scaffold_8 AUGUSTUS stop_codon 275777 275779 . - 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_8 AUGUSTUS CDS 275777 276655 0.96 - 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_8 AUGUSTUS CDS 276744 276776 0.81 - 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_8 AUGUSTUS start_codon 276774 276776 . - 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MKEAQSPKLTNTQSELSRCLQELTRVKVSHFTEEALRAQDEAYLASLPKPKPIPAIPVPLAPEKPKSKQVKLSKEEEI # LREKWQRLVEMVSKGRLEPLIAFWEREGNNLGGINVRLPEWIGEKRVATLLQLATFSGQEDVTNWMLEMCADPTIPVPRSEDEADSVEGEESASKRRR # TAYDLAQSRSIRDVFRRNAGAHPDWWDWFGAAHIPSALSKEMEDGREEKKKVRRKGLKDRLKEREAKEKEKPTAEESTPFISIPSIGPHKLGGSAGDT # AGTAGLTLEMKAKIERERRARAAEARLKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 Scaffold_8 AUGUSTUS gene 277036 277554 0.66 - . g453 Scaffold_8 AUGUSTUS transcript 277036 277554 0.66 - . g453.t1 Scaffold_8 AUGUSTUS stop_codon 277036 277038 . - 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_8 AUGUSTUS CDS 277036 277554 0.66 - 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_8 AUGUSTUS start_codon 277552 277554 . - 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MEELNVSLALEDSLSGSESSDEEIDSDSGHDAVSTLVDKQKPRKRSISPELSTRRGPRTAISWFHSSPSTQIGVYRVL # FPYDIPEDDHLQALKDLQEAKSGGRSWAMFMVAGGHFAGAIVRVSNAGKESEVQSKKTKKPVSDMEVLRHKTFHRYTSQSIEARSFISCSLTII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 Scaffold_8 AUGUSTUS gene 280710 282204 0.23 - . g454 Scaffold_8 AUGUSTUS transcript 280710 282204 0.23 - . g454.t1 Scaffold_8 AUGUSTUS stop_codon 280710 280712 . - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_8 AUGUSTUS CDS 280710 281028 0.86 - 1 transcript_id "g454.t1"; gene_id "g454"; Scaffold_8 AUGUSTUS CDS 281105 281243 0.76 - 2 transcript_id "g454.t1"; gene_id "g454"; Scaffold_8 AUGUSTUS CDS 281294 281500 0.46 - 2 transcript_id "g454.t1"; gene_id "g454"; Scaffold_8 AUGUSTUS CDS 281556 282204 0.29 - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_8 AUGUSTUS start_codon 282202 282204 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MLEKWRDFVEEVDPDLIIGYNIAGFDFPYLIDRAKELGSQRFPYLGRLKGETLFMFSSEGVLAHKPADVQTRVKDTHF # SSKAYGQRDSKETPLDGRLQLDVLQFMQREHKLRSYTLNSVCSHFLGEQKEDVHHSVITELQNGTPESRRRLAVYCLKDAYLPQRLLDKLMCFVNYIE # MARVTGVPFNYLLARGQSIKVLSQLFRKANDEGYVIPAMKGSEDQYEGATVIEPHKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLDKPTIERLELV # KDRDYIQTPNNDFFVATSKRKGLLPTILEDLIAARKRAKADLKKEIDPFKRAVLDGRHANSVYGFTGATIGKLPCLAISSSVTAYGRQMIERTKQVRL # KFERQHRFMPLQEVEAEYSTANGHSHDAQVIYGDTDSVMVRFGPTDLKTVMALGESLAHYGSASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 Scaffold_8 AUGUSTUS gene 286472 287927 0.53 + . g455 Scaffold_8 AUGUSTUS transcript 286472 287927 0.53 + . g455.t1 Scaffold_8 AUGUSTUS start_codon 286472 286474 . + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_8 AUGUSTUS CDS 286472 287088 0.75 + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_8 AUGUSTUS CDS 287141 287487 0.85 + 1 transcript_id "g455.t1"; gene_id "g455"; Scaffold_8 AUGUSTUS CDS 287545 287927 0.74 + 2 transcript_id "g455.t1"; gene_id "g455"; Scaffold_8 AUGUSTUS stop_codon 287925 287927 . + 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MARSADKSQPLYDDSDPDTEPETFKPQRNGTRKRLSEAYNPDNDASFASDSGVRAQKSSVDINDDAAEKRRRRKSTKI # VVPENAHAGPSSEVNDEVDKSRTIKQKQQLTTVAPLAPPEKESIDILSSKFEEWMKLTTDNVSSHHALCNLTRLIFAPRKSRLPILGNLPSSTTFTRC # LYCETRTTILLISSVPLVPSMVVSKSGLAVGTMDEDEEAGSDDPDREQTKQKKKRASRRENNLSDASQLRNKKPDLEFSVDPLFRKTCADFDEGGAQG # LLMNHLSLGVGQDGSLRVVFDASDSISKEDEDDLHEPEDLIDLTQLRAEFIPDLDGLQSKAISQELSDFSFTQNPLMNDDTTFFQDDTIADGFDDDDD # DGFEAMMVDGAPPVEDFFVGDDAVGDDYGAGMMDGEDLGMPSNGSVGPWITGKVAQASSFPSIPVMPRTREILCLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 Scaffold_8 AUGUSTUS gene 293593 294255 0.72 + . g456 Scaffold_8 AUGUSTUS transcript 293593 294255 0.72 + . g456.t1 Scaffold_8 AUGUSTUS start_codon 293593 293595 . + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_8 AUGUSTUS CDS 293593 294255 0.72 + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_8 AUGUSTUS stop_codon 294253 294255 . + 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MKAVSKNSHTVVAHFSRRAQLRISIRKFPNLNSSTCSHNLDPFSAVVVLNSAQLIQGPSSPLVIFTLFVMSSLAGALI # PPEMSSLSSQAPSDHLYDNVDVDMKPALEHIDPTANEEDEEMTDLFGGDGEVENATRGEYVRTLLTEVPLNFCSRHTSLGDTTDGSEGLGSAEAEQRR # ALEYEEDEVPPEIAIEEREANVAFPNLPVPSNSDQDVKRISSLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 Scaffold_8 AUGUSTUS gene 294575 295399 0.75 + . g457 Scaffold_8 AUGUSTUS transcript 294575 295399 0.75 + . g457.t1 Scaffold_8 AUGUSTUS start_codon 294575 294577 . + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_8 AUGUSTUS CDS 294575 295399 0.75 + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_8 AUGUSTUS stop_codon 295397 295399 . + 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MSLRLGKELFDITKDIDTSGAIPRKSFGGSQSQSQLQPPPSTPGKSHGLTYLVAQHKRSQVLQSEAVITGYMSLRPTG # MQSETHRMLVRAVGQKHNKVARLRLVEDPAIDPEKEKAELMKTVKKTTKRRSNAVDSLGGRTSRKSYGRRHETSDMEQSDEDEEGGGMSTRRRKSRDE # DDSGGHYQRDGFVVEDESEEDGDFDAGRKRRRDEEEDPLDQLEAKIQRQQNKRRHESDDSDAVEGHVEVESEEEEEQKVRRAGATRRRQALYDDDEDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 Scaffold_8 AUGUSTUS gene 301003 301593 0.22 + . g458 Scaffold_8 AUGUSTUS transcript 301003 301593 0.22 + . g458.t1 Scaffold_8 AUGUSTUS start_codon 301003 301005 . + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_8 AUGUSTUS CDS 301003 301593 0.22 + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_8 AUGUSTUS stop_codon 301591 301593 . + 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MHGFHVRIVLNTRVQSPFDISIPNTIFDKLPVHRPNPTNRKNATFNPYQKDYRFGPIRIDWMDSNMPASTSSTGKEKD # RGKDGTSDEQSYTTSSTDMYRLLGHAVAHFVANETVSGSTNLPEGVIHVYRENETPTGQTSTSRPVTDSVILGILAVPSWMAPSDLLTFVAPAAETIS # HLRILRFVIFIYQSTSNLHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 Scaffold_8 AUGUSTUS gene 302207 303070 0.14 + . g459 Scaffold_8 AUGUSTUS transcript 302207 303070 0.14 + . g459.t1 Scaffold_8 AUGUSTUS start_codon 302207 302209 . + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_8 AUGUSTUS CDS 302207 302222 0.43 + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_8 AUGUSTUS CDS 302314 302445 0.29 + 2 transcript_id "g459.t1"; gene_id "g459"; Scaffold_8 AUGUSTUS CDS 302550 303070 0.48 + 2 transcript_id "g459.t1"; gene_id "g459"; Scaffold_8 AUGUSTUS stop_codon 303068 303070 . + 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MLVAGGDGYVHRLIRNKADGKVVELPSAATAMSSSPREGGLGPSAADALNPGRGIEGVSGTVDESIRERTDCVDGSGE # GTTTVDEERIIELLKAKAKAENRAEKMAELARRLEKDLREERAVTEGLMSNLGKMKEKAEAVDKDREEFRSKISELEDQLRDVMFFLEAKTQIETGGG # VVSEAAGDRLKCLHQDRTKRKKTRNDDVGELINVLRYNVQHEQYKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 Scaffold_8 AUGUSTUS gene 305827 306533 0.49 + . g460 Scaffold_8 AUGUSTUS transcript 305827 306533 0.49 + . g460.t1 Scaffold_8 AUGUSTUS start_codon 305827 305829 . + 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_8 AUGUSTUS CDS 305827 305832 0.49 + 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_8 AUGUSTUS CDS 306045 306533 0.98 + 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_8 AUGUSTUS stop_codon 306531 306533 . + 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MCDDSSPSLHRQPSFKWAQFKPTKSPTKPEHVESPHPSPQQLDHDIPPYTRSTPPSQIASTSASTPAPSDKPKPQQNI # TDSPNLTQGAPPKPARQDSTDNLKSFKVSLEDPTWKVLPAALKKYRIHNDNWENYAMFICYGSPGVLWSLWHDAVLDMQHDFRQPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 Scaffold_8 AUGUSTUS gene 308920 310943 0.65 + . g461 Scaffold_8 AUGUSTUS transcript 308920 310943 0.65 + . g461.t1 Scaffold_8 AUGUSTUS start_codon 308920 308922 . + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_8 AUGUSTUS CDS 308920 310213 0.7 + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_8 AUGUSTUS CDS 310303 310336 0.83 + 2 transcript_id "g461.t1"; gene_id "g461"; Scaffold_8 AUGUSTUS CDS 310463 310943 0.9 + 1 transcript_id "g461.t1"; gene_id "g461"; Scaffold_8 AUGUSTUS stop_codon 310941 310943 . + 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MAVNNTVATKIPPYPSPSARKDLSPTQIANLNRTILACIGDVLSLPSTKRNTPAAHNFVSTYARDAAVQTLEALIWGN # GAVSSKVEYAIRSRVLQLAEKLDKLDVQTLLDLVIVYAKTNLNRLRAVLELNSHSLATSELVSSFVLLLHFDNSPGLYALRKASHCISSLLHIAPSAT # LRAFAHSKAFVLALATIYHTGMNTVAQSYGGLNLTRSDEPDADDWEKLWLETKVSFMDSFHACMVCLLNGLASASGPNLAAEAEATFDIVFALFESNS # SAEQSQIPFLNRSILADYQQSYDLMRTLSSSLQRAVERDARLELLEASLRELETQSGPAEVGMKNPGALRLLLRSSGVPPGIDNRGIGSGWSKGNGKG # RENKNGVSISTSAASVASTSQSISKNDIDVKISQVLDIFPDKNPLYIRDLLSHPSYPFAMAAAQNWIPLHHEDVQLLFRDRETVETDEGRYTQTGRGI # LVFGRRRRRQVRSTDDDPLAPTVANKIKIVGDGEDSDSSDSEGSHNYYSDQPAKLSPETILELAYIENAKLFDRDSATRGSKARKDLKEKTGWEDEQI # EGWRIMLDRDVRSLSSLQSIVTDHLRSRGRKNGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 Scaffold_8 AUGUSTUS gene 315498 319370 0.39 + . g462 Scaffold_8 AUGUSTUS transcript 315498 319370 0.39 + . g462.t1 Scaffold_8 AUGUSTUS start_codon 315498 315500 . + 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_8 AUGUSTUS CDS 315498 316277 0.56 + 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_8 AUGUSTUS CDS 316378 316625 0.75 + 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_8 AUGUSTUS CDS 316682 319370 0.94 + 1 transcript_id "g462.t1"; gene_id "g462"; Scaffold_8 AUGUSTUS stop_codon 319368 319370 . + 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MDDPWANAWDESHSKNTTSSVPTKSIFSTSTWRDPAESETDIALPSWSVGPAVTWNEPSDDAPTLWGSSTSNDSPELP # ITSSFSPKGVDWKSSYESMSAHFGGSSVDENSETEEVGDAEESNEGEGMHDQMDINVDEYEAVAAKGEAPGIVDPWTPPQSTFPTSTSLSSVLEITAS # NSPPAPRSPDAFEFGTFESGASDSLAGPSTEGKTWDSGSLSNPESEWGTAWVSKEADPNDVEDVEALDEWERAKREKEKMDRVVEISDDLWPPPVQAK # PNDVNSVPTTDTTQEPLKDTRDDDPLDRDSPNLGSVVQVEDESNSLNDESQPEETLAHWKGGIDAVEGLLDLCQTIIPPLPPLSSLPALPSQTKSSPI # IKRSSEALRLTRSTVISSSGPLGMYLKTKGSIEWEVAVKARPEKTSEQEREEIVPAGWRILPKEKEDEKKVEAPEMKRKGSSILSSFFGRKAEASPTE # SKEKKDKEASPRPSFASSRNSMDSKSGTANAESPSTDKLPTSPASAPVPSTSAVGASTSTTPTPSTYGDGGSPDLFHDAPTTAPAPSAVSRFLNRFSS # SRNRPSHSRQNSNTSLALSTDDLEFLQDIVPSASDVDHEHELVQTGSNELELNGLQKMINSAPLPAPLLPPPRAPGRDPQRSQSQLSSPQSPSDDFIT # GRKAPSDASRQNKNFDFASSSSQILTPSPALPSQIQTAITRSSTPSSFALPLSTRSSSPGLDMLSIAGSSVGGRASQLTSPSTGMNALGGSAISRPSS # SSAMPNIRTTSSSSSTTMKRPTPVAIMSQSSGSSSKTPESADPFSFLPPPPSIRGGGKATSSPTLLIDDELPRASSSVSGVSSIPAALNIPSTSVTSA # NLPQNPDDDDFSDFLSATPTDVVQPPFSASNLFSLSSAQPLFSAGSAEFNGRDSEGPSDAFSARYDNPLNTSVSSIASTNSVNNMLLSSREMDSFGDS # FDAFNDFASSSSPVQRDTLRTPSPPALPDKSPGKLAARRAFGAEPTSAGVSRRASTGKKTMGGSGVGGRIPPGRLNLPAPVSSSAYSRHWGSPAHEPS # PSFLSGNAVNSASPLVASSSEPALAVTPASSPSPKNHKKKVSKEAHQRTRSLVEDAMARSGIWPSPAPSAASSTSGYGSGYGAYGFGTAPPLSPLPPI # LSPPPEYSSSSKNKGGGDLLGAHEDDDDDVPLASLAPGSTYGSIPNSNIGSSTFATQQTQAKAGLIPPMSSMSSSPIQYQWP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 Scaffold_8 AUGUSTUS gene 322358 322654 0.99 + . g463 Scaffold_8 AUGUSTUS transcript 322358 322654 0.99 + . g463.t1 Scaffold_8 AUGUSTUS start_codon 322358 322360 . + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_8 AUGUSTUS CDS 322358 322654 0.99 + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_8 AUGUSTUS stop_codon 322652 322654 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MSATNDTNRTTTNGHRINSPIPPPIPKSSYKIASIPGDGIGPEVIAAAVEILQALTKKLSTFELEFTEFDWGTERFLK # TGRYTPEDYLEVLREFDAIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 Scaffold_8 AUGUSTUS gene 326081 327037 0.8 - . g464 Scaffold_8 AUGUSTUS transcript 326081 327037 0.8 - . g464.t1 Scaffold_8 AUGUSTUS stop_codon 326081 326083 . - 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_8 AUGUSTUS CDS 326081 327037 0.8 - 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_8 AUGUSTUS start_codon 327035 327037 . - 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MAAFGFAATICIAVAVDRLLYHRNRRPAASVTLSDTSIDWVLSRCSQLEQQLTEKESHYQELRLVAAASQAKYLQLER # QWLADERRYERQCTELESENARLQENIRSHDTSAKTLVVFQRKTEEERAERVHPLFLSFLDRLLLANKIWQQQKELQRMRGALAEKKAEKNNSCEHAF # ATFRDRLIAANMVWRQQREMKKLKEERNMMKEEADRVKQGRVRAVARSAKQMVVDTRKEGMVDELVNDLVADLKREREKHEREVEEMNVMWQEERQKL # LSEIEMLRLGQQARLIEQEISNELEDRLAASLKECQKEVHRLGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 Scaffold_8 AUGUSTUS gene 336735 338497 0.39 + . g465 Scaffold_8 AUGUSTUS transcript 336735 338497 0.39 + . g465.t1 Scaffold_8 AUGUSTUS start_codon 336735 336737 . + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_8 AUGUSTUS CDS 336735 336751 0.65 + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_8 AUGUSTUS CDS 336845 337336 0.58 + 1 transcript_id "g465.t1"; gene_id "g465"; Scaffold_8 AUGUSTUS CDS 338020 338497 0.62 + 1 transcript_id "g465.t1"; gene_id "g465"; Scaffold_8 AUGUSTUS stop_codon 338495 338497 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MDDLDIILRLKTDDCFQIISAQQLPLPKDKSGKEIQSIVDPFVEVSVHIPLWTHSPFVADEAEAEGATYSPPSNITTS # QTTSQNPQNSQKNSQPTTARSISFSTGSVKNNGFNPVWQEELCIPFDCVGGMTDLIFVKFAVKQERKKLKDEADEEPIAVYCSSLGSLERGLLSAILS # FTLYSIRCSFAILHNVTYDNLDPSVTYLPQGGDGWDVDIKEGLDYEGSHAVASGDPDASAVFQFTGDYSFQASARKSLIRDTTSLQRIGVAVYYFSPL # WPYNVSTVVSLDGGNNITVNLMDMSATPASVGSPLQHLLQQDLDSLDCPIVHIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 Scaffold_8 AUGUSTUS gene 338619 339209 0.99 + . g466 Scaffold_8 AUGUSTUS transcript 338619 339209 0.99 + . g466.t1 Scaffold_8 AUGUSTUS start_codon 338619 338621 . + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_8 AUGUSTUS CDS 338619 339209 0.99 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_8 AUGUSTUS stop_codon 339207 339209 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MYSVTIDDGVQEVQSSGSSGKNVAAIAGGVVGGIVGLAASIAVFFIYHRRVTRLRAGGNPWEEKGVLEENSTPVYGRS # GEAPYTDFGPPTHRDASKYSAGSAVALTHQSMYSQSEAGYTTVSAAAPGVTWAASTDSGSSSQGSGSTPSGSVAGKDSTYFSEKRLQRLTVANEEPPA # PPPYAARSDDQGELENDVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 Scaffold_8 AUGUSTUS gene 339574 340359 1 - . g467 Scaffold_8 AUGUSTUS transcript 339574 340359 1 - . g467.t1 Scaffold_8 AUGUSTUS stop_codon 339574 339576 . - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_8 AUGUSTUS CDS 339574 340359 1 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_8 AUGUSTUS start_codon 340357 340359 . - 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MPVKSTGEYATDAIAIAGRDDLSFAPARWIWTGELNDGRAPPGARAFRLTVNLPPKHTLASATILVTADDYYSFYVNG # RFVGSGIQYMAAQRFEVDDIQGPRIVFAVYAENKVAPEGWNPAGLISAIRVTSRDPTLSCLQGCSITHDWFTDAGWKAYPGDAPPYGFELPVFDDSNW # AYAAVRERLPGRFSIPAIGEMDESGSPLPGAPRGFHPKRLFFDINPSRPARQAIVWTHTTARITNQSSPIIPPTLILSPTGPKQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 Scaffold_8 AUGUSTUS gene 346242 347147 0.94 - . g468 Scaffold_8 AUGUSTUS transcript 346242 347147 0.94 - . g468.t1 Scaffold_8 AUGUSTUS stop_codon 346242 346244 . - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_8 AUGUSTUS CDS 346242 347147 0.94 - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_8 AUGUSTUS start_codon 347145 347147 . - 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MTTSSTSSLMKTVEIHDTELPVKAPSQDVRRETDGRNEQSEDAQSLKPQATTGRGRSRSRSKPPSAQAAVTSSEEISE # KDIAATNTPLPLRRSTRKASAEPDTRTSEDEGPAPTKRTRTAVGGRTRGEESDTDSSSKGVAKKPLARTTRARGKTPVSEAETDDTNDEEVAMAKTKR # GRRPKAAIVPEVIKEEEVDELPTTRTTARSKKIVVSSDTSHPSVTPGTRGRSKKIAAPEPAIETDVNKENAQTSASEDQPVVTRTRIGRPRKAPTLKI # KEEVTTEPETALRTGSRTRAMRTRSKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 Scaffold_8 AUGUSTUS gene 347461 348102 0.72 - . g469 Scaffold_8 AUGUSTUS transcript 347461 348102 0.72 - . g469.t1 Scaffold_8 AUGUSTUS stop_codon 347461 347463 . - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_8 AUGUSTUS CDS 347461 348102 0.72 - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_8 AUGUSTUS start_codon 348100 348102 . - 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MSLGGGEPRRIKVEEQPWKVQDLVVPSPPSSPTRPSHGLDANREHTPRMNQLSEVERRAIQERRRSALRTPDNFFSGG # IPGMSPTKTIGPTPIRTGRLSHAANNMDDQLDTRSLLEKMKETVEGMKAERRASLSSPQKRRFGDTKIDAEEFSLLRSPAKLPVRRSPTIFENEAAVL # STPVVAPPADPGSSTSYSDGDDVQMIDVGRDAFGARL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 Scaffold_8 AUGUSTUS gene 348138 349082 0.47 - . g470 Scaffold_8 AUGUSTUS transcript 348138 349082 0.47 - . g470.t1 Scaffold_8 AUGUSTUS stop_codon 348138 348140 . - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_8 AUGUSTUS CDS 348138 349082 0.47 - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_8 AUGUSTUS start_codon 349080 349082 . - 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MDNLRVLQSPLKPYSIRSRTSSPHISAPHSRSLFPTQITSDSATEDKQDAAEEEEIILVEGNSPRVVEEAKDLVILED # VEVPPVVESTSPIPVIRRNPSKSPTKSRYIPAPPPLLLPPQPPMTPRRSRPTLHKAVLIRSAQRMVMAELHREEELEEQEEEAEVFGTVLGEDDQEDE # TENPQSENNNERVAVEKEDRKEGTSPTWKASLERIWPFRRSTSPTKTLTKDEESVSPLPEDLMDVDSEDTATIEKTGNVDVTCENAEADVKDEDETEA # TENPAPLYPRLDASLLAPPSRRLFNTLNLNVRHRRTLGLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 Scaffold_8 AUGUSTUS gene 352067 354754 0.06 - . g471 Scaffold_8 AUGUSTUS transcript 352067 354754 0.06 - . g471.t1 Scaffold_8 AUGUSTUS stop_codon 352067 352069 . - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_8 AUGUSTUS CDS 352067 352321 1 - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_8 AUGUSTUS CDS 352387 352666 0.88 - 1 transcript_id "g471.t1"; gene_id "g471"; Scaffold_8 AUGUSTUS CDS 352741 353134 0.41 - 2 transcript_id "g471.t1"; gene_id "g471"; Scaffold_8 AUGUSTUS CDS 353172 353354 0.41 - 2 transcript_id "g471.t1"; gene_id "g471"; Scaffold_8 AUGUSTUS CDS 354304 354754 0.41 - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_8 AUGUSTUS start_codon 354752 354754 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MKRELKLGRGSYPITTATTIFIKSFGVTTHPKLPLKPESPEPDEEVVAEAAADVREKAAAVVLAGVAVADVEPDTGEV # PEVEETEGLDFRTKDQGEDQICVPPQNESKYEVASCCSVVVQSRFTQYSTSAMKAELVQQDPSSLQISDRSATTARLISSSRTLGEDSPEIADLYFAY # GKSLLENAISQTSVLGKDQPEEEGAEDDKGAVSSHCSSSNGPILSFSGDAEEGAEDSAVDLFAEAAKEVAEADAAAGEEDDNDDEDAEPEDDFNAAWE # VLDLARAIYDKQHDADTSNEDVALKLADCYISTWRRVVGDRYVLNASQKIHRLTRRCQKNSIKALPIMSIVLDLTPGRLSDSIKHADQALQSIESRLG # ELKLAKEHPSSLVKDVKPDPKGKGKGKASAVAGINSDAVQNMSATQIEGELKELAELKEELALRIEELKMAPNETLAGSAPALAAQALDKELASKSSP # LVPAAVVNDLTNMVRKKKAPTTDGSSAKRKANDGEDSGSEKKLKLDAGAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 Scaffold_8 AUGUSTUS gene 355315 355881 0.35 + . g472 Scaffold_8 AUGUSTUS transcript 355315 355881 0.35 + . g472.t1 Scaffold_8 AUGUSTUS start_codon 355315 355317 . + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_8 AUGUSTUS CDS 355315 355881 0.35 + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_8 AUGUSTUS stop_codon 355879 355881 . + 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MLTSTFSQVVFKALIVLHTMIRNGATDNVLSYLSSSEVLRLQNVSAGNWEGAPRDYPKVMSFSLYLSGYAAPQNLQNY # AVYLDSRIRAYRDLKHDAIRVQAESNRDMRNSASVEEDNYARGKKKDISASGPQRSKTIMGRKLRVMTVEKGLLRETKAVHRMIDSLVECKVPLFVNH # VDDLTDGSTSST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 Scaffold_8 AUGUSTUS gene 356054 356650 0.5 + . g473 Scaffold_8 AUGUSTUS transcript 356054 356650 0.5 + . g473.t1 Scaffold_8 AUGUSTUS start_codon 356054 356056 . + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_8 AUGUSTUS CDS 356054 356650 0.5 + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_8 AUGUSTUS stop_codon 356648 356650 . + 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MSHVDAEQALALYRHFCKQTERVVEYLGVAKKLQNILNVPIPNLKHVCILPTQTFHFPSDVSSCQAPVSLAGALDEYL # SDPNFEQNRIEYKTNKEAAQRGRGTGSTSSKPGKGKLISEPRHTSYSMCLLASSPAPPLPLSTPSQATPATSPTPANTQMEPPNKAVADFFSGIEEEQ # SSLFNPQTNRYIPLWSSFNCKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 Scaffold_8 AUGUSTUS gene 356721 357425 0.18 + . g474 Scaffold_8 AUGUSTUS transcript 356721 357425 0.18 + . g474.t1 Scaffold_8 AUGUSTUS start_codon 356721 356723 . + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_8 AUGUSTUS CDS 356721 357425 0.18 + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_8 AUGUSTUS stop_codon 357423 357425 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MGMAPQFGQPQMQVQPTGVVAPPQVSFQQVPNPFGMMQQQSQPPSHLRLQPQATGHRPFSSFLPQQATGMPQQQNSFL # QPQATGANPFRQSMLLPQTTGMAMFGVGGMQQQPHLFPQQQLQPASSGTLNGAPNGLSAVNGLPSAQSSSSLGSSSFSSSFMSAGPFSQQSSPSPINV # PARPASTPLTAFGSTQSSSATSPPPAQPVKTHQTGTRNPFGPISTPPPPVPKQPSLMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 Scaffold_8 AUGUSTUS gene 357582 358232 0.79 + . g475 Scaffold_8 AUGUSTUS transcript 357582 358232 0.79 + . g475.t1 Scaffold_8 AUGUSTUS start_codon 357582 357584 . + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_8 AUGUSTUS CDS 357582 358232 0.79 + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_8 AUGUSTUS stop_codon 358230 358232 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MSSVASSFSSRKPDSTATSGQASSSSGPFNALNSQNTSTTTTGSTFSDSLFSSSLSSQPTGATNYSSPPSISFSSAAP # LRSQTTGFNGLKPFKPSSSFGASLLESLPSIPGSSPATPAVTGTPSMSPQGRNTSGSANGLPSGTFGSQPTGLGQSSTLGSTGIGSTLGQGLRPQMTG # GGANPFRASMFSTMPNGANVLSMPTGIGVWVVLEECQIRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 Scaffold_8 AUGUSTUS gene 361263 362071 0.85 - . g476 Scaffold_8 AUGUSTUS transcript 361263 362071 0.85 - . g476.t1 Scaffold_8 AUGUSTUS stop_codon 361263 361265 . - 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_8 AUGUSTUS CDS 361263 361398 0.88 - 1 transcript_id "g476.t1"; gene_id "g476"; Scaffold_8 AUGUSTUS CDS 361526 361565 0.88 - 2 transcript_id "g476.t1"; gene_id "g476"; Scaffold_8 AUGUSTUS CDS 361750 362071 0.87 - 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_8 AUGUSTUS start_codon 362069 362071 . - 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MWAAEGLAQTCWLSYADMPTGLGPDEMVMHTAGDDRWGKTVDGFKDGGGYLWMDAIEKWKASGARGAPPGVGDKTPVI # YAETERLRGSGRARDYSIRKSGYLLRPEVLEVLPAVKDDDMPSLKYLYLMFIDTDPIPLDKWVLNTEAHPLPVIEWSQAEKDNFHIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 Scaffold_8 AUGUSTUS gene 367566 368090 0.84 - . g477 Scaffold_8 AUGUSTUS transcript 367566 368090 0.84 - . g477.t1 Scaffold_8 AUGUSTUS stop_codon 367566 367568 . - 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_8 AUGUSTUS CDS 367566 368090 0.84 - 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_8 AUGUSTUS start_codon 368088 368090 . - 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MVEFSSGVRGMCLNLEADNVGVSIFGNDRLIKEGDTVKRTGQIVDVPVGPGLLGRVVDALGDPIDGKGPIEAAERRRA # SLKAPGILPRRSVNQPMMTGLKPIDAMVPIGRGQRELIIGDRQTGKTAVAIDTILNQKRWNDGKDEDKKLYCVYVLWARNVRLLLSLSRPLRRMTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 Scaffold_8 AUGUSTUS gene 371154 372325 0.47 + . g478 Scaffold_8 AUGUSTUS transcript 371154 372325 0.47 + . g478.t1 Scaffold_8 AUGUSTUS start_codon 371154 371156 . + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_8 AUGUSTUS CDS 371154 371674 0.48 + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_8 AUGUSTUS CDS 372037 372325 0.94 + 1 transcript_id "g478.t1"; gene_id "g478"; Scaffold_8 AUGUSTUS stop_codon 372323 372325 . + 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MLGNPGSNQIELFWDVVDTLDQKLDAKIAIVTNAIAKVDGPTKGDSEGKEDDDAPERSGLSITATTSEEEFLGVVKAT # LNEDVKSLSKEELHLIFGTVCASCMRLFFISQSRFQLHDAAVKKQADEKRRAERKQRHLQEDLRYALRKLTEPLDLNLSFEEVSSYWALISFLELKHD # DYDRRASKDYDRDYRSKHHEKDDRRRDRDRGRRPDYPSRDWDESQYRREEREKSVSSSTYKDRDEPSKSEKREMEELPIDDRAEKVSRLHDRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 Scaffold_8 AUGUSTUS gene 374885 375365 0.62 + . g479 Scaffold_8 AUGUSTUS transcript 374885 375365 0.62 + . g479.t1 Scaffold_8 AUGUSTUS start_codon 374885 374887 . + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_8 AUGUSTUS CDS 374885 374921 0.62 + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_8 AUGUSTUS CDS 375034 375365 0.65 + 2 transcript_id "g479.t1"; gene_id "g479"; Scaffold_8 AUGUSTUS stop_codon 375363 375365 . + 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MANNFRVRSGRSSTQASEIHPLVASDFGDPHAKNPSSSSGIRSQTLDSSFSTDSLQDGKYSDYVSAPQLQFVEGSSRS # GVGSTIVTAYPDEKKVIKSDVILGVANPETEELPPPAYSEHHEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 Scaffold_8 AUGUSTUS gene 378001 378306 0.6 + . g480 Scaffold_8 AUGUSTUS transcript 378001 378306 0.6 + . g480.t1 Scaffold_8 AUGUSTUS start_codon 378001 378003 . + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_8 AUGUSTUS CDS 378001 378306 0.6 + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_8 AUGUSTUS stop_codon 378304 378306 . + 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MNNLRLEADQAIERAEAAEAKNKKLDQLLLEKDQEITSLNHKLSVVDEQLEKAELSLQEAKRENMDNIGSKTTSEGLQ # RKIQLLEEELDAAEKNAKDTVEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 Scaffold_8 AUGUSTUS gene 382636 383736 0.79 - . g481 Scaffold_8 AUGUSTUS transcript 382636 383736 0.79 - . g481.t1 Scaffold_8 AUGUSTUS stop_codon 382636 382638 . - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_8 AUGUSTUS CDS 382636 383736 0.79 - 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_8 AUGUSTUS start_codon 383734 383736 . - 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MRSKSYGNLRASASMPSVSRPSPTTRSSTFSHSSRSNYNPLSRSFSSRTLDIHLDEVDEISEFGEMNVGHGKGSNVPP # TLRSTKKSFINGETRSIRSSSSTLSMKTSISHLTSGERTPKTSGAGNRFARPGSEASTRSSASDVAGSTSRYGVDELAILTPSSTASSLSIPLTPRDD # DDILEDTQASSLTGRSHPNIDKMLPSLPNPKTGSIRRPSAPSSIRKSSLKKPLESSSYSTHSFPSIASDTSINSTPSSSLNSISPTAMTSPRPLKQLQ # LPRQQSAMNVNGQLPVPVPSLNGGSSRLRMPSTPSLPSHSAPVTPTTPSTPTDHGKPKSRVGTGMTYRNSASRNVSRMRPPSGKSPVVAPKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 Scaffold_8 AUGUSTUS gene 384976 386916 1 - . g482 Scaffold_8 AUGUSTUS transcript 384976 386916 1 - . g482.t1 Scaffold_8 AUGUSTUS stop_codon 384976 384978 . - 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_8 AUGUSTUS CDS 384976 386916 1 - 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_8 AUGUSTUS start_codon 386914 386916 . - 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MGHSVPLLLESFPVPPSFLPPSTPRTPSSLSFNHANIGEPINEPSSSISSTSSIPPSSSVSSISSTSSNPPPSLPPRG # PLPPVPGRSRISDHEAAHLLQSRRSSKYSINSSHSGNGGYDRPDSVASFASARSNGASYAYGHGYRDLETREGRRVSKGSGRVKPPEVQVTTEDAEDT # NQAYGGLRIDEEDDSDVQLTSLRLSISPMPPSPTDTDNELEIPSSLSTQFPTPPPLSPFALQQANAMQKRIPSSAASTPIKWSAPPSPLYQPSPVPPP # VRSASPNESLAEISMHDLPSGDDGAESEWDVPTTKPPVVQAFQTRRVSGGGVPPPSSFTTSVPSRSDSRSSLRRMARISMDNLDNVSLKASIISPSVS # ISPSKSISSTYTQPDPSPSMPSPPATFPTPPTTYPTPPSSSATYNPDVEIDLHRSLHRELRSARSRSRSHRERLISGIASPSSPPADVAWPPMPPVPY # AAEFSNRPRRKTSQASTVSVADNQSTADSDDGRASPDVQRLLEKTPRPRRSLSMKRRTRSSIGTSSTKGSIGRRKSGDVGSDDGYDEFGGPSLLSRGR # KESRRRLGHNEDVEAKLQKLERELDGRGSESEGENVPRRHSYGDGFGFGTYKDGVESDGDGLDSDASDSSLDLHTPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 Scaffold_8 AUGUSTUS gene 389859 390497 0.64 - . g483 Scaffold_8 AUGUSTUS transcript 389859 390497 0.64 - . g483.t1 Scaffold_8 AUGUSTUS stop_codon 389859 389861 . - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_8 AUGUSTUS CDS 389859 390497 0.64 - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_8 AUGUSTUS start_codon 390495 390497 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MPDTALTISSSLSEAIHVRTSRSVESEAEAIVEGKKKRRAAKSSALPKLINMASFPKVTSNQGIAQNGASMSSMLLGP # LNEMETLAQTLFLSLTPGQVKPPAPRVDAFLACDQALAAAVNLSYKHQIKQRKIERLKAEILELDSRWRQICIELEMEKRELDGMIEEADERLESIEQ # AKKGITYLVPVLYCWPSHALYQHLYRTLNYWLMPKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 Scaffold_8 AUGUSTUS gene 391702 392381 0.43 + . g484 Scaffold_8 AUGUSTUS transcript 391702 392381 0.43 + . g484.t1 Scaffold_8 AUGUSTUS start_codon 391702 391704 . + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_8 AUGUSTUS CDS 391702 391945 0.57 + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_8 AUGUSTUS CDS 392008 392381 0.83 + 2 transcript_id "g484.t1"; gene_id "g484"; Scaffold_8 AUGUSTUS stop_codon 392379 392381 . + 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MSINTAQIFQPTDSITEEFALKTTQDLVKTIYTSQTADGTDSDIEGLARDACEECIAILREPEKSQAKPAIKILCAFM # STTLSRYTVAQTAPYLVKLYAHPDNVAARPSILLLLSDLIAAARDSMAANKVDDSDSLETPLSPYKDEILSIVSSALKVSSSRDPALACLLGLVSTEK # LVSDEELGFIVHSVDEILLEESDEAEETK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 Scaffold_8 AUGUSTUS gene 394891 396149 0.85 - . g485 Scaffold_8 AUGUSTUS transcript 394891 396149 0.85 - . g485.t1 Scaffold_8 AUGUSTUS stop_codon 394891 394893 . - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_8 AUGUSTUS CDS 394891 395498 0.96 - 2 transcript_id "g485.t1"; gene_id "g485"; Scaffold_8 AUGUSTUS CDS 395567 396149 0.87 - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_8 AUGUSTUS start_codon 396147 396149 . - 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MDQDASNSRFSLAHELAAALMPEPSAGSRLLAEEFGIEYDEGAEGIDEDIHHSNSDHPQLLVDSNEGPSFADELNHRD # ALDTSFADTPQHRAVRDEQDYDPVFGSPSATRHKKSKRPEQDAMEVLAQDLESTDKFLSHLRHLDNEPGSIASASQQLSLEKMAYDVIRRLDETTRDR # EGQVRELLEYEREFRKIAEEKPTPASIHPQIDNVEDEPPRRSRVQEWDADPHQLDRDGEDEDDIDYEEELTPVKDTFPPPPPILGPPTPAATISQLAH # LRSFTRSLVTSLTTISEQAQVNGAATTEAGRKIRALKNKLGTWRTDWDSAERSRLKIERWEAGISDGADTPDGDASPGYISSPRPSGHKRVDGRRIVE # EHLQAFELALADAGGKTKAIMASG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 Scaffold_8 AUGUSTUS gene 397553 397846 0.9 + . g486 Scaffold_8 AUGUSTUS transcript 397553 397846 0.9 + . g486.t1 Scaffold_8 AUGUSTUS start_codon 397553 397555 . + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_8 AUGUSTUS CDS 397553 397846 0.9 + 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_8 AUGUSTUS stop_codon 397844 397846 . + 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MSTTLALPNDVLASMEVDLSMPWEFFPPKLFKMWVVVKCEGGDVEVQNFVLPTFWHSIKVSNKVGGTTTRRVEKVYKF # ADAHIDDHSKALDLGRTGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 Scaffold_8 AUGUSTUS gene 404467 406305 0.91 - . g487 Scaffold_8 AUGUSTUS transcript 404467 406305 0.91 - . g487.t1 Scaffold_8 AUGUSTUS stop_codon 404467 404469 . - 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_8 AUGUSTUS CDS 404467 406305 0.91 - 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_8 AUGUSTUS start_codon 406303 406305 . - 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MTSPSSPTTPRRRLSSRRGSVSAQDPYAKHGEINLNPNRLSTSTLTIVKVVPSDIFSAFSNNNHGTISLKDPPGPGQR # RPHRRIGNNDSGAGPRGRPEGGAGAEGSPRMSFAFSTFGPARPGTQSDRTGARTPSPSSPSTSSRIRPSSPSGHRSSTSGYAAPKPKLTPEQLYDLAH # QATHPTHLPTMTSPLNQRWSPHFTGSPRSSPSSGISTGTTPATFTPLHPSVYLPFIDRSAEVKALIESTPTRKLFALLKQTFPRQDSLPATGHLVVAN # PDPESKSSPSDSPTRSIFSPTPGVDIPIDPTTWTYDSLIAFIVNTSRDQEPDTIWVAKIRRCILSHSELIWERVKGALGVPPELDVDFDLDMEMNADV # FESSESESESDRDLQTPGSTKTPRTEDMEDGGMKGKGYWEGWDAIMDSPNNDRGSAPASAFIKSPSTDPIPINAAAASMLHTQRSGSGDTTESPTPVQ # RESRSPARDLDLPKIMQQMPTPTTSFDESQQVKAVPIPDGEDVSSKTSASTTTTTTRHVKTNSRSSIGSPGSFSPSLSSSIPSLLSFTSATSGPNPET # GVVIEPLILSPSQNSVGSLVCIHPRLASLLCCQIRQAMELVRMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 Scaffold_8 AUGUSTUS gene 414603 414908 1 + . g488 Scaffold_8 AUGUSTUS transcript 414603 414908 1 + . g488.t1 Scaffold_8 AUGUSTUS start_codon 414603 414605 . + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_8 AUGUSTUS CDS 414603 414908 1 + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_8 AUGUSTUS stop_codon 414906 414908 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MNRSLQCYGDIQGRDAEAEEYERQYGFEDSLSDPEEEETSARLSTQQKQQSRRMKSISPAQESIRSLDIDDFEDSRPV # FNDDEDNDSENSDGGAQTCIVLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 Scaffold_8 AUGUSTUS gene 418024 419550 0.76 + . g489 Scaffold_8 AUGUSTUS transcript 418024 419550 0.76 + . g489.t1 Scaffold_8 AUGUSTUS start_codon 418024 418026 . + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_8 AUGUSTUS CDS 418024 419550 0.76 + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_8 AUGUSTUS stop_codon 419548 419550 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 Scaffold_8 AUGUSTUS gene 419580 421012 0.33 + . g490 Scaffold_8 AUGUSTUS transcript 419580 421012 0.33 + . g490.t1 Scaffold_8 AUGUSTUS start_codon 419580 419582 . + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_8 AUGUSTUS CDS 419580 420302 0.41 + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_8 AUGUSTUS CDS 420425 421012 0.47 + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_8 AUGUSTUS stop_codon 421010 421012 . + 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRISGYLLIRVAYEDHSDHPVVVANQSNGLRAVTPEINN # KDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNG # DSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEHDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 Scaffold_8 AUGUSTUS gene 421336 422639 0.83 + . g491 Scaffold_8 AUGUSTUS transcript 421336 422639 0.83 + . g491.t1 Scaffold_8 AUGUSTUS start_codon 421336 421338 . + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_8 AUGUSTUS CDS 421336 421358 0.83 + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_8 AUGUSTUS CDS 421412 422639 0.91 + 1 transcript_id "g491.t1"; gene_id "g491"; Scaffold_8 AUGUSTUS stop_codon 422637 422639 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR # IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNI # PIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQL # SRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTIFYEMKYHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 Scaffold_8 AUGUSTUS gene 422919 424439 0.93 + . g492 Scaffold_8 AUGUSTUS transcript 422919 424439 0.93 + . g492.t1 Scaffold_8 AUGUSTUS start_codon 422919 422921 . + 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_8 AUGUSTUS CDS 422919 424439 0.93 + 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_8 AUGUSTUS stop_codon 424437 424439 . + 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MAFCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVR # NYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEE # RSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYH # RNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIP # SNGCNTSSMEGIHCFGLRPGSKHENARTLGECSLTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 Scaffold_8 AUGUSTUS gene 430800 431525 0.79 + . g493 Scaffold_8 AUGUSTUS transcript 430800 431525 0.79 + . g493.t1 Scaffold_8 AUGUSTUS start_codon 430800 430802 . + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_8 AUGUSTUS CDS 430800 431525 0.79 + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_8 AUGUSTUS stop_codon 431523 431525 . + 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKNWDFKPGQLVQVRNSGIEKSLDRKMYPR # YRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 Scaffold_8 AUGUSTUS gene 431906 432681 0.2 - . g494 Scaffold_8 AUGUSTUS transcript 431906 432681 0.2 - . g494.t1 Scaffold_8 AUGUSTUS stop_codon 431906 431908 . - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_8 AUGUSTUS CDS 431906 432122 0.72 - 1 transcript_id "g494.t1"; gene_id "g494"; Scaffold_8 AUGUSTUS CDS 432181 432331 0.75 - 2 transcript_id "g494.t1"; gene_id "g494"; Scaffold_8 AUGUSTUS CDS 432413 432548 0.83 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_8 AUGUSTUS CDS 432655 432681 0.26 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_8 AUGUSTUS start_codon 432679 432681 . - 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSTKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSISILHQL # LLSRKVPNSLLLHSTFRQLNSNLTQTCILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 Scaffold_8 AUGUSTUS gene 435704 436406 0.52 - . g495 Scaffold_8 AUGUSTUS transcript 435704 436406 0.52 - . g495.t1 Scaffold_8 AUGUSTUS stop_codon 435704 435706 . - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_8 AUGUSTUS CDS 435704 436140 0.94 - 2 transcript_id "g495.t1"; gene_id "g495"; Scaffold_8 AUGUSTUS CDS 436199 436406 0.54 - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_8 AUGUSTUS start_codon 436404 436406 . - 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS # KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE # DEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 Scaffold_8 AUGUSTUS gene 445156 445518 0.43 - . g496 Scaffold_8 AUGUSTUS transcript 445156 445518 0.43 - . g496.t1 Scaffold_8 AUGUSTUS stop_codon 445156 445158 . - 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_8 AUGUSTUS CDS 445156 445518 0.43 - 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_8 AUGUSTUS start_codon 445516 445518 . - 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MAQKSKVEGLRNHINLTNDAITNAEVTKAKAEKDVDKHRHTVDTDAAALEQLETELAELDGQLKELQGFVKTVKAKVE # AAEAAEESKREALAERKAQLEEKAEAVEAFRQTEVRLQWTNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 Scaffold_8 AUGUSTUS gene 445755 446506 0.38 - . g497 Scaffold_8 AUGUSTUS transcript 445755 446506 0.38 - . g497.t1 Scaffold_8 AUGUSTUS stop_codon 445755 445757 . - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_8 AUGUSTUS CDS 445755 446423 0.98 - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_8 AUGUSTUS CDS 446474 446506 0.38 - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_8 AUGUSTUS start_codon 446504 446506 . - 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MQDTGRITGFHGRLGSLGTIPEKYDVAITTACPSLNNMVVDTVKQGQACLEYLRSNNIGRATFMVLEKISYHPSTLST # PNTPENVPRLFDLITPKDPKFAEVFYKAVGDTLVATDMDQANRIAFGERRTKVVTLAGQVIETSGAMSGGGGAPAKGGMSSKLAKDSVSPRQLQELEQ # NREEAQAKLEEAIAAVRSAEAEYEKLNRSGPEIDLRYEKLGLDIQKGNLELRKRRNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 Scaffold_8 AUGUSTUS gene 446653 447304 0.14 - . g498 Scaffold_8 AUGUSTUS transcript 446653 447304 0.14 - . g498.t1 Scaffold_8 AUGUSTUS stop_codon 446653 446655 . - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_8 AUGUSTUS CDS 446653 446970 0.4 - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_8 AUGUSTUS CDS 447044 447304 0.37 - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_8 AUGUSTUS start_codon 447302 447304 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MKSRDWLSEKRKHAAGKAKKLKKSVGDVSNSLSCFTLSSISLCTQGSHCSKYRTTYDEDSEEKLEKEKRKLDDYEESL # GVEEKILEETNPEIYDQKESLQKDLQPWTAKINAKQKEIDIARGERDALVKKVESIQTALHEAETHLEKVNSDQEEKVKLLSEAKSEKAELNDKKEAA # TERLNVRTLFFRTWSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 Scaffold_8 AUGUSTUS gene 448397 449449 0.83 - . g499 Scaffold_8 AUGUSTUS transcript 448397 449449 0.83 - . g499.t1 Scaffold_8 AUGUSTUS stop_codon 448397 448399 . - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_8 AUGUSTUS CDS 448397 449449 0.83 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_8 AUGUSTUS start_codon 449447 449449 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MPPRRSSRSRTSSGPALVESTPVKRKRSQQPVNNFEEKENLRKPPSSSRRDSSSHLGNAVSIQSKPSTRREPAEPIVE # EEEVSETDQEEDEDEVQPPRKKKRPSLEKSDEEEEGDNDTEAGRPKRTLQTAKRGRASRAPALVQPRSGRLQKPVAISSDEEEYAGKVPNPEEEDSEF # EEQNQKQKQKPKPKSRQTAKRGRPSRATQPRSARGHKLVPMSDDDGKADVQTEKGLESDVEEYEMPKRRVSMSPKKTSSRTNHRLSKEHSMDEDEGET # KPTGVDEEDEELEEEISLLIDYPPSLPPASQSQAKVVLEEPKGPQSRLVIHKLALVNFKSYAGRQEIGPFHKVRRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 Scaffold_8 AUGUSTUS gene 454910 455230 0.88 + . g500 Scaffold_8 AUGUSTUS transcript 454910 455230 0.88 + . g500.t1 Scaffold_8 AUGUSTUS start_codon 454910 454912 . + 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_8 AUGUSTUS CDS 454910 455230 0.88 + 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_8 AUGUSTUS stop_codon 455228 455230 . + 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MKGRTVILVSHHVQLCAPSANYIVALDNGRVQFEGTREAFQTSGVIHTLMQSTINETGDEKEEQAIEEIPVPSSQSSD # SDPSSETTTIAPTPATVKMDKKTCEEIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 Scaffold_8 AUGUSTUS gene 460706 462003 0.43 + . g501 Scaffold_8 AUGUSTUS transcript 460706 462003 0.43 + . g501.t1 Scaffold_8 AUGUSTUS start_codon 460706 460708 . + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_8 AUGUSTUS CDS 460706 461346 0.88 + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_8 AUGUSTUS CDS 461544 462003 0.48 + 1 transcript_id "g501.t1"; gene_id "g501"; Scaffold_8 AUGUSTUS stop_codon 462001 462003 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MSTHISDCSSQSVKPSTSVATSNSSRTSPSSEHSTSKSPQGQSQSPPKPPSTTSHHSHPHHPGTISIPPASFSLPVHN # MSPMGVPMSPYYSGMSPLHHPHAVPMTPHGLPPITPSMPPFTFLPPMPLPSPHMEVPRMSDSGHHPLMSRMSDVITPTYSYHPPNSSGQEVFHGESQS # EDVNDQSSSSSSTTEGHKASRSSFVNPYFQPPIPGHRPSSGKRWRRNGKQGWYRARGYFDNVTLGQGYFPPIQSYFGGLGANSVEGEILKDEKDKEVD # KEQELKAMEEEQSRKHSVEREQVIGGHTSYASPTSASSDESGGITDANYPDLPTSVVRKDGSASRAHSMSTDVSERPQLHRPESDPPPTTIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 Scaffold_8 AUGUSTUS gene 464851 466453 0.45 + . g502 Scaffold_8 AUGUSTUS transcript 464851 466453 0.45 + . g502.t1 Scaffold_8 AUGUSTUS start_codon 464851 464853 . + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_8 AUGUSTUS CDS 464851 465094 0.81 + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_8 AUGUSTUS CDS 465150 465489 0.49 + 2 transcript_id "g502.t1"; gene_id "g502"; Scaffold_8 AUGUSTUS CDS 465544 466453 0.84 + 1 transcript_id "g502.t1"; gene_id "g502"; Scaffold_8 AUGUSTUS stop_codon 466451 466453 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MKSTDKDEKKDEKKQENKEEEVKKEPPTPLAEIKSNFVLIDRAVSTLEPRFTHRVLRTLTTLVKRLDETIIRNAIEEA # YPKESTTKSTLVSWLPTTSEDVEMQVDSAPTSATTAKPAAPVTSEPVPEVDIYLRLLIINQLLKSTEGVSKAKELSVETVKKMQALNRRSLDSIAAKV # WFAVERAFELAGDISEARPMFLAAQRTAALRHDDDTQASLINRLLRSYLAYSLYDQADKLVSKTTFPVSAGNPQYARYHYYLGRIKTVQLNYSDAHTN # LQQAIRRAPPATVAPGFYQAVHKLFVVVELLMGDIPDRSIFRHPVLEKPLKGYFEIVKGAELSRPSASHMLTFFPFPAVRTGSLSQFQQTVLKHAALF # QADKTHTLITRLRQNVIKTGIRRLSLSYSLISLKDICVKLHLDSEEDAEYIVGKSIRDGVIDGRLVHEKGWMACGGAGGVKRGYGADVAETFSRRIGY # CLELHNQSVKVGFRVVLYRQFVADHNP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 Scaffold_8 AUGUSTUS gene 468023 469115 0.41 + . g503 Scaffold_8 AUGUSTUS transcript 468023 469115 0.41 + . g503.t1 Scaffold_8 AUGUSTUS start_codon 468023 468025 . + 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_8 AUGUSTUS CDS 468023 468167 0.41 + 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_8 AUGUSTUS CDS 468250 469115 0.96 + 2 transcript_id "g503.t1"; gene_id "g503"; Scaffold_8 AUGUSTUS stop_codon 469113 469115 . + 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MLAFSHQHKNTIQALAWSPNGNLVASASRDQTVRVFDIRAMKEYRVLKAVAWHPVHPILVSGGSEGSIIHWDLSSEES # SSSTPFIPPPTAKSKLSDLPAHLTLPPTPTALPRATLAEAHDSNVWSLAFHPLGHLLVSASNDHTTRFWSRERPGDSDAVFSAFGEKPPAAVDGADGG # WEDEDMAVPGFGGAGTAGGWDDGYEGGINDNGGTGASYSNGNLSNQNGYDSGDRGFAGGYSGSGGDDDYSIPGIGDSGFGSASGTNSIRVNGPLPPQE # EAIYGSGTGAGPGSDEWYSGGGERERSGGGDRGYDTWSRGGGARDGGGGGSRQRWGGRRTRY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 Scaffold_8 AUGUSTUS gene 474256 474615 0.73 - . g504 Scaffold_8 AUGUSTUS transcript 474256 474615 0.73 - . g504.t1 Scaffold_8 AUGUSTUS stop_codon 474256 474258 . - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_8 AUGUSTUS CDS 474256 474615 0.73 - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_8 AUGUSTUS start_codon 474613 474615 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MKEHELEIRRVQVETEVLLKEHAAAVAQHGSNSESADSSHDDTAIALPLLPPVPQALVLLPEFDEGSRNNRGLENDMT # GGLLCPGEIDWNDDTYVILLTLMDVIHRKQQYPRRCAAYGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 Scaffold_8 AUGUSTUS gene 479335 479667 0.75 + . g505 Scaffold_8 AUGUSTUS transcript 479335 479667 0.75 + . g505.t1 Scaffold_8 AUGUSTUS start_codon 479335 479337 . + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_8 AUGUSTUS CDS 479335 479667 0.75 + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_8 AUGUSTUS stop_codon 479665 479667 . + 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MYMRYFPGGGIGHTANRKFFKDMADSEDGENEPDGEIQPGNQSEADEDDELYFDSELPLLDKEDLLGIGSDEDNGDNE # DDEDEEDAEENQDSLDGTDIDDWQWDDGYGSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 Scaffold_8 AUGUSTUS gene 482092 482721 1 + . g506 Scaffold_8 AUGUSTUS transcript 482092 482721 1 + . g506.t1 Scaffold_8 AUGUSTUS start_codon 482092 482094 . + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_8 AUGUSTUS CDS 482092 482721 1 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_8 AUGUSTUS stop_codon 482719 482721 . + 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 Scaffold_8 AUGUSTUS gene 486592 487299 0.58 + . g507 Scaffold_8 AUGUSTUS transcript 486592 487299 0.58 + . g507.t1 Scaffold_8 AUGUSTUS start_codon 486592 486594 . + 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_8 AUGUSTUS CDS 486592 487299 0.58 + 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_8 AUGUSTUS stop_codon 487297 487299 . + 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQNHSRSSSTNPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPS # DKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMESNPETNEGFRGGISKVEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 Scaffold_8 AUGUSTUS gene 490927 493093 0.18 - . g508 Scaffold_8 AUGUSTUS transcript 490927 493093 0.18 - . g508.t1 Scaffold_8 AUGUSTUS stop_codon 490927 490929 . - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_8 AUGUSTUS CDS 490927 492255 0.54 - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_8 AUGUSTUS CDS 492311 493093 0.19 - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_8 AUGUSTUS start_codon 493091 493093 . - 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MLDEQDAVDADQQELQQFLTLQRDEAAVAAKRKRNRSPMPVAGPSSKKIRSDAPKTDAPKKRSRRKSPAVEVNVEPFR # RVRLVVPPVRSVAPTSLPVPPPASPSLMGVLNRDLPMQGPSDLVRLADAAEVHPGLVQQAGSSSPARTPIKGTGQDLLSSTMPPILRPALVPRNPASH # PYRAENQRLAARVRLLETQLADSQRENSSLTSALRDTSHALESRQREVEQLRSSSQEFLQRQEEYRHIIDQFNTLDRALSGPSDQSLLERFQKVEEEL # RITRRIGTTTGKLSTSSRRISELTTALLYQHGITDEGNALSTRQRARLEELQEEVHRTRGRAAFVERMIKEYPDEGYYEVVLPPLSQLEGDLVKVRAD # LRRVATLAHRLYRSDPATVLHHHNRYIGAIIEAVVAFLRRALETEDPDIMEHNIRLALDYMQTARGVHGDLHIRSISSIQWFFNNAVDQDEGLYTLML # ENSRFDSDRPFLTAAQHAGFTSPPPDSLEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQYMHHITDTPLPVPDPPVPMSSTG # PVPESSDETNVEQSLEAPIVQVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSPVPPLLFGSVASLSIDLTGDDDELYETEEAYASRIDVAMEGTELAV # GQGIVKESRCSIPFVVLVPFPFCTSVKYYACLIFCFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 Scaffold_8 AUGUSTUS gene 500550 501248 0.86 - . g509 Scaffold_8 AUGUSTUS transcript 500550 501248 0.86 - . g509.t1 Scaffold_8 AUGUSTUS stop_codon 500550 500552 . - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_8 AUGUSTUS CDS 500550 501248 0.86 - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_8 AUGUSTUS start_codon 501246 501248 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MSQFPQEHYPFHNHPDVPQHWVPPLPRVPNDNQYPVYYAPYPVYQSFQPPPEQPHSATPKFKIEYSSIHATFLAMIKD # ANSLKDRKSWVKWNEGVWQAVADGFVLGHICDEPSPRTPWTEWNTPVVRPNVSIHPLRKELEARLKWDKNDRWTSSILTACLSDEVRNHLPPMIHDRG # ERRTARQIYLQLKAAYQAAPDRKACLCIQDELFNSQVHGMDIEKFNLKWSSTLTTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 Scaffold_8 AUGUSTUS gene 510249 511202 0.44 - . g510 Scaffold_8 AUGUSTUS transcript 510249 511202 0.44 - . g510.t1 Scaffold_8 AUGUSTUS stop_codon 510249 510251 . - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_8 AUGUSTUS CDS 510249 511202 0.44 - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_8 AUGUSTUS start_codon 511200 511202 . - 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLAISMIIHSRPFRPEPH # SRSCTSSIHLAQGQRLVRVRTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAEL # FVIHVFSKHGVLIMLLPIVVPNLFRRSSGALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITP # FFANKGYHPNITVRPEVDMKSDLAETSSSTSMNSTSSFERKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 Scaffold_8 AUGUSTUS gene 513575 514817 0.34 - . g511 Scaffold_8 AUGUSTUS transcript 513575 514817 0.34 - . g511.t1 Scaffold_8 AUGUSTUS stop_codon 513575 513577 . - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_8 AUGUSTUS CDS 513575 513946 0.81 - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_8 AUGUSTUS CDS 514029 514817 0.43 - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_8 AUGUSTUS start_codon 514815 514817 . - 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MTIPGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDS # SESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGE # AEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYVKKFFVLTIVIGNARKLESVRLPSGSSAPFTPK # PKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDRKT # SPQLLFPGTKRELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 Scaffold_8 AUGUSTUS gene 525794 526611 0.5 + . g512 Scaffold_8 AUGUSTUS transcript 525794 526611 0.5 + . g512.t1 Scaffold_8 AUGUSTUS start_codon 525794 525796 . + 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_8 AUGUSTUS CDS 525794 526133 0.5 + 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_8 AUGUSTUS CDS 526229 526611 0.65 + 2 transcript_id "g512.t1"; gene_id "g512"; Scaffold_8 AUGUSTUS stop_codon 526609 526611 . + 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSNSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARHPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSDLVVLVVPAVPAVPVDLVDPVPQSLLTSP # RQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGFGPPKTQDVLRESRPGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 Scaffold_8 AUGUSTUS gene 530325 531355 0.3 + . g513 Scaffold_8 AUGUSTUS transcript 530325 531355 0.3 + . g513.t1 Scaffold_8 AUGUSTUS start_codon 530325 530327 . + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_8 AUGUSTUS CDS 530325 530774 0.35 + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_8 AUGUSTUS CDS 530975 531355 0.38 + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_8 AUGUSTUS stop_codon 531353 531355 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MVTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGY # HPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNHRSARGRHEKNILVLSRSSVDLVLCLTSSSSQTTS # PNSPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKP # GP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 Scaffold_8 AUGUSTUS gene 537131 537659 0.39 + . g514 Scaffold_8 AUGUSTUS transcript 537131 537659 0.39 + . g514.t1 Scaffold_8 AUGUSTUS start_codon 537131 537133 . + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_8 AUGUSTUS CDS 537131 537332 0.43 + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_8 AUGUSTUS CDS 537391 537659 0.93 + 2 transcript_id "g514.t1"; gene_id "g514"; Scaffold_8 AUGUSTUS stop_codon 537657 537659 . + 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MVSSKDLDVFASLRGKALSAVALKDTTSSPPLETQASTSVSKTLVAPPRLIRRNRELENLKADASSFLASPRSARSKD # SDNELLSGFPLVDAVPRASSSTKVPVGKKEPKSKTTVKVVEASKASKPTPTAMVYKRVRLPPSSRKVAPTTVKGNPDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 Scaffold_8 AUGUSTUS gene 538431 539089 0.39 + . g515 Scaffold_8 AUGUSTUS transcript 538431 539089 0.39 + . g515.t1 Scaffold_8 AUGUSTUS start_codon 538431 538433 . + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_8 AUGUSTUS CDS 538431 538479 0.39 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_8 AUGUSTUS CDS 538542 539089 1 + 2 transcript_id "g515.t1"; gene_id "g515"; Scaffold_8 AUGUSTUS stop_codon 539087 539089 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MDALNALHTASSSSTHNLANSLRRAADLNDQLKQLGSLFDTTKELFLRSILDLQNAGTDPIVVLEALKAAEPNRRAIN # LNEWTLLATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLP # AIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 Scaffold_8 AUGUSTUS gene 540898 541675 0.38 + . g516 Scaffold_8 AUGUSTUS transcript 540898 541675 0.38 + . g516.t1 Scaffold_8 AUGUSTUS start_codon 540898 540900 . + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_8 AUGUSTUS CDS 540898 540924 0.39 + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_8 AUGUSTUS CDS 541031 541166 0.93 + 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_8 AUGUSTUS CDS 541248 541675 1 + 2 transcript_id "g516.t1"; gene_id "g516"; Scaffold_8 AUGUSTUS stop_codon 541673 541675 . + 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSTKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERA # TTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 Scaffold_8 AUGUSTUS gene 541937 543679 0.66 - . g517 Scaffold_8 AUGUSTUS transcript 541937 543679 0.66 - . g517.t1 Scaffold_8 AUGUSTUS stop_codon 541937 541939 . - 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_8 AUGUSTUS CDS 541937 543679 0.66 - 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_8 AUGUSTUS start_codon 543677 543679 . - 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MGKRKSRINLMTSKIKLTLEVVTYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFV # QNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGV # FATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEW # FFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPY # FLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKNWDFKPGQLVQVRNSGIEKSLDR # KMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMAPENDYIFDAIPHLRLSDT # DSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 Scaffold_8 AUGUSTUS gene 543863 544210 0.99 - . g518 Scaffold_8 AUGUSTUS transcript 543863 544210 0.99 - . g518.t1 Scaffold_8 AUGUSTUS stop_codon 543863 543865 . - 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_8 AUGUSTUS CDS 543863 544210 0.99 - 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_8 AUGUSTUS start_codon 544208 544210 . - 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPVVVLMQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 Scaffold_8 AUGUSTUS gene 545388 547697 0.19 - . g519 Scaffold_8 AUGUSTUS transcript 545388 547697 0.19 - . g519.t1 Scaffold_8 AUGUSTUS stop_codon 545388 545390 . - 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_8 AUGUSTUS CDS 545388 545865 1 - 1 transcript_id "g519.t1"; gene_id "g519"; Scaffold_8 AUGUSTUS CDS 545955 546195 0.26 - 2 transcript_id "g519.t1"; gene_id "g519"; Scaffold_8 AUGUSTUS CDS 546308 547697 0.35 - 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_8 AUGUSTUS start_codon 547695 547697 . - 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDD # ERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPF # KFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTDGYKRCE # QETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTS # ETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE # TNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 Scaffold_8 AUGUSTUS gene 547727 547996 0.81 - . g520 Scaffold_8 AUGUSTUS transcript 547727 547996 0.81 - . g520.t1 Scaffold_8 AUGUSTUS stop_codon 547727 547729 . - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_8 AUGUSTUS CDS 547727 547996 0.81 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_8 AUGUSTUS start_codon 547994 547996 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 Scaffold_8 AUGUSTUS gene 548388 548945 0.99 - . g521 Scaffold_8 AUGUSTUS transcript 548388 548945 0.99 - . g521.t1 Scaffold_8 AUGUSTUS stop_codon 548388 548390 . - 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_8 AUGUSTUS CDS 548388 548945 0.99 - 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_8 AUGUSTUS start_codon 548943 548945 . - 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLE # TVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGI # KLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 Scaffold_8 AUGUSTUS gene 549044 549250 0.83 - . g522 Scaffold_8 AUGUSTUS transcript 549044 549250 0.83 - . g522.t1 Scaffold_8 AUGUSTUS stop_codon 549044 549046 . - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_8 AUGUSTUS CDS 549044 549250 0.83 - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_8 AUGUSTUS start_codon 549248 549250 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 Scaffold_8 AUGUSTUS gene 551409 551894 0.89 - . g523 Scaffold_8 AUGUSTUS transcript 551409 551894 0.89 - . g523.t1 Scaffold_8 AUGUSTUS stop_codon 551409 551411 . - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_8 AUGUSTUS CDS 551409 551894 0.89 - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_8 AUGUSTUS start_codon 551892 551894 . - 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MDIEKFNLKWSSTLTTLRNYGYDIPWDTLISKYISKLPSGPRYVYLKQTLEEEFDQPGIIPNRDLFDKFAIRLENTRN # RELLDLADSGGGAYNRRFQRNGNGGTSDKPSEPQKPKDSPNVSKPNNKPSAYVTTVTSPTSNTTSKIEPVDNVNPVPNVIPDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 Scaffold_8 AUGUSTUS gene 564958 565266 0.73 - . g524 Scaffold_8 AUGUSTUS transcript 564958 565266 0.73 - . g524.t1 Scaffold_8 AUGUSTUS stop_codon 564958 564960 . - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_8 AUGUSTUS CDS 564958 565266 0.73 - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_8 AUGUSTUS start_codon 565264 565266 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MQRQLGCEGDLPHDTQELSMSRHAWSNRPRHLPQPESDRSSNTDVDCEIHTPINYTELSDDKDEIAFDSLIRTWDCAF # SDCDKFGHCKLIEKTGLVQVGEHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 Scaffold_8 AUGUSTUS gene 569495 570758 0.42 - . g525 Scaffold_8 AUGUSTUS transcript 569495 570758 0.42 - . g525.t1 Scaffold_8 AUGUSTUS stop_codon 569495 569497 . - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_8 AUGUSTUS CDS 569495 570249 0.76 - 2 transcript_id "g525.t1"; gene_id "g525"; Scaffold_8 AUGUSTUS CDS 570347 570758 0.42 - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_8 AUGUSTUS start_codon 570756 570758 . - 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MSNILDARSNIGDFSDDNLADQNFGGEIDESACSSRCWDADWWRLRLCRSAWVSQGGPESEDSIVASNAYGTEDFNSD # GEPDEETTSEFNDELLQDVDMEVGEETECQGQVEQADDDMQRNSTMFNGYPQQGTVYTPETNLRALLLPPDQTTNQEELLLHANEPPAPAAAPPHDHP # PPLPNNGNNEGGPHANNANPAPHPHQAQEAGHRPVPFTEDTLGLAAVPLYLRLSEYVVYFGGQTIPCANDTKVDFDSDDGMHSITHTNNDTGHRGAGA # AGMNLDDAFDQGIKDSWFPPNTTLSTKGDRVIATVPSFVTNNVEEYEYVAIQNNDINADDVTSSVASFSTPTLSRGMGSEVEARSKRKPGTFHDQERC # PGCNTGESVVSCEDSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 Scaffold_8 AUGUSTUS gene 575379 576149 1 + . g526 Scaffold_8 AUGUSTUS transcript 575379 576149 1 + . g526.t1 Scaffold_8 AUGUSTUS start_codon 575379 575381 . + 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_8 AUGUSTUS CDS 575379 576149 1 + 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_8 AUGUSTUS stop_codon 576147 576149 . + 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MSNRLALGDPSYAVEDLGFCHDVYVGLREFAASSSNTSELDDFADALRNSEAYWRNAFTLMHIKNSDKSTHTEKEVSV # AVLNLALKLILQRPVPEVAQLMRTWIQTGLFSVLDETMEELIRVPGATSKSGVSKARRSLFANSNLTKTFFLYAGLLTFFYTTIKESCLSPSFPVDVL # EALKDEFPRQRAVGAVMRYETEQKGNQQNNTPEKNAHEDDIPDAEDPIWINGLWQAMGWLEGYATVTILSTRARKVLKID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 Scaffold_8 AUGUSTUS gene 581380 582347 0.42 + . g527 Scaffold_8 AUGUSTUS transcript 581380 582347 0.42 + . g527.t1 Scaffold_8 AUGUSTUS start_codon 581380 581382 . + 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_8 AUGUSTUS CDS 581380 581844 0.65 + 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_8 AUGUSTUS CDS 581934 582347 0.43 + 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_8 AUGUSTUS stop_codon 582345 582347 . + 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MKRQAQSKSTKVIAVDITRKEKLQYLYSMGIDLPLTTRLPDDANAIEKKFRSAIDASQSFATLIAKSPFDPSTLPLWS # KKTSKTTLLKTVSRGNFEEAFANIRARREGKESAWPLFENTFMDARQTIMGLADGIDKGVKTALIQDKDTKYAICLRETPVMVVLCRRGTRDAPALET # IRWAQEIISNKKLSLLKVTATPEEQKLLLAVLNMNARRLPPAYSVKRNSSGSEATFALSFLLPLGPINQKDIGKLTHHTGCVVCGKKTVSKCSRCLSM # EYCGVGKPLVQIVWCTSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 Scaffold_8 AUGUSTUS gene 584955 585281 0.91 - . g528 Scaffold_8 AUGUSTUS transcript 584955 585281 0.91 - . g528.t1 Scaffold_8 AUGUSTUS stop_codon 584955 584957 . - 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_8 AUGUSTUS CDS 584955 585281 0.91 - 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_8 AUGUSTUS start_codon 585279 585281 . - 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MYTNFVPALDGKYLSSNVNITVFDANNNTIDVPVGNRFRKFTTRKGRKITSLGVLYDFTGNDVNTTVQSVADMVKEQW # VSNMKPISSIELTGSFSSQKLLPKNQMYFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 Scaffold_8 AUGUSTUS gene 591991 592907 0.47 + . g529 Scaffold_8 AUGUSTUS transcript 591991 592907 0.47 + . g529.t1 Scaffold_8 AUGUSTUS start_codon 591991 591993 . + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_8 AUGUSTUS CDS 591991 592150 0.51 + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_8 AUGUSTUS CDS 592258 592907 0.85 + 2 transcript_id "g529.t1"; gene_id "g529"; Scaffold_8 AUGUSTUS stop_codon 592905 592907 . + 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MEYAMDDDIYDPEYIMNCQKSCPTCRAIVIGRPLPVYSVKDIINALQKAKPNGEDPWEGPLPDDLFPNYDEVEGQSES # GFADEETDGNPAGPAYEEGYDSAIDEEECNSLAYYENMYGIPSDEEKEEWYNHFEEMYGHLVDEEEDDCIGDEEEYESPADGDDNSPADGGYDSPADG # GMIVLLIMGGMIVLLMGDMLRRRRMICSGSTADARGYDSPEKGGSRIYGCNAGGQIRIQKVPAHTLQRYTAWKTKLALAFSSIKTRFVLGRES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 Scaffold_8 AUGUSTUS gene 597795 598524 0.29 - . g530 Scaffold_8 AUGUSTUS transcript 597795 598524 0.29 - . g530.t1 Scaffold_8 AUGUSTUS stop_codon 597795 597797 . - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_8 AUGUSTUS CDS 597795 598051 0.42 - 2 transcript_id "g530.t1"; gene_id "g530"; Scaffold_8 AUGUSTUS CDS 598324 598438 0.36 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_8 AUGUSTUS CDS 598504 598524 0.32 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_8 AUGUSTUS start_codon 598522 598524 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MLDVQVEVGRLNAPFGTQNNSTIREFRPALCRQNRKQVCTYVQSRCRFGTRIYSNISLCICPQSLQGAPPPPLPSPFA # RNLSFLLLGGDLDLAGVPDLVLPVLPLTGVEGDELDEEEEEDSEITEAEAEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 Scaffold_8 AUGUSTUS gene 601723 602199 0.5 - . g531 Scaffold_8 AUGUSTUS transcript 601723 602199 0.5 - . g531.t1 Scaffold_8 AUGUSTUS stop_codon 601723 601725 . - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_8 AUGUSTUS CDS 601723 602199 0.5 - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_8 AUGUSTUS start_codon 602197 602199 . - 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MLRRSHSEELLLGPMQKGSVDKDRRKRGAVDVRLVDFAHTTTGRDWLPYPEDFDKHLPHEVTTSSQGYNADIDPETGL # IYARFPPHYPEDADMGFIWGLKNLTLALEQMWNDERKLRFKLLRENPDCGVKKLPALPTEGKEIFDEIFGEEDDPGMLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 Scaffold_8 AUGUSTUS gene 602576 605522 0.9 - . g532 Scaffold_8 AUGUSTUS transcript 602576 605522 0.9 - . g532.t1 Scaffold_8 AUGUSTUS stop_codon 602576 602578 . - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_8 AUGUSTUS CDS 602576 604144 1 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_8 AUGUSTUS CDS 604227 605522 0.9 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_8 AUGUSTUS start_codon 605520 605522 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MGSVAADFRQSKQSQFRYPSSTSSQPISSPRSASFLSEISGKWPRTSPGSHLSSSRQRLNGDGTDSDGYLTEKSSSHR # RKHSVAGKSRALTLPPTAGQIKLSPSRPIFRRTRSPSTGSSSSSSSSTSAPAVPLPTHPSTSGIGRKVAATLQLFKETEDDSQTNDVQPSTDHHERSA # SLGNGGDVAEAKFEFVKRSEWPDREAVVLRREKSTVTLHRVRTRESLASSDHKQQEDKKAQERKLSVTDLNQWRKDVGKWDDGIDRGRRRERAEDEII # SPLPSPRLLEQLEPPDVIRRSSSRSQPSTGVQSPHPYLSAVPHYDSSTLSPWSTDDESGWDSASGTTSTTSHSTAFTHHQNLSSSIPPLDDASSPTIS # FPSPNTPYHHYTDADDGDENTYLLDMGLNISQDTLPHIPLRPFRNQVGGHSAIYKFTKRAPLVSRENLFYEMVEREAPPLLAYIPRYLGVMLVSYRRV # LKSATLQLKPSADGHGEAKTPRPPLQKAATDRPSAGGKHNEEYTDTDESEMPEVVLDRNRHIVPEWMLRGSRSRSASQYTAAGVPSAIRRFQRQTLHR # GTASSPDLASPDSGSGILKPSPLARYPPFVSSEMTAPTPANSPKILTNGLRPGFPEGEKRRIFLVKSASDEDDGFGCRPELPSFHSEHMHSPLFGGRG # STMVNTKLKDHVFSTVLRRLKRRPGGRWLGGTRIVDDDGEVADAEGDDPSDFDNSSSKIRRRRGRKIAGDSLGRLRDSDHSQLRRVQSEAMIASPSKL # QAIAYEQQNQDHRGQEQFDHDVVGLFDMDVEGSPPPLRSHKWPNLTSSDLDTTELPPSLRKRSRSRSLDERPHRMTLTSPIRMPPLKEPELTTDDVHP # KQHDDGEAEPKHDLDSEFSRQNHFILMEDLTGRLKHPCVMDLKMGTRQYGMDATPVKKKSQRKKCDRTTSRTLGVRMCGMQVRIVNQSFTSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 Scaffold_8 AUGUSTUS gene 609154 611669 0.46 - . g533 Scaffold_8 AUGUSTUS transcript 609154 611669 0.46 - . g533.t1 Scaffold_8 AUGUSTUS stop_codon 609154 609156 . - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_8 AUGUSTUS CDS 609154 609998 0.97 - 2 transcript_id "g533.t1"; gene_id "g533"; Scaffold_8 AUGUSTUS CDS 611270 611669 0.47 - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_8 AUGUSTUS start_codon 611667 611669 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MSLCFIEPAASLRHEHEYGSDIALLTDESAPPTQTTFTQAPTNNLSPTITSTAAPALPPLITVDHMKPNFKSIFRRST # TDSRKQRHEQAEGLGPHSPREVVRAGTFSSLLTPSKKVGPSPTMFQSFRSVICSSFYAAYLVFQLYSHASLYNDKNDIIKSTKYAPRPKKTKSNKSSV # DHAHLNASAERLEMHVMPPYSSFDLAHDQHPDLEHGHGEGEGPSPGFSSPSATPTSSKPLIGRLTTKAWDTASTTAATFTSVASSAASLAGGRHKSKD # VEKGLAPATSTAEGEVVVEVEEEEEEKPQMNLTTTIVLLAVVTAVSQFSSFLRILVFQDSTDRLSSLSFTQLVSVTAEWLVDSIDGLTDTGAISQEFV # GIILLPIVGNAAEHVTAVTVSVKDKLTLSLGVAVGSTLVSAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 Scaffold_8 AUGUSTUS gene 613385 613981 0.63 - . g534 Scaffold_8 AUGUSTUS transcript 613385 613981 0.63 - . g534.t1 Scaffold_8 AUGUSTUS stop_codon 613385 613387 . - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_8 AUGUSTUS CDS 613385 613981 0.63 - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_8 AUGUSTUS start_codon 613979 613981 . - 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MCFYFFIPDELKSTVAATSPPGTNLGLLASTGTVKANGNLPAYRMGSQRSKYDIYDLEAPRNGNGRAGAAVGGRGIMA # EAAAEFDLAESEDDFASETGDGERHPGDEEDITYRPTMQKAAGNKPNGKNKSEIVAGGANGHRHTASIARLIRGPDARGSIDGGDEGWRSPMSAGFVF # PPRNGRGKEADGKRSPIRETFV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 Scaffold_8 AUGUSTUS gene 616569 617018 0.96 + . g535 Scaffold_8 AUGUSTUS transcript 616569 617018 0.96 + . g535.t1 Scaffold_8 AUGUSTUS start_codon 616569 616571 . + 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_8 AUGUSTUS CDS 616569 617018 0.96 + 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_8 AUGUSTUS stop_codon 617016 617018 . + 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MLDSAARNVDDDEWQVVLADWPRIHFEAISWTHNPPGSHGAPCKAICRPPTKSHYLVKQTDGNSADLEQELNAELVGV # SIAFDVLTAYEATSGFHYNSCLDVRGVESTSANVADISCQIDEKDVAACKKNWNEIVQCSLTGDFAEEEGY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 Scaffold_8 AUGUSTUS gene 617096 618502 0.73 + . g536 Scaffold_8 AUGUSTUS transcript 617096 618502 0.73 + . g536.t1 Scaffold_8 AUGUSTUS start_codon 617096 617098 . + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_8 AUGUSTUS CDS 617096 618502 0.73 + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_8 AUGUSTUS stop_codon 618500 618502 . + 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MYQCLQLQKPHAPSSYGAARSSPSVSPHSKLNASASSFTPSGSSVPSLTFSNNASPLTTRSSPSPTLHDFVFPSLNST # KVSSYPKLKIEKDDQGFYTNMEAETELVTPKSHMHPSTLLPAFLQDDHIRRKGLSSKTRALVDRLRSRQSTTTHEESGYNLSPSPVDSELHDSQGTTF # DVDDSASSSFSESRSISGVPSLTSTNLSSDTDGWIGLEELHRSSPPKSRKRNGPNLSLSTTPMHRRTGSGPAALETEPQVRSPSSSSSQGPALSSSSS # SSSSSILSPPTPPVITNNDGWIEVSEISRKKSISFVPTKKPSRVSNRKMETEPLTFPTLNATPQTNSRSHTRNASSAGSSKSTKAYKSAPAGVLPLSP # PAPASNYGYYVPPALPVAPTVSYAPYAVNPMTPYATMMPQYYPHQYAYQQQHTHPQQYPYHHRGHSVAVPSIGTMPASYVIPNATASPMTIRLGMW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 Scaffold_8 AUGUSTUS gene 618910 619838 0.28 - . g537 Scaffold_8 AUGUSTUS transcript 618910 619838 0.28 - . g537.t1 Scaffold_8 AUGUSTUS stop_codon 618910 618912 . - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_8 AUGUSTUS CDS 618910 619726 0.51 - 1 transcript_id "g537.t1"; gene_id "g537"; Scaffold_8 AUGUSTUS CDS 619777 619838 0.28 - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_8 AUGUSTUS start_codon 619836 619838 . - 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MLPIWLHGVQGDSVTGMPIVRPHYVVFPQDTAGFAIDDQFFVGSSGILVKPVTEKDKTEATVYIAEDQVGDLYMLSFY # GIHSRFSLYQVYYDYFTQYAYRGSSKGKHITVAAELHQVPVLIRGGSIIPTRERPRRSSPLMKLDPFTLRVALSKTGTARGDLYLDDGVTYSHQQGDF # VWREFVAEQSHKKTTRISSKDLASHNPGKAVDGIALTTFDPKNAFAKEIEEVRVEKIVVLGLNSKPRSVNVEGGAELKWEFVPGVAASDKKEGVSSVL # IIKDPKVLITTDWAIVIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 Scaffold_8 AUGUSTUS gene 620404 620745 0.76 - . g538 Scaffold_8 AUGUSTUS transcript 620404 620745 0.76 - . g538.t1 Scaffold_8 AUGUSTUS stop_codon 620404 620406 . - 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_8 AUGUSTUS CDS 620404 620745 0.76 - 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_8 AUGUSTUS start_codon 620743 620745 . - 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MVVIVDPHLKRTSDYPVYQEASDLDILVKPKSGEGEYEGWCWTGSSSWIDHFNPASWDWWISKFKTTKNDTGFSWTES # TEDIHIWNDMNEVKSSRLFRTEDSHYDLAFHLQWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 Scaffold_8 AUGUSTUS gene 621065 622200 0.93 - . g539 Scaffold_8 AUGUSTUS transcript 621065 622200 0.93 - . g539.t1 Scaffold_8 AUGUSTUS stop_codon 621065 621067 . - 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_8 AUGUSTUS CDS 621065 621426 0.93 - 2 transcript_id "g539.t1"; gene_id "g539"; Scaffold_8 AUGUSTUS CDS 621483 622200 0.96 - 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_8 AUGUSTUS start_codon 622198 622200 . - 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MHSVVLFGSFYALLALPHALAVKSQDFKTCSQSGFCRRGRALAARAQEAQSSWKSPYTVDPSSIVISPEDSTVKAAVK # SSLYPEIKFGLELRIHDDGVVRVLLDEVDGLKKRYDEAASWALVSEPKLSKGIRWAAGKKELRAVFGEKNDIEVAVDYDPLRVRLRRGGEDQIVLNGR # GLLHMEHFRSQTLKETIEEVASDENAEGQEVLQVENVRAWFEGDSEDAYWEEKFSSWTDSKPKGPESLSLDITFPNHGTVYGIPQHATNLSLPSTTGD # SPSYTDPFRLYNADVFEYLASSPMSLYGSIPVMHAHSADTTVGVFNAVGSETWIDISYPTKKSTHTHWISESGIMDVFLATWTNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 Scaffold_8 AUGUSTUS gene 622938 623669 0.98 + . g540 Scaffold_8 AUGUSTUS transcript 622938 623669 0.98 + . g540.t1 Scaffold_8 AUGUSTUS start_codon 622938 622940 . + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_8 AUGUSTUS CDS 622938 623669 0.98 + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_8 AUGUSTUS stop_codon 623667 623669 . + 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MSLDTLNVTSTYHRDTYPAISPTKPSLSQAGRAILITGGGGGIGFEIARSFAKAAASKIIIVGRRSAVLEAAAVKLRE # EFKDSTTEFIAHQGDIGDDASISSLWDFLNSRNIFVRVLVLNAAHFTPWGPDTLKMDKRELMEGFDINVGGNFLMTVKFVNQPLRPAGQQLNLINVST # ASIQMIPAPNQTPYSTTKSAFTALIGRIADEHPVEDIQIISYHPGALYSEGAAKHVDKNLLKWDESK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 Scaffold_8 AUGUSTUS gene 630334 631623 0.8 + . g541 Scaffold_8 AUGUSTUS transcript 630334 631623 0.8 + . g541.t1 Scaffold_8 AUGUSTUS start_codon 630334 630336 . + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_8 AUGUSTUS CDS 630334 631623 0.8 + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_8 AUGUSTUS stop_codon 631621 631623 . + 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MSDILIACLFPAMLLYLGLRLSVFDKAFLHSIWFDFLALFKSGRTPNTNSGNGPFSVQTSSTAYSRYRSLSLDELSRM # RASYTLIGRTHKHIGYELGYTKKLDRLAELIQVNAKATDGIVTVMRRRYAQELSVSTATLWSGFPSTVRETSIDSHSLSRIREALKHFVRDWSDAGSS # ERSVIFQPILSALSALPAPSRSRNRVLVPGSGLGRLAYEISQLGYDVTACELSAYMNGAFRFLLDSEMTTTINQHEIHPYAHWWSHSRNTADLFRGIR # FPDVIPRLAEEGTVGLHLTEGDFLALKAPKPLAGSDLSRANGYDFIVTLFFIDTSVNILSTLEQIHKLLKPGGTWVNLGPLLWCSSAQARLELTLEEL # FDAMEAVGFAVAGGRDGNDDDEPDCMKRRTIPCEYTHDDKAMMRWIYEAEFWVARKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 Scaffold_8 AUGUSTUS gene 636504 636944 0.97 + . g542 Scaffold_8 AUGUSTUS transcript 636504 636944 0.97 + . g542.t1 Scaffold_8 AUGUSTUS start_codon 636504 636506 . + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_8 AUGUSTUS CDS 636504 636944 0.97 + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_8 AUGUSTUS stop_codon 636942 636944 . + 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MILKIRLQLSALNRITNKKVYQAAIEKEFKAKQTQESYVKKAREKYEQDCMRINSYTAQSTLVQGRDLEKIQFKLDKA # QATVQTNERDFANFARTFQDTAAKWEQDWKMFCDTCQDLEDDRMEFMKDSMWAYANAVSTVCVSDDEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 Scaffold_8 AUGUSTUS gene 637025 638958 0.91 + . g543 Scaffold_8 AUGUSTUS transcript 637025 638958 0.91 + . g543.t1 Scaffold_8 AUGUSTUS start_codon 637025 637027 . + 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_8 AUGUSTUS CDS 637025 638162 0.91 + 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_8 AUGUSTUS CDS 638234 638958 1 + 2 transcript_id "g543.t1"; gene_id "g543"; Scaffold_8 AUGUSTUS stop_codon 638956 638958 . + 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MDSEKEMENFVRDYGTGPQIPAPPAFFTYNSPEAASASVARTKPANFVRSSQRTSPLRMPQPIPPEEEDEPPVNTAGR # GAGGGHSAKSSMADARPSSRGPNGVNGQNGQLSSSPSHVSSSTAAQPLSRRSTHRNPPPHDPLAEPIDPNAETYIKVGGSAYKVDLNNDPQRQGSMGY # NAPRSASPSKLNSANSAVDDPLAKQLEELQNQVSSVGSVRRNSIWRGQQNTEGSSSGTPSRKGTADALAAPRAGSSAPRDYRNSAEMIVGQHPSLSRP # ASPNPNPSAPTAAFMVPKKPVSPGAEILDGILTDYHQSLPGERKAINRSGSRSRSRPGSYAASNGFNEQQQQRGRNLDRPPSVGHAGIGAHGSRSNSP # QPMSRSTRSQRSPSPNPLGISLDANNARVTVDEMAQRYQQQAQSQYRQPPPQQQQQQQQQQPQYTGRSQGYTAPAAQPQYAPPPAPYQAPHHQQQPSY # SQVPPPPQPSYNAPPPVHYQVPPPPQQQPMYQQTAPPPTVSPGYGQMERALTGPGYYGNGNGQLVQQQQPQQTMSQQQQRNMHPQQQNSSPGYQQQMS # MYGGPMRRSPSPQPPAGAMVAAPTRQVTEDGAGILFYGTLLQLAYLLSNSSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 Scaffold_8 AUGUSTUS gene 649007 650470 0.39 - . g544 Scaffold_8 AUGUSTUS transcript 649007 650470 0.39 - . g544.t1 Scaffold_8 AUGUSTUS stop_codon 649007 649009 . - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_8 AUGUSTUS CDS 649007 650470 0.39 - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_8 AUGUSTUS start_codon 650468 650470 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MRSPVPIVLPSPEHTWSPVLIRPPSYTSLDNRLTGLTATTDQRGASPISRLSTPQSLYESRPSTAMQELPPPNEERTN # EASIHSSSVHSSRLPTSILAVRSPSLVYTRSSSGSARSQSPPPVIPVLSNIPSTRTCSPSSIRAWSPPPFGNNVPRPFVYTPIPPSPSQSFMRYHSPR # IAPFSNLPAVFTPSSAPELTPRLLGEPSRVIPPLCSGVPSLVSRMHDGTGVGTTKNDHTDSDPNFIPWVPPTPPPITPSVTSTILHRPHDHTWTGANW # GPGQKGRFDPNHNSPWVPLRPPIAQTQGVVNASSSPNLHHQSSQFPQVTPYGSWNSPLQPFIPPVIPPPPPDTPKVNDSRCVCGPRGGVGDSSVGGVF # GVGGYSGFGNGPSGAVWPVPPSFPAPTHPFPSTFHTIPSVPPSLPGFSHVSPSFPPGFIPTSQVSRIPDQPAAPNVVPLSPKYHHRYHFYDGSVLILV # SLHLCVTSSPAEVISLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 Scaffold_8 AUGUSTUS gene 661961 662323 0.73 - . g545 Scaffold_8 AUGUSTUS transcript 661961 662323 0.73 - . g545.t1 Scaffold_8 AUGUSTUS stop_codon 661961 661963 . - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_8 AUGUSTUS CDS 661961 662323 0.73 - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_8 AUGUSTUS start_codon 662321 662323 . - 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MQYLPPDILDWDNAITTCEANKVFDAAIWALNRQGKPLEALAKADTFDQSLSLELVNIFQAASNQVSIADVGSILRSL # ESIGRTGISMCIEQSQDPSAMDIPLEDIWFKLLHSQINWYKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 Scaffold_8 AUGUSTUS gene 683608 685646 0.14 + . g546 Scaffold_8 AUGUSTUS transcript 683608 685646 0.14 + . g546.t1 Scaffold_8 AUGUSTUS start_codon 683608 683610 . + 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_8 AUGUSTUS CDS 683608 684564 0.15 + 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_8 AUGUSTUS CDS 684633 685646 0.57 + 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_8 AUGUSTUS stop_codon 685644 685646 . + 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MDLDQDMDNSTLYDNHPLSSLYDPVTKESGSILEDGNDLEEEPSSCIRDVASTALLSEGDQEYMSSASTFQNSTKRRP # ASSNPFSNVDPVPIDHSTYSCVDHDAPAIFMSEGHYLAQTNEGIMSLKTENPADIYQNPVEPDKAGNEDGKQEDRLLTNNRSSHLDPETMTTETQFPH # EVFAESAISELVVGNGNEEQSPNSDSYKDVYLASAHELEAGKIEETRNLASLALSTRSYLSGLEHDTNLVFTDDDYYGSPAIREVQQDPQQEEDDWEQ # AQAGDYVPRTRTSQSRSFLNMVREQSTQDLLNLGVQTLSETSLHPEEEGGRGEDWEEGGGDNHQYRESGFVGFLNYEAQPQYTGIEQDIASPSQSNSN # QHNSTFGYHEDLDKEQEQDREEWEQVNFQLLQDFIAFSEPNPPVAEFIDVGEGDNQFQPVGSSDYPSQSRYMEVEQEIPVLSLSNSKEESRTFSAKMV # DIEAPPRWYTEDTGETDNFVEDADGYYTNEYQGDDEVDHIPMHHAVLHPPSMNISPSLNASPSLNASPSLNASPSLNVSPPPSLNVSPPSNVPYQAEN # VPNVLLNTHDLHNGCPTVVIYGPAADYKGDEAGSNEGSYGEKDSMSMDHWDTNDESSGATSKTSPSAIPELFAPIPNSLTIPTFPVAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 Scaffold_8 AUGUSTUS gene 687280 689280 0.79 + . g547 Scaffold_8 AUGUSTUS transcript 687280 689280 0.79 + . g547.t1 Scaffold_8 AUGUSTUS start_codon 687280 687282 . + 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_8 AUGUSTUS CDS 687280 688764 0.79 + 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_8 AUGUSTUS CDS 688816 689280 0.81 + 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_8 AUGUSTUS stop_codon 689278 689280 . + 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MSVDPGDTSFVAPLNVPLLSTTENPVAYKNLLHHAHDYALHGNDAEFSQGWAENNRQSTDDGTRFFDPNAMLSADSRP # SSNSGSDLDDPFFRPDVNPTTARRSVTIKEIQEPEIYPNPLPYLGRLGPILRPTSAMGQHPNVEHAQDDCYQQNPNRYFDSDDHPDLLFHGTNNDSSD # GNNHNNYELFNGDDDVQMYQGASGDGIDTENDTRPQLFDTANESYLRGLSPLTEIPDTPMPKTHSNEDEVLASLMGELSSLVQNGVKSISMVRLFIIK # YENSIMIINFQQSHFKSQMNDPNINIKTLEAILNRCYRYVGALSDNASPSFARPEHDGNDHLSVDSGFSPKLYNPPTHRTEGKNYLAELVRNETGVLL # GILGVNETRAEPLTPTGKFLATVSPGTIKDFANSRHDGPTVQNFVLQLHHGRRTAWNKAAAEVFCKHFRSQEGFGNYKKKDVYEAFIAHITQLKREFA # LQGRQKSTREKDDERRARRLARRHKLLHRRIKAFRQIYRHHPGPLGELARFILRLTPECMSGDETGTDGKYYKTQVEWRSQELADFLALLSAWYMGRY # LDHGKYSPGELPHPRYPSNRVDMVMQADAASSQLPINWYNPAWLAEYEERRNVLSPLPAVSLELPVDIARYVLMREVNAQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 Scaffold_8 AUGUSTUS gene 690384 690866 0.53 + . g548 Scaffold_8 AUGUSTUS transcript 690384 690866 0.53 + . g548.t1 Scaffold_8 AUGUSTUS start_codon 690384 690386 . + 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_8 AUGUSTUS CDS 690384 690866 0.53 + 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_8 AUGUSTUS stop_codon 690864 690866 . + 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MHMNPPRVVLEEELFLSNCWKFAGSQGHIAIALSDSIIWNQFTIHFPDGDPGINLRQAPRVIVMQALVSQENILVEAR # SLQTAWEDFVVVDQLLDPSMFNSSMAFMEVARIVYMPLEGGQQMFTTFSPVQTSVVLVQILDNWGDMSTCLHRISFHGDTLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 Scaffold_8 AUGUSTUS gene 693236 693748 0.52 + . g549 Scaffold_8 AUGUSTUS transcript 693236 693748 0.52 + . g549.t1 Scaffold_8 AUGUSTUS start_codon 693236 693238 . + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_8 AUGUSTUS CDS 693236 693748 0.52 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_8 AUGUSTUS stop_codon 693746 693748 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MAKGACIYLYQAFGRRGSHHAKTQVALDAKQLVKQSIKSYDTRMSYRPRTVEGDFDITRSRQLIRELCMVNFRSELLY # VDNLLDQSRPQPSPSLSVAELEAVTASHKRSRRTLISHALLFDSLTPHTSVDLGLAAISWSERYAALKHFWTLMDTWPREKPLIWRRGIEMD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 Scaffold_8 AUGUSTUS gene 695707 696618 0.85 - . g550 Scaffold_8 AUGUSTUS transcript 695707 696618 0.85 - . g550.t1 Scaffold_8 AUGUSTUS stop_codon 695707 695709 . - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_8 AUGUSTUS CDS 695707 696618 0.85 - 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_8 AUGUSTUS start_codon 696616 696618 . - 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MGWSTTEVEYTYQQTTTYALRYSVNAMTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDCEVCARKKIQRHPRA # VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLGLHRPVGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIK # SDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDA # GAALHLGKKQQKEGYERGSGKLINLKLET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 Scaffold_8 AUGUSTUS gene 697559 698992 0.9 - . g551 Scaffold_8 AUGUSTUS transcript 697559 698992 0.9 - . g551.t1 Scaffold_8 AUGUSTUS stop_codon 697559 697561 . - 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_8 AUGUSTUS CDS 697559 698992 0.9 - 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_8 AUGUSTUS start_codon 698990 698992 . - 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 Scaffold_8 AUGUSTUS gene 699043 700209 0.9 - . g552 Scaffold_8 AUGUSTUS transcript 699043 700209 0.9 - . g552.t1 Scaffold_8 AUGUSTUS stop_codon 699043 699045 . - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_8 AUGUSTUS CDS 699043 700209 0.9 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_8 AUGUSTUS start_codon 700207 700209 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 Scaffold_8 AUGUSTUS gene 704341 705123 0.66 - . g553 Scaffold_8 AUGUSTUS transcript 704341 705123 0.66 - . g553.t1 Scaffold_8 AUGUSTUS stop_codon 704341 704343 . - 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_8 AUGUSTUS CDS 704341 705037 0.67 - 1 transcript_id "g553.t1"; gene_id "g553"; Scaffold_8 AUGUSTUS CDS 705116 705123 0.67 - 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_8 AUGUSTUS start_codon 705121 705123 . - 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MCCEYELRQHFAYEDRGRTHASPEPYPLPTMTLFPQSEAAPETVFDPPNVVSESVSYPLPPTSLNETDDVGTPAPEVP # KPTTNIIYEWKTLENIQLHLHTLKENPHRSWIPANIQFRSDLGESPDFKDFTRCLCQDSRNSNFLGHVEWLRNSQMFLDNTLPLKKLSAAFSCKHRVV # RTALDVELEDCRHKLEVELIERRQRAATGQESVHLVGAYSLSIRKFLAHPSFTRYPCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 Scaffold_8 AUGUSTUS gene 706205 706657 0.88 - . g554 Scaffold_8 AUGUSTUS transcript 706205 706657 0.88 - . g554.t1 Scaffold_8 AUGUSTUS stop_codon 706205 706207 . - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_8 AUGUSTUS CDS 706205 706657 0.88 - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_8 AUGUSTUS start_codon 706655 706657 . - 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MGSNNGDYTAKKMKIEDGTARRQYLPTGTGIIGQMGGNYTGSDRSNVPEVTNPKKRKSTADNDGASPLALPPHLNMSA # SSSSVDRARSSSPRPPPAAHSRQNFLNTSGTNNSHLNSAPQAGPSNYHHMALGTSAGYSSQNPFASPSTAGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 Scaffold_8 AUGUSTUS gene 716110 717414 0.54 + . g555 Scaffold_8 AUGUSTUS transcript 716110 717414 0.54 + . g555.t1 Scaffold_8 AUGUSTUS start_codon 716110 716112 . + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_8 AUGUSTUS CDS 716110 716754 0.67 + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_8 AUGUSTUS CDS 717001 717414 0.9 + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_8 AUGUSTUS stop_codon 717412 717414 . + 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MLSVNVMLVLLVVYWMGLYLNNPASVQESSPKDCLARNTLNDLIDCLDAFSVSPDFYDASSYAAAQPTDEENSAWTSV # IYSMLNANANDCADITLPSALEHIYAVTTFPDVDINRTFCVLSETTASVYSNYTKGWGLMVVPASARDISRHIHLSAPHPQADINTPQQAGAIFTLSG # AHSLLISGRFRSAYAVQTDCIIPVGAKKVFYKTDPAHDVALLADHLHSPWPGNSDSSLSWYEDHSLNIPARRLRDIARTIFPNWNASLPSDDPTCVLT # ATSNVFGRLINGVPGGSVCTTDADSLIATGEFIHIEQAIASRQSDVYDQWGEILRRAFRTSCAEGTVEDSKIGLCVLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 Scaffold_8 AUGUSTUS gene 719525 720118 0.95 - . g556 Scaffold_8 AUGUSTUS transcript 719525 720118 0.95 - . g556.t1 Scaffold_8 AUGUSTUS stop_codon 719525 719527 . - 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_8 AUGUSTUS CDS 719525 720118 0.95 - 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_8 AUGUSTUS start_codon 720116 720118 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MALPRVLSVIGAGQMGIGIALVASLRAKIPTVLLYDRDPLQITKGLEFMDKLLAKDVSKGKTSEDDAKAARGRIISIT # SSSASSSTSNNDEFGWARELGERGSDMVVEAASERLSIKEGIFRALAKNLSKDAVLASNTSSISITKLAGAAVEGLGSTISKASEEGRSCAGRVVGVH # FFNPVPVMVSRHDLVDFRERR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 Scaffold_8 AUGUSTUS gene 721472 721768 0.99 - . g557 Scaffold_8 AUGUSTUS transcript 721472 721768 0.99 - . g557.t1 Scaffold_8 AUGUSTUS stop_codon 721472 721474 . - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_8 AUGUSTUS CDS 721472 721768 0.99 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_8 AUGUSTUS start_codon 721766 721768 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MSPIHGDAATGTHDSYDDVNGDDSYLASDGHEDIDDMQAYPSIEPYHDAENHHQIKNIAGDSPNNAGRDVNEFKVEDS # EAMIGHGEFFDADGDGIFSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 Scaffold_8 AUGUSTUS gene 722996 724265 0.76 - . g558 Scaffold_8 AUGUSTUS transcript 722996 724265 0.76 - . g558.t1 Scaffold_8 AUGUSTUS stop_codon 722996 722998 . - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_8 AUGUSTUS CDS 722996 723505 0.77 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_8 AUGUSTUS CDS 723609 724265 0.78 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_8 AUGUSTUS start_codon 724263 724265 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MSILTRILSNVSSSSNQPVEAIPGVLWSGSRDTAHAELDPVDLDDPSLGRLPKFSSSPPLTDDLGITDAERIRARLRD # LQNHQNELDKAADMTDLRALLSTALNAKNDFDMQKVLQVAGKDMPKAIRTLLGTLEGKGPHWKPTPGSAMRSANLKLPHTRAFTWPLDEKQGSVLDGE # HIESDIARLVQRTDTDLPSWTIGKYVYESISWDLSKAKYSSKQTTSRDTFLSELNVWKSLNHPNILRLYGASDSHSESIGPWFFISPYMRNGTLSEYL # KRLEWDGGMDMGTSMVSEVYGDSSVPDLLRFMEEIAIAMEYMHSAEVVHGDLKVCFAPLSWFTSPLPVFYTIYQGANVLLDNDLRCVLADFGHSKRES # EISYKNDKHARMFRSY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 Scaffold_8 AUGUSTUS gene 732347 733351 0.94 + . g559 Scaffold_8 AUGUSTUS transcript 732347 733351 0.94 + . g559.t1 Scaffold_8 AUGUSTUS start_codon 732347 732349 . + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_8 AUGUSTUS CDS 732347 733351 0.94 + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_8 AUGUSTUS stop_codon 733349 733351 . + 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MQRPLLNRQQAQNHIYSRGICFIYCYSSHFHWSYSDDQPLSPSESHGTFPGDLHPPSPAPSVSDGNFGMPLFQIVRSI # VLNCATIGFNPDYSAFVRTSGLFCAARRPYVEPIVQHDLGSMEYACSHCGALHWLSEKLPDSPKHSPQFRMCCKLGEVRIPLLQRPPEFLHRLFTSMD # PQAKEFRENISQYNSALAFTSVGVSIDDTVNQRGRGPAIFRIHGELKHWSGTLLPREGVAPSYAQLYILDPHTALAYCMQRNENLSHQTMEALQTLLT # TVNPYSHIYQHAYEVLRQYPDAQEFSISLRVMPGQDRRRYNLPTADEVAAIVPGDGDPSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 Scaffold_8 AUGUSTUS gene 735158 736228 0.81 + . g560 Scaffold_8 AUGUSTUS transcript 735158 736228 0.81 + . g560.t1 Scaffold_8 AUGUSTUS start_codon 735158 735160 . + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_8 AUGUSTUS CDS 735158 736228 0.81 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_8 AUGUSTUS stop_codon 736226 736228 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MTSVFTYVMICIIVWVLGRTNPTTEDIFDYGLYLLDRLLQESGHFLEDFAGMPLPIQDWTAQVENTFIAEQLDYDCES # ERERGEQDVAIMNPEQRIAFEQVMESVEMENGKLFFLNGPGGTGKTFVYKALCHAIRARGLITLCVASTGIAALLLPGGRTAHSMFKIPIEGLIDESF # CNIPKQSPRAELLRHTHAIIWDESPMQHRFAFEALDRTCRDIRNNECPFGGITIIFGGDFQQILPVVIKGSQEDIVSASLKRSYLWPLITTLKLSQNM # PLAQSGSDDGKDFASWLLNVGHGVNLTREDNMISLWNGMQVPSETSLIDAIYPDLALSNSSLPRILPRTSHSCTPEYRCEQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 Scaffold_8 AUGUSTUS gene 738121 739092 0.97 + . g561 Scaffold_8 AUGUSTUS transcript 738121 739092 0.97 + . g561.t1 Scaffold_8 AUGUSTUS start_codon 738121 738123 . + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_8 AUGUSTUS CDS 738121 739092 0.97 + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_8 AUGUSTUS stop_codon 739090 739092 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLK # EFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPT # MTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQP # RRQQISATAAPFTLFPNESVQIAASIPTPVAGPANRAPLIRTSPPKLDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 Scaffold_8 AUGUSTUS gene 739855 741306 0.88 + . g562 Scaffold_8 AUGUSTUS transcript 739855 741306 0.88 + . g562.t1 Scaffold_8 AUGUSTUS start_codon 739855 739857 . + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_8 AUGUSTUS CDS 739855 741306 0.88 + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_8 AUGUSTUS stop_codon 741304 741306 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MGESGDIGRTNRGSMVLSRVHYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGA # PATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGY # NNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFE # QQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALW # APDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHTPTSNSGAQHKTLPVDK # PDGPSIYHGLIFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 Scaffold_8 AUGUSTUS gene 742071 742916 0.45 + . g563 Scaffold_8 AUGUSTUS transcript 742071 742916 0.45 + . g563.t1 Scaffold_8 AUGUSTUS start_codon 742071 742073 . + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_8 AUGUSTUS CDS 742071 742916 0.45 + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_8 AUGUSTUS stop_codon 742914 742916 . + 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK # HPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 Scaffold_8 AUGUSTUS gene 756357 759262 0.96 - . g564 Scaffold_8 AUGUSTUS transcript 756357 759262 0.96 - . g564.t1 Scaffold_8 AUGUSTUS stop_codon 756357 756359 . - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_8 AUGUSTUS CDS 756357 758897 0.98 - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_8 AUGUSTUS CDS 759056 759262 0.96 - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_8 AUGUSTUS start_codon 759260 759262 . - 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MNLSSLMDALASYDDDTEELNVSSRNGQILVLTEIQKRLVESRKLTQRLTPPGASVLRSPHLNEPEVGKTKSLPDIKD # PLKHLDTLVTAAAWTATPVDTTTHQKLFMSSDEFYQDRVALSAQTSNSFNFQDAVESLEAVATVKATSSSALRPKRRFGKSSLPERQSASSQSRSRSP # SPTSIHRAGKIERDERREINRLSTRYEELHTQIFNENFATITADPYPQTALLDEATAFLKGGLKRLKDFDRKGKYRRQKGGSDELKEERRELSTRMRS # FYTKVYALYAPLIPTNPIPVDAGAFPFQLIFVIRLSETRQDHLYNADIVYLDEINQVLIILIVVCNMVMGLSTAQCNFLVAIAGILIKMAMATNGSSE # GSSTLLPSQNGVISDMPTSLSDALQKFDVDGVFIPYATCPSCNATTKGIPVEDGVYHWPDTCTNSIVEKEGARTCGEPLLICRKDGIPQPIKPYLVGS # LPDYIARCLLDPVYLEQSVRGTDAALQDIQRGIDAKQTAVHDVFEAEFIKDFKGPDGKLFVDRGNKVRLAFSIHSDFFNPNGITHRGAHDSIGVISCA # NLALDSSIRYLPENMFLAGIIPGPSEPKGDQMDHFIRPIIEQFVQAWSPGYKVSRTASSDVPVVVEAGILLSVNDLPAARKVAGFQGIRSGFICSICE # LRGTDQVFNTNHDHWNLRDVQELRHWANAYKNATNLAEQTKIWEDHGVRWSSLWLLDYWNPTTMLVIDSMHCLLEGLIQYHCRHVLRLDASSTKISSD # GLKYAFDWPWIPYDHDLVPNGCPRLSAKHIPRIANIHQTLCLALEGAQALTLDAMWTRLENGAPRDALRFVAHTLSLPTALNDIHEQISSTYVKRARK # HFTADKDAHQKIFPFSKPATQKNHFIALLLNWVSDTVQSRSNPVLKMISLVNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 Scaffold_8 AUGUSTUS gene 774851 775075 0.51 - . g565 Scaffold_8 AUGUSTUS transcript 774851 775075 0.51 - . g565.t1 Scaffold_8 AUGUSTUS stop_codon 774851 774853 . - 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_8 AUGUSTUS CDS 774851 775075 0.51 - 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_8 AUGUSTUS start_codon 775073 775075 . - 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MFESSYETSSSQEGASDMNSSGNAVAESSQSQPGYHRLKAGDNNQDFEYFSSDRSEIEEDTVKSEGLILATDSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 Scaffold_8 AUGUSTUS gene 780107 780757 0.86 + . g566 Scaffold_8 AUGUSTUS transcript 780107 780757 0.86 + . g566.t1 Scaffold_8 AUGUSTUS start_codon 780107 780109 . + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_8 AUGUSTUS CDS 780107 780757 0.86 + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_8 AUGUSTUS stop_codon 780755 780757 . + 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MNSNNYSKASEIFQEAVQRDGENSIIWCSIGALYIQVKQYYGALQAYSRALEINPYISEAWLGVGSLYERCDNQISDA # IAAYTRASALDPGNVMISKRLELLKTAHATGGQIPVASEPQDRKAHHHPPGLATSAGSPLAGPLDLEQPLPTSTTFLTTATTPRPPPGGANENNSQAA # PQPPSSPGTHSHPPSPPRDPKFWKRCSRFASRYVSSSYKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 Scaffold_8 AUGUSTUS gene 781677 782114 1 - . g567 Scaffold_8 AUGUSTUS transcript 781677 782114 1 - . g567.t1 Scaffold_8 AUGUSTUS stop_codon 781677 781679 . - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_8 AUGUSTUS CDS 781677 782114 1 - 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_8 AUGUSTUS start_codon 782112 782114 . - 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MTQNVLLECGVEGQSSDDTDPLADFEADSPVALYTSVPHYRRRVLSELFGDLDSKIRALKTRTARDIGKRLIRRPTRL # RIRGQFKTERTVVRKLPESCYHRRYIQSLDPVALDELGMKRTEIDIFDKWANTQADSDSDSNSMEED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 Scaffold_8 AUGUSTUS gene 782743 783344 0.8 - . g568 Scaffold_8 AUGUSTUS transcript 782743 783344 0.8 - . g568.t1 Scaffold_8 AUGUSTUS stop_codon 782743 782745 . - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_8 AUGUSTUS CDS 782743 783189 0.9 - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_8 AUGUSTUS CDS 783248 783280 0.8 - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_8 AUGUSTUS CDS 783330 783344 0.9 - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_8 AUGUSTUS start_codon 783342 783344 . - 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MITELQTQQEQALRQKTKLESEIRQLRMGNSSKGKNPRPGEATDDDGDAAMEADDEDENGLTSGRSETRSGSNASAPH # KDTNQSASGNSAPSVPGNPSTASASSTASLTIDVAAIVSETLRQLNQVPSSRGKQTAKEGSVAYARQIKKNGLSALPQKLEREWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 Scaffold_8 AUGUSTUS gene 801065 802368 0.31 - . g569 Scaffold_8 AUGUSTUS transcript 801065 802368 0.31 - . g569.t1 Scaffold_8 AUGUSTUS stop_codon 801065 801067 . - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_8 AUGUSTUS CDS 801065 801700 0.8 - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_8 AUGUSTUS CDS 801756 801919 0.75 - 2 transcript_id "g569.t1"; gene_id "g569"; Scaffold_8 AUGUSTUS CDS 802007 802249 0.4 - 2 transcript_id "g569.t1"; gene_id "g569"; Scaffold_8 AUGUSTUS CDS 802299 802368 0.41 - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_8 AUGUSTUS start_codon 802366 802368 . - 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MEQELSTPSKKNRIIPSESDALKEQANALFSSILHTEVTPPSPHRPSSPTRPPVASTSAAPPSTPTRRRLFAYSSPSR # SNPSTPSRRLDTPTDEAYSMSPVRAQKDFYLNLVDWSSTNVLGVGLGSCVYLWTAHNAAVSKLCDLAESRDTISSVSWVQKGSTLAVGTLSGTLHVYD # ASTLQLIRTYPQAHGQRIGAIAWNAHILSSGSRDRMVHHRDVREADTRPFKRCQGHKQEVCGLKWSGDGGPSSANLASGGNDNKVCIWDLRGSRRAAA # GLPNAGRPVPGTSSGDDAGAGDIPLWKFHEHTAAVKALAWDPHVSGVLATGGGTQDKHIRFWNTGTGTMLNELDTGSQVRFLVSGCCSVLTYDLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 Scaffold_8 AUGUSTUS gene 803992 804625 0.24 - . g570 Scaffold_8 AUGUSTUS transcript 803992 804625 0.24 - . g570.t1 Scaffold_8 AUGUSTUS stop_codon 803992 803994 . - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_8 AUGUSTUS CDS 803992 804512 0.69 - 2 transcript_id "g570.t1"; gene_id "g570"; Scaffold_8 AUGUSTUS CDS 804562 804625 0.26 - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_8 AUGUSTUS start_codon 804623 804625 . - 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MKDYIDELEIVIEVGAVSRAREETSLEHGGDVKGKMKAKDTPVVSPSSSRETIKPKSTSFNGPPTTIDSSRPLSTSSS # SGKPKSIPVPPSPSTRTDPHDLFNDDMPVEYASPKKKKTTKPQETPNTILRHVHNVDADEDEVPATPQPAGSKSKSAHSNSKGSSSEWEELALQSKSS # QEEGNTLGECSYLIELYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 Scaffold_8 AUGUSTUS gene 805979 806641 0.79 + . g571 Scaffold_8 AUGUSTUS transcript 805979 806641 0.79 + . g571.t1 Scaffold_8 AUGUSTUS start_codon 805979 805981 . + 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_8 AUGUSTUS CDS 805979 806641 0.79 + 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_8 AUGUSTUS stop_codon 806639 806641 . + 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MEQQPCFYSEDAYVTSGPSTPSLVDDSSSCKSPSPSLEEESFSAAEFAAEFLNLPEDLDCQDQSMDTVFDCSFAPSII # GDLMRPSDRKNMYEHIDTNIVSNGTSFALDLSALEHETSSLNPLFANTALPSFYPSLSLASYLSALQNLSAGAVPTFSTSLPAPMPSSSTSEGYCIPS # AVLSKSTRVFTPRDFLIPGFRQVESVPCSVPAVPFTANAYYPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 Scaffold_8 AUGUSTUS gene 808480 809162 0.56 + . g572 Scaffold_8 AUGUSTUS transcript 808480 809162 0.56 + . g572.t1 Scaffold_8 AUGUSTUS start_codon 808480 808482 . + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_8 AUGUSTUS CDS 808480 808625 0.57 + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_8 AUGUSTUS CDS 808676 809162 0.59 + 1 transcript_id "g572.t1"; gene_id "g572"; Scaffold_8 AUGUSTUS stop_codon 809160 809162 . + 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MLMTIFGLKHARRTPVGDASIRGVSGGEKKRVSIAEALATRMRLGSWDNSTRGLDSSTALEFGRALRIATDIDRLTTI # VSIYQAGETLYNLFDKVCIIYEGRMAYFGPANQARQYFIDLGYEPANRQTTPDFLVAVTDPLGRIPRQVVANRPRTAEEFAMRFKESHLGIANRKEIA # SYKQSAVLGHKSEKADAYRSSAAMEKAKHTRAQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 Scaffold_8 AUGUSTUS gene 810191 810673 0.34 + . g573 Scaffold_8 AUGUSTUS transcript 810191 810673 0.34 + . g573.t1 Scaffold_8 AUGUSTUS start_codon 810191 810193 . + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_8 AUGUSTUS CDS 810191 810673 0.34 + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_8 AUGUSTUS stop_codon 810671 810673 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MNFGILIAFGVAFLCALFIASELNTTLSEDTTRTLFQRGSKPSAIVTESGSDEEKGPSGHVTENVSQDVQEALHDAPA # MTEVFSWQSVNYTVPVSDGHRKLLDDVSGFVVPGKLTALMGESGAGKTTLLNVLAQRVSTGVVTGDMFVSGQPLPRDFQAQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 Scaffold_8 AUGUSTUS gene 810907 811896 0.43 + . g574 Scaffold_8 AUGUSTUS transcript 810907 811896 0.43 + . g574.t1 Scaffold_8 AUGUSTUS start_codon 810907 810909 . + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_8 AUGUSTUS CDS 810907 811118 0.44 + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_8 AUGUSTUS CDS 811398 811896 0.93 + 1 transcript_id "g574.t1"; gene_id "g574"; Scaffold_8 AUGUSTUS stop_codon 811894 811896 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MCGLEHMADAVVGTLGVEHRKRTTIAVELAAKPKLLLFLDEPTSGLDSQSAWAIMDFLRSLAKNGQAILCTAEFMLDV # IGAGATATTDRDWHEIWRKTPEAKVVQDSIQQIYEDGKNRPPVAATYHSEFATGWLNQFGQLVKRDMLFRWRDPTYLLAKLVLNIFGGLFIGFTFFKA # KDSQQGTQNKLFVSFFSPLHSNKKKKLIIAPFAGDLHGDYHLGSGCQPASSSFHKYAQDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 Scaffold_8 AUGUSTUS gene 815382 816446 0.95 + . g575 Scaffold_8 AUGUSTUS transcript 815382 816446 0.95 + . g575.t1 Scaffold_8 AUGUSTUS start_codon 815382 815384 . + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_8 AUGUSTUS CDS 815382 816446 0.95 + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_8 AUGUSTUS stop_codon 816444 816446 . + 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MSILRGVLFACSSVSTQGHHLPKAALRLKAKADKLLVHITDRKERADPYIPYDFSSSGALHPKINGINGRAHTRSPSV # ASPSSSKLPTITIKASSLAKAVTKVPRRDTSFEESPALIRTPEGMSMFRDLDRSLQEAGPSSSTSDIRTRMRELVPSEHEDEYDESAQLGDKRKVING # VNDHRAHKRIRFATPLPLSDSSPGSPTTISKDDELTQLWWSTVQSDALLPNGLPEFPSSASSSSSPRHPFLRPPIPKSPAQTAKKKKCRKKLPHSYRP # EDKPKALLTLMNNNVRTIKRVRHTHARFAALGLTKDSGVGNEDGEGAEAAPIFNAQTSSAVGPGPGLGTGRSGFRSNGCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 Scaffold_8 AUGUSTUS gene 817443 818645 0.89 + . g576 Scaffold_8 AUGUSTUS transcript 817443 818645 0.89 + . g576.t1 Scaffold_8 AUGUSTUS start_codon 817443 817445 . + 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_8 AUGUSTUS CDS 817443 818645 0.89 + 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_8 AUGUSTUS stop_codon 818643 818645 . + 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MSSLTIPKRLLRGKKKRTNLLPVYVSFFSCLVSLLHLIYVVGHSTKPTEPPPPFPPPPAFIPLTAGRIPEQIGLLQKF # YHDRLQAVAAPPAPAIPPLVPPLSHLPVPPLAPTAAWTLTKQPYPSIPSLPKPYIPPLLGPPKLPGGQPAPAHTPTPISNSLPPMHNTATHLPSNSLL # PPSGLPQEPSLSLQPPAQPFSPPPETIIPDDSPTPAQAKMSPLGHIVKTGSSYPAAKKKAKGASSAAAGAASNSNNGNKANTNAYSANVNTDVSNPLS # ATPNPPSAGETSNNRLVNGIVKPEFGSGPMNLNGNATSKPGASTMSTTIATGDPVIGPAPSPKKKKGATGVGSGNGRKKRMLDAAQGQTQAQAQAQAH # THPSQNQPGQGHGQDPRPPFPPFVAASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 Scaffold_8 AUGUSTUS gene 821112 821750 0.53 - . g577 Scaffold_8 AUGUSTUS transcript 821112 821750 0.53 - . g577.t1 Scaffold_8 AUGUSTUS stop_codon 821112 821114 . - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_8 AUGUSTUS CDS 821112 821750 0.53 - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_8 AUGUSTUS start_codon 821748 821750 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MSGIIVPGITFPLLQILDLVDWHDECESRFLNAITVPSLRYFRTNHTYHGGFVNESFASDMIDLQERSSAPLRTFELL # GMHELPVDDLLSILAVFPMLHNLGLNQCDLDTAPLMQGLEYCANKPLLVPRLQSFSFKNAQLKPKGSDRYIADMVESRNLIGDHDEQRPVDLHRISKL # TVIFEKQSLSHTVTKRLRNSGIRELTLADKAKKKVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 Scaffold_8 AUGUSTUS gene 824351 824558 0.54 - . g578 Scaffold_8 AUGUSTUS transcript 824351 824558 0.54 - . g578.t1 Scaffold_8 AUGUSTUS stop_codon 824351 824353 . - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_8 AUGUSTUS CDS 824351 824497 0.95 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_8 AUGUSTUS CDS 824556 824558 0.54 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_8 AUGUSTUS start_codon 824556 824558 . - 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MGAMTFGKEGTMGARVHDLKDVEAIIDAFVAHGHTEVRIFQSSHPADPT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 Scaffold_8 AUGUSTUS gene 827976 828137 0.54 + . g579 Scaffold_8 AUGUSTUS transcript 827976 828137 0.54 + . g579.t1 Scaffold_8 AUGUSTUS start_codon 827976 827978 . + 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_8 AUGUSTUS CDS 827976 828137 0.54 + 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_8 AUGUSTUS stop_codon 828135 828137 . + 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MFEHGPDAVYSDDDLSDGERSESSDAEHRPNVEDVDEFNIRGVQSTTSILELR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 Scaffold_8 AUGUSTUS gene 838815 840765 0.45 + . g580 Scaffold_8 AUGUSTUS transcript 838815 840765 0.45 + . g580.t1 Scaffold_8 AUGUSTUS start_codon 838815 838817 . + 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_8 AUGUSTUS CDS 838815 839001 0.45 + 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_8 AUGUSTUS CDS 839099 840765 0.98 + 2 transcript_id "g580.t1"; gene_id "g580"; Scaffold_8 AUGUSTUS stop_codon 840763 840765 . + 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MYDDSADDSSATLFPPSSTPAPPPRRRRAPPGKRRSLGYIPRPPNAFMLFRADFVKQKHVPNRSCWRSLPTEEKAIWE # KRARAEKAEHKRKYPEYRFRPVHNKNKTKSADSPSANKKTKTDSLPPPLASIEALRTEREGFIAQSLLDGLKGDALKEKVSWWDDAHGWDESAEGMAA # LEARAMTPHVQSNSDAFPARSAVPIARYPARRPSSVPLPNDFLPFQGGYQQTQQYLSQYSDAPFSHATETSHGLSMDLAGYNGTHVAQSSFHMLPPLN # ALRPPSPSPTNFNVGSISRQQRMVLGGRRASSAQAFVNYGRPEDSWAIPHTNWPDVHGQWVGANWQTGYGEGTGSSPSTSASSLPLQTETDELPEVDT # SLFQPGFAFGGSTFSIPSSQQPQPSPFDVQQQCNPFENYSMEQSNDFELVQQFLQEQQNQFHNPHNLSLPALDTHSYSPLDTSPLSSSSVQSYSPAYS # GSPPPSEKEQELVLHAPQPVHPASVEDVGLTYHEHDQSPAQSSTEDFQMQSSGSRSASASLLAPIDSAAAFDDLWKGLSSSGSFAAVMGFSIDSTVQQ # ADEFAYQQPSPVLESESGANSHEPGAFPRPGNDEFQQPVQTQHEQLTMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 Scaffold_8 AUGUSTUS gene 844424 846676 0.14 - . g581 Scaffold_8 AUGUSTUS transcript 844424 846676 0.14 - . g581.t1 Scaffold_8 AUGUSTUS stop_codon 844424 844426 . - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_8 AUGUSTUS CDS 844424 844787 0.97 - 1 transcript_id "g581.t1"; gene_id "g581"; Scaffold_8 AUGUSTUS CDS 844850 845092 0.34 - 1 transcript_id "g581.t1"; gene_id "g581"; Scaffold_8 AUGUSTUS CDS 845212 845621 0.43 - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_8 AUGUSTUS CDS 845708 846211 0.54 - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_8 AUGUSTUS CDS 846278 846676 0.97 - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_8 AUGUSTUS start_codon 846674 846676 . - 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MEPVGGPDAKKARWSPTFPQQNSSSNANSNRDAYANYGYGPQASISQSGYASSPIAPSPLYSTPSLSINTQAGGSMNP # QMSPNTANFPQQQQPSPNGSSPYGFGSYNMLGMGMPGMNMMGGFAYNGQMGGFPQQRLPSLTIPQGNPNGPQSAYSPVALSAALSASNNTTGRTVYVG # NLPATASVDELLNLVHFGPLESIRVLPEKSCVFLSFLDGATAAAFHADATIKKLTLHGQELKIGWGKPSPVPAQVALAISQSNASRNVYLGGLEENTT # EEQLRDDLSRFGLIDQVKIVRDKNIGFVVNTLPTEPAWAGKRVNYGKDRCAYIPKSQQAAAQQAQAAAAQSLVAQSAAAAAAAAAASSPQSAHPNNMG # NGVSSPFNPYAPFGAGDALQQAMAAASAVGMSGMGMSQGINRTVYLGNIHPETTTEDLCNAIRGGVLHLLPGCVLPRHDSEQSSLKIGWGKNSGPLPP # TLALAVHAGATRNVYIGNIEDFETFTEERLKRDFGEYGDIELVNFLKEKNCAFVNFTNISNAIKAIDGVKNKPEYGNLRIAHGKDRCANPPRSGPQGA # SGGRRTASGAGATGGEPVSAIDGAGFDAELTDAMVQQAADEEAMVAAGVVIAAPDEAQQMHVDGGEVSAPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 Scaffold_8 AUGUSTUS gene 847282 847746 0.48 - . g582 Scaffold_8 AUGUSTUS transcript 847282 847746 0.48 - . g582.t1 Scaffold_8 AUGUSTUS stop_codon 847282 847284 . - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_8 AUGUSTUS CDS 847282 847746 0.48 - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_8 AUGUSTUS start_codon 847744 847746 . - 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MSLAIRLNTVPFPSESTPSPLVLRPGPLHRRRGVDLGMTLQMPAPAQFGYGYAVGNETHTVAVTAAAAVFNTTERGIN # NNTSSTTIAGNNLYNPGTGRLGYASSSSGLFGSTASANASTTLFWSPASAAVGTKGPLQPHVSNLPRRKPTVKRRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 Scaffold_8 AUGUSTUS gene 852085 853777 0.52 + . g583 Scaffold_8 AUGUSTUS transcript 852085 853777 0.52 + . g583.t1 Scaffold_8 AUGUSTUS start_codon 852085 852087 . + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_8 AUGUSTUS CDS 852085 853390 0.53 + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_8 AUGUSTUS CDS 853515 853777 0.61 + 2 transcript_id "g583.t1"; gene_id "g583"; Scaffold_8 AUGUSTUS stop_codon 853775 853777 . + 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MCNINSGTCVLSTTVIMYLTDKIRPAFARTTGFLTIPVTILLVLVYLAVALSTLITDQLPSVPSASTLHSHYGGLNVT # EAYRDLQIIAARPHPYHSHANDIVREYLLQRLRNVRLQSGSRDNFIIDDDVITSGSWSSSFGVSGSGNYFEGNNILVKIRGTAETESSNLPHPPLPAV # LFSAHYDCVSTASGAVDDGIGVVTLLQLIQYFATHPPRRDVLFNINNGEEDGLNGAHILLEHPWIKNTSHIEYTNLFGSTFLNLEGAGSGGRPLMFRG # TDHGSVKSWRNVETPHANIISAEAFNLGLIRSSTDYTVYNSRFAAPDPLDAAKFAPLRGLDFAFYRGRSKYHTKYDALPYIEGGEKALWAMLQPASAG # GIALANDNNVSLDVNEKAVYFECTSSVDLWDTFVILKSNISVQFRSHPSTTRRSSYNQYHRTHQSAASQMLSPGGTVVEDTPSENEEDEPHESETGWT # KAKRRFNTSSRVLWKHGRYWVALIIAIGAQIALVVGFVNLNPFVSFEQGCLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 Scaffold_8 AUGUSTUS gene 853804 855573 0.89 + . g584 Scaffold_8 AUGUSTUS transcript 853804 855573 0.89 + . g584.t1 Scaffold_8 AUGUSTUS start_codon 853804 853806 . + 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_8 AUGUSTUS CDS 853804 855573 0.89 + 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_8 AUGUSTUS stop_codon 855571 855573 . + 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MDIPSIPILSSFALSILVLALVLSPPLINDHARIQVLSQAPITTNVPAWESFRTLVVHSYILSWLLVVLSTISITQFG # LGGILYMASACNGLTWLAAVICGIAGCFGVAETAELRLVHVFRDDTDVAEQEQEETEVNERTPLVGRKHLRVIKNKSKSGVDPVENPRPYVLWILVLL # IYVPFPLILISHIAIFLITSVSQTMIDGSPAVTVYAVISLISLIASLPAIPFIGARRVHRYLFWILGLVWVVCIALAWIPWSGPWAGSVEGFEGGLFP # FSEDAPLKVFFQQKVHLSPSGTDVNPTVRIVTTLTGATPFVHDLILPLIPSYLHSLANGRLVGCSDNNVDERKIGLANCNWETYNSNLPSFDALNMVP # VAADTLVVHAQKNHSSWDWASTINPWFEAYGKSMSFNETPGARFSIIGNNSRACRIYFDQPVERFRVRTVDVESDVEVNNEVDDEASWGVQRGFESDH # YNMLRLWTRAWGKKFVVDVQWSNQFSFAGQHATETNSSQKIFFGETTTHTGRVACEWAEYESGMVGMGLSTSPVPSSSGERFPSAKIPAFEEVLTYLP # KWAVVSKLTDGLVEVEEKFVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 Scaffold_8 AUGUSTUS gene 856529 857798 0.43 + . g585 Scaffold_8 AUGUSTUS transcript 856529 857798 0.43 + . g585.t1 Scaffold_8 AUGUSTUS start_codon 856529 856531 . + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_8 AUGUSTUS CDS 856529 856909 0.83 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_8 AUGUSTUS CDS 856983 857798 0.47 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_8 AUGUSTUS stop_codon 857796 857798 . + 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MYQPQSTGKGPIQPHVSNLPRRKPRQRSVGTFPKESPTLATPDAVKALSSASIRTNAARSPSPSRSSSSSLSISQPRG # PRAYFVDDEPSPSVAPIYTKPSVSAFELGHVIPQSKGHIQPHITNMPAGERWEKARCLQEVIKGSEVWVAFWDWENASEESDDEDQSDDSLAEELLRA # DRVIQIISREQEDQGYTEDSTASSGGVEDALKNVLKLFLSPQVVRVRDDGVPHTSLEQMSLARAFLSNIHPRRTDNSARATSTLISSVPPTPRTASTP # SLSRSSSSSTSPSPSSYTLTPSSTSSESRSNKRLLITVPSKEFAVDALALVVIAFSLLGDITSLATSADETESSVSPILEFLNSLNDLEGLDPHWRGT # LSCDGIDWLDGVLGMIKSSGGSNLEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 Scaffold_8 AUGUSTUS gene 858430 859458 0.75 + . g586 Scaffold_8 AUGUSTUS transcript 858430 859458 0.75 + . g586.t1 Scaffold_8 AUGUSTUS start_codon 858430 858432 . + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_8 AUGUSTUS CDS 858430 859458 0.75 + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_8 AUGUSTUS stop_codon 859456 859458 . + 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MAAPLTGTIASSPMIGNNKPENDNTVHVTNEIPHTSLSSQHLYKASEFALLTVLQKQQIFNVLIQSPSISCNKLRKLA # TLHVDLTTWDSQHQQKNKMKLLSDFAQHFCSNHCLIRQVQAETVGITHIPSISQSEFLECAKALKLRNYNETSAYKHKYEHKHFSQKKMKISHTSTLA # ANDVHFTSPVVDSEIWPEILSLNEKQAILQESYDAGSNASIRMIECSFCGTLETGMNICSIPCTDLDISLLDTAVHEIRLKTQQATIEAFRHETINND # CYQLCIQCKREVRYKTSIDNSEGHGKSQRSFVRLPLRSYANGTWTGDLPNALKGLTFLEEQCIARALS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 Scaffold_8 AUGUSTUS gene 860230 861387 0.96 + . g587 Scaffold_8 AUGUSTUS transcript 860230 861387 0.96 + . g587.t1 Scaffold_8 AUGUSTUS start_codon 860230 860232 . + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_8 AUGUSTUS CDS 860230 861387 0.96 + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_8 AUGUSTUS stop_codon 861385 861387 . + 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRAN # AMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 Scaffold_8 AUGUSTUS gene 862207 863298 0.85 + . g588 Scaffold_8 AUGUSTUS transcript 862207 863298 0.85 + . g588.t1 Scaffold_8 AUGUSTUS start_codon 862207 862209 . + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_8 AUGUSTUS CDS 862207 863298 0.85 + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_8 AUGUSTUS stop_codon 863296 863298 . + 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 Scaffold_8 AUGUSTUS gene 864296 865141 0.32 + . g589 Scaffold_8 AUGUSTUS transcript 864296 865141 0.32 + . g589.t1 Scaffold_8 AUGUSTUS start_codon 864296 864298 . + 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_8 AUGUSTUS CDS 864296 865141 0.32 + 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_8 AUGUSTUS stop_codon 865139 865141 . + 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK # HPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 Scaffold_8 AUGUSTUS gene 865929 867668 0.8 + . g590 Scaffold_8 AUGUSTUS transcript 865929 867668 0.8 + . g590.t1 Scaffold_8 AUGUSTUS start_codon 865929 865931 . + 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_8 AUGUSTUS CDS 865929 867668 0.8 + 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_8 AUGUSTUS stop_codon 867666 867668 . + 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MISILMQLLVNANQYPEHGIPIPLKSIIRTSSNSEGSSYIAQANSEQFNENVSSSGMLSSTVVDADHIDSTYQMRKLN # ALQQLKNGNSPFIKFPSGSIPLSTYKNPKVYAYLWPTLFPYGVGMMENDDVHCNSSVGFRHIDMRTHTAYLLQSRPNFRFQTHLSFIFVIGNILQRRQ # TSFNAKLAVKRSWFPRVEMLLGKLSNDTILEFSEKLKKNPFVHPETEGEKAAKQLMKYINYIGENIPGSMSEVQNMREELFSLVHTNGLPHVFLTLNP # SDTNNPIAQVLAGRNIDLDQIFHDLKLHSENLERSTCIAQNPIAAAQFFDISVRNLLDILLGTKRQNKKGVFGEVAVYYGVVEAQGRGSLHIHLLIWL # KHGLSPNEIKFKCESDPKWAQHLIDWYDDVFSQSIPNHTQEYIQTEGMYKRQPVMSRPMNPQISGYWYSFDQDLRNVLENAGMVHEHTDTCFKHLPIK # LRSLRNDDKDCRFQLPRDKVEKTHFDEDGYLVLKCNNGNVNGHNTIITVAERCNTDAKPIGSGSVAMAMFQYFGNYTIKNTMDTAFCFLLYVQQSKCY # LMTPLWILMGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 Scaffold_8 AUGUSTUS gene 867821 868171 0.9 + . g591 Scaffold_8 AUGUSTUS transcript 867821 868171 0.9 + . g591.t1 Scaffold_8 AUGUSTUS start_codon 867821 867823 . + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_8 AUGUSTUS CDS 867821 868171 0.9 + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_8 AUGUSTUS stop_codon 868169 868171 . + 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MLREIAPEVFDTADLHNDEESDINCNGNNIEDPETLQQNLPPREEFDCDSFVLLTEKTLKTGKFSSKSYIHNSLFNDI # FFRPDVLFDICAWDLMCEYSKEELPESKKQIKLTYDSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 Scaffold_8 AUGUSTUS gene 868304 868768 0.76 + . g592 Scaffold_8 AUGUSTUS transcript 868304 868768 0.76 + . g592.t1 Scaffold_8 AUGUSTUS start_codon 868304 868306 . + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_8 AUGUSTUS CDS 868304 868768 0.76 + 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_8 AUGUSTUS stop_codon 868766 868768 . + 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MLALFKPWSHNEQSPLKAPQEAWNTAFNTWKDTNLFKSHIRIINNMQLLYESKDAKLDYSAQRQKRLAELSHKLALEE # DDGESYLYDPEWENAMQVQVPATIDNDILQEVDNYNVVSQEVCHKVRSPYHFPFLTVSTPLLVRYIIPSLSNPIDY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 Scaffold_8 AUGUSTUS gene 869445 871671 0.32 + . g593 Scaffold_8 AUGUSTUS transcript 869445 871671 0.32 + . g593.t1 Scaffold_8 AUGUSTUS start_codon 869445 869447 . + 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_8 AUGUSTUS CDS 869445 870804 0.32 + 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_8 AUGUSTUS CDS 870902 871671 0.72 + 2 transcript_id "g593.t1"; gene_id "g593"; Scaffold_8 AUGUSTUS stop_codon 871669 871671 . + 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNVENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQEIYGTRTRPRPTPTDIRYGTRAILPISKRIRPNRVLDPNICSAPVAATPSPPNQDFSNQIGQIRELLDRANAMS # SSSSGFPTGFLKRVPASAAPRVPRNQFVMFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATPSGRITHFARLALTVDNQ # ERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENPHIEVPLEATLEPSESAA # VEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPA # TMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 Scaffold_8 AUGUSTUS gene 874866 876682 0.56 + . g594 Scaffold_8 AUGUSTUS transcript 874866 876682 0.56 + . g594.t1 Scaffold_8 AUGUSTUS start_codon 874866 874868 . + 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_8 AUGUSTUS CDS 874866 875806 0.57 + 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_8 AUGUSTUS CDS 875911 876682 0.9 + 1 transcript_id "g594.t1"; gene_id "g594"; Scaffold_8 AUGUSTUS stop_codon 876680 876682 . + 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MEATVQRGFYKGELDSSSKKQLQNSYSNCTRVATLLDKVAVEDSINSIMKKKEDLVKRRLEFIRKPDSQLHHRLPTSC # IPSPFATELNKEIEYAQKLFMKFHPNSPAWDELKFYQKLAIALINKHKLNDQQILAFLLLADTVGHQSLTDKPVEPLRMLVTGPGGTGKSRIFAAWSD # FHEGINCKDEFRLTAPTGVVASQIGGCTEAALRVARSTMKAETAGGQKIRSQLEKRFAPLRTLVVDEIYFMSPENISILSEYCSIAKGITEHPFGKLN # IITCGDPAQLPPPRAKPLFDHELVKCYESTHLNALNSKTHRLRTGTCTQVDKDILDKYVLSNDACSNETKSLIDITQWITNPERACPLITYTNAARDA # HNFESAKAFARATGQEFHVYHSTDTRGHGKNKKVIKGVAAEAAWRIPVKDAQDLGGKVPYIPGMPVFGTENIATELGLSNGSLGTLVSLTYEIHDDRY # YAVSATVDFPGYKSNDPIHPNRVLLKPITQSIKFHLPNSEKLYSATRKQLPLIPAFAFTSHNAQGRSMDVACIDFASCRSIQSAYVMLSRVRSLKGLC # IL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 Scaffold_8 AUGUSTUS gene 886606 887196 0.67 + . g595 Scaffold_8 AUGUSTUS transcript 886606 887196 0.67 + . g595.t1 Scaffold_8 AUGUSTUS start_codon 886606 886608 . + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_8 AUGUSTUS CDS 886606 887196 0.67 + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_8 AUGUSTUS stop_codon 887194 887196 . + 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MPLTKIAKTTSMSSSSSSSASKPPVIDLSPIDDASFFPPLEDDRGRNDRKPSFRRKISETLRSNSKPRNGRPVSSKGL # SSSLTSPPTSSSRDDSSFPVQMSLRRDSWSSAQAKYACRVVHPCRPPAVVSYFGFPFFTLVEGDVYQILQEAGHPSIHPKLPLYVDDGEDCLLLCRNE # VGTVGWALASFLEPIGVSIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 Scaffold_8 AUGUSTUS gene 888059 888417 0.6 - . g596 Scaffold_8 AUGUSTUS transcript 888059 888417 0.6 - . g596.t1 Scaffold_8 AUGUSTUS stop_codon 888059 888061 . - 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_8 AUGUSTUS CDS 888059 888216 0.63 - 2 transcript_id "g596.t1"; gene_id "g596"; Scaffold_8 AUGUSTUS CDS 888270 888417 0.6 - 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_8 AUGUSTUS start_codon 888415 888417 . - 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MCYVGSREKGQEYLAALASWDGEKSLLNEVNEKSFLHQQDSVAQVLRGKAGRQWFIRSALINSLPDDIIHQTVLKFDD # TPVGCSKQQYFLQNRQKFLITNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 Scaffold_8 AUGUSTUS gene 888606 889646 0.96 - . g597 Scaffold_8 AUGUSTUS transcript 888606 889646 0.96 - . g597.t1 Scaffold_8 AUGUSTUS stop_codon 888606 888608 . - 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_8 AUGUSTUS CDS 888606 889646 0.96 - 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_8 AUGUSTUS start_codon 889644 889646 . - 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MAPSNSKGKKPEITPSDVNSGKRRREEDDKLRKYHAASGSVAAFLQEPSRSDSPPPNVRRRLNKSTEGSHDNISDTNI # RVVQSPTLDSNVEAPDVSLGDDARNARSAHANDNTDSSNAPFDADPFGYLEERNSSGYPGRSNLQSTSRTLYDSWGSGSRSIGSSVAITTAPAVLHSI # PSQTQAIHTHAYVTFGAGMRQKEIDTFTANNPLRAQLISGGQDTVHITYLCAFPVVYSVVHQFDAVLFSAAHPAGSSIMLLGGFGFLGRLHGLSIDNL # VEVEMVLADGRIVIVNKDEHPGSHIYHTHLYISLSPKDLWWALRGAGPAFGVATRYKAKAYPIPVVFAGNLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 Scaffold_8 AUGUSTUS gene 892728 893681 0.81 - . g598 Scaffold_8 AUGUSTUS transcript 892728 893681 0.81 - . g598.t1 Scaffold_8 AUGUSTUS stop_codon 892728 892730 . - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_8 AUGUSTUS CDS 892728 893681 0.81 - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_8 AUGUSTUS start_codon 893679 893681 . - 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MRSPDTEINQVSFIPMTYIPTLEQPQPTDPLQSTNAVDNHERPSPHHAGPEERAGFRPSHDHDRISDSSSSPLSHSER # PPYRVRWGSSLPSHSSSNALPGRWDTPLPHPPLHTSSSINPPPTTNPPSTIPPPPMYPFNMTPLWSSNGPPLRSLPNPPLYYSNQSTPWYYTPHPLPA # NPVTPYTLPPMTPNPIIAFTPRSTYGPETETAFSMNHTPSRMHQTPSGFDTPANATPSTHNSMYRPTPEAPRRRTQSLEPEETTYERYQPRDNNDRRG # PPNNSASATPFYQRSVNDQPHNRFYLIDGNVEFRVSIIVFRGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 Scaffold_8 AUGUSTUS gene 898661 899089 0.62 - . g599 Scaffold_8 AUGUSTUS transcript 898661 899089 0.62 - . g599.t1 Scaffold_8 AUGUSTUS stop_codon 898661 898663 . - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_8 AUGUSTUS CDS 898661 899089 0.62 - 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_8 AUGUSTUS start_codon 899087 899089 . - 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MNITFDSNPKHLPLAGVANVEQFVLSKTSAMTKILQEKSGVPKSRMERPFFTLLEDHMGLGESDIRAITNAKPNYKWY # HKFRRVEGWEDHLKWLAMPREGEEETVTEDTLVILNAGAHVRLQSVSLVDNKVANQVVYSVVAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 Scaffold_8 AUGUSTUS gene 909174 910037 0.32 - . g600 Scaffold_8 AUGUSTUS transcript 909174 910037 0.32 - . g600.t1 Scaffold_8 AUGUSTUS stop_codon 909174 909176 . - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_8 AUGUSTUS CDS 909174 909775 0.74 - 2 transcript_id "g600.t1"; gene_id "g600"; Scaffold_8 AUGUSTUS CDS 909986 910037 0.33 - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_8 AUGUSTUS start_codon 910035 910037 . - 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MLPKIQGRFGYAPLVFCDSSRTFTTGLPSRTEYITPQPTPPAVDTFHHFENPEDLAVENLSQNPEYDGEATPQYESDP # ESDFIDPATVQGRNWIADTNDDATTWEMHSNEIFRTGSVTYHRPRIHQSRHGRRRDIEEQPSIGNIRAEINKYSTPPGSGKDPSAAVIVVPRISRVDP # TRPLVMEEPSASHSSDVVHPYVRSMFLIAWHLLTDEFVHRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 Scaffold_8 AUGUSTUS gene 915712 916431 0.68 - . g601 Scaffold_8 AUGUSTUS transcript 915712 916431 0.68 - . g601.t1 Scaffold_8 AUGUSTUS stop_codon 915712 915714 . - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_8 AUGUSTUS CDS 915712 916307 0.69 - 2 transcript_id "g601.t1"; gene_id "g601"; Scaffold_8 AUGUSTUS CDS 916377 916431 0.68 - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_8 AUGUSTUS start_codon 916429 916431 . - 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MTLTFDVISEAPLETTEFDVPINVGWGSKQTQFHGSLGKTAAQASTSNMLVGCSPDDNIPRISWRGDGACFAVSSITT # AGSYPHRILRVYDHQAVLQSTSESVPGLEHSLSWRPSGNLIASTQRFGFDGGGAGRDGRHDVVFFERNGLRHGDFELRPADGLVPLPSQALNLRWGYK # VKDIKWSSDSNVLAIWIGRDHASDLGESAFCYDVGTHCGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 Scaffold_8 AUGUSTUS gene 917812 918063 0.95 + . g602 Scaffold_8 AUGUSTUS transcript 917812 918063 0.95 + . g602.t1 Scaffold_8 AUGUSTUS start_codon 917812 917814 . + 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_8 AUGUSTUS CDS 917812 918063 0.95 + 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_8 AUGUSTUS stop_codon 918061 918063 . + 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MSDSPSIETDQARDEVKTWIRDQMAAGILPTTPEDTQHSRRNAKQTDWGEKFQTKFKEKEILGDMDDGKDDFFEEDEG # EEEEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 Scaffold_8 AUGUSTUS gene 919700 920179 0.98 - . g603 Scaffold_8 AUGUSTUS transcript 919700 920179 0.98 - . g603.t1 Scaffold_8 AUGUSTUS stop_codon 919700 919702 . - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_8 AUGUSTUS CDS 919700 920179 0.98 - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_8 AUGUSTUS start_codon 920177 920179 . - 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MASESGERSDVHIQYQVSVELGSPFTANKFLNFHSDSMFDRRIDIRTTFPLNFSSSLYDSPESDTNSQLDDSEEDITE # DVNEDTQCIYIPSTSPFYHPPPKARPFASSSSNVSFSCDALAEDGSFQKQPVTSFCESLSQASDEWSEDEDRKRSVPSPET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 Scaffold_8 AUGUSTUS gene 925119 925716 0.51 - . g604 Scaffold_8 AUGUSTUS transcript 925119 925716 0.51 - . g604.t1 Scaffold_8 AUGUSTUS stop_codon 925119 925121 . - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_8 AUGUSTUS CDS 925119 925545 0.83 - 1 transcript_id "g604.t1"; gene_id "g604"; Scaffold_8 AUGUSTUS CDS 925610 925716 0.53 - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_8 AUGUSTUS start_codon 925714 925716 . - 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MIISSMCNTQPRATWCCRYHPKRAFYGSQSTSFSIGAETAMLIASLQDTLRSQSQEIEDLRKQLQQQQQQQKPVANED # EVPLSLSIPLSLSKVLTQISALKSQVSSLKLALQASDEKQKEMERERKEAEKEQEDLLVLLDEVTAKRKRDKGKMREAGLGAEVSEDEVDEEDGEDGD # D] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 Scaffold_8 AUGUSTUS gene 930798 932473 0.66 + . g605 Scaffold_8 AUGUSTUS transcript 930798 932473 0.66 + . g605.t1 Scaffold_8 AUGUSTUS start_codon 930798 930800 . + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_8 AUGUSTUS CDS 930798 930851 0.96 + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_8 AUGUSTUS CDS 931229 931544 0.97 + 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_8 AUGUSTUS CDS 932095 932317 0.71 + 2 transcript_id "g605.t1"; gene_id "g605"; Scaffold_8 AUGUSTUS CDS 932374 932473 1 + 1 transcript_id "g605.t1"; gene_id "g605"; Scaffold_8 AUGUSTUS stop_codon 932471 932473 . + 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MALSIDTSFDDIVTIHKYVEIAVRNGYRHLDLAMIYENQDEVGAALKKVIPSVVKREELFMTSKLWNSSHQPAEAEKE # LDQTLSQLGVDYLDLYCALTVSYSYLVNLLILISYHYSDPLASRVLVGKPKLTDYPAILEIAKTKNATPAQIPAWGAYRGYSVIPKSVQEERIKSNFQ # QVTLTKEEYEAISAVGKGNHTRFNIPYNYQPRWDINIFGEPEEKDASNPVNIGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 Scaffold_8 AUGUSTUS gene 938098 938466 0.52 - . g606 Scaffold_8 AUGUSTUS transcript 938098 938466 0.52 - . g606.t1 Scaffold_8 AUGUSTUS stop_codon 938098 938100 . - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_8 AUGUSTUS CDS 938098 938466 0.52 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_8 AUGUSTUS start_codon 938464 938466 . - 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MKLTKFAVLVSLVALTAQSVSAANVKVADPVDASPATDVTATAPSPVASSTYVDVELLDPSASNGTVNVKVPLPGFSK # ELYSSLVAGSESTLSSAACIPPGSFCTWATGTAAALRAASYSRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 Scaffold_8 AUGUSTUS gene 941521 943179 0.72 + . g607 Scaffold_8 AUGUSTUS transcript 941521 943179 0.72 + . g607.t1 Scaffold_8 AUGUSTUS start_codon 941521 941523 . + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_8 AUGUSTUS CDS 941521 943179 0.72 + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_8 AUGUSTUS stop_codon 943177 943179 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MSSSHNSSSHLMRRLVPKTLRGSRQNRTQIRTESPTTNASATLPFVSHTPTLPAAAAAMPALFPSEVQSDIFKNEPRS # APHPPIRPPRPPTLSTGDPIVTYHTNFLGLFSGDGETPIATTVPPKLTDLVPPMQVHPAEHDYDTSVPGETPATSRANRAPGVPRAKVIEDFDYVGGW # IADAGGKQQYVSRGHIEEIEEDAERDVGIPSGSYPAGLSAIAGPSSRFLDALSLPASTTPPPRPMLSTKRDLPLSQSDSGSNNHPFHHPFFTKHKPLA # TTRQFAASPLSQSVSSLAHMPLRGFTSLHHTGGQGPTGPEQNTFFGPSASHDTDVDMQYEPLPVGSPPFDPLADSLSSLPGLRGFAPFTPNTERISEE # NITSTPEPFEHSTYPAFESLGHSLDSISPAQQADRSEKELPLPPSPTSQIPLPHPVLGTEAEGPMNPTLPTPAPLPHIGDLGDPIIILPLHESTPPRN # PNRNGRTSGKNNAQPGDARNRNKKEKENRNDEPIEETEQRISTSIKEIVGIVRGVRGVSSETYFNHDTLPSSLLFLLLIALR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 Scaffold_8 AUGUSTUS gene 944841 946493 0.79 + . g608 Scaffold_8 AUGUSTUS transcript 944841 946493 0.79 + . g608.t1 Scaffold_8 AUGUSTUS start_codon 944841 944843 . + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_8 AUGUSTUS CDS 944841 946493 0.79 + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_8 AUGUSTUS stop_codon 946491 946493 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MSQFLLPSRIEGPIWLSPVEKAVLHKQVAMINQEIASLDSQKDIQLALLASVQNILSPARRVPNEVLAHIFDDVLYHP # ENSKKYYVQRSIGKTLYTLSRVCVVWRYVAHTTPRLWSTLCLSIPKHMSALVGDLEWVEEWLMRSKGLPLDVYLILPQNIKHWPGCESWFNKTCDSLV # DRLHKFLEKIINEPAHHRNRVSSLILIGHSTFFSPLLKLPASSLPGLKRVFLQVTKDFSASLTQVKAFLGAPKLREVEIIEPYEESQLKTILLPAGQL # INLKLMPGPGVVNSMFDPLIYKSFLQQCRNLVSLEILPPMNPIVPRYNFPTEGYIFLPVLKSLIFACSSSIWYSGISFLQCFIVPLLEDLDLDYGDIE # FHDFCEIITKFQRQSGYIPNLRSLTVKLGSMDNTVLIPVLDFFPRINSLQLVGINFDVNFLFEAMTYNPSTEQNSLPVPKISTLELVFKMNNWDNSYP # SKLLSMILSRTLPDGPGELQVDTGAATRGKKIRHEVGVGVHRLQRVSVCGSELEKAPEDVAHIAEIPSTTIYSECWDCVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 Scaffold_8 AUGUSTUS gene 946839 948008 0.75 + . g609 Scaffold_8 AUGUSTUS transcript 946839 948008 0.75 + . g609.t1 Scaffold_8 AUGUSTUS start_codon 946839 946841 . + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_8 AUGUSTUS CDS 946839 948008 0.75 + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_8 AUGUSTUS stop_codon 948006 948008 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MRRSAVSLCRLYDLQSGIDLLLDECFAQVLMTDVHAAVVISQKFTSPNSSFTGNISCMYTFSLMRDAAVCQFEMIESI # KEFTLSSDSSVKPSSTSTSVPISLFNTSDALDINAPTPDSQPTGPPPIPPKPNPTLPLTPRIQQSPLPSHIPSIFPGTRTQVYVIIHTPKDNTGVNAV # IKEIKVRGVVTTTGDVVELTVPVLRVLDIPLPSFDTMLTSLFIHTLAAKALIKDCEQGTHSFPTPVSVLFEATSAESFINGPRVKELKDLKEAYLKKD # IVQLGMEYCVASQYTSFVAVDRRRSSVSSRGQEQTVTLNQIVPVVFADPLQAETTDGSVQAVGGSMLGINGRADGGGESHLMAIDLIPMDIRARRRVM # LRVEPSLKIYWTASLRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 Scaffold_8 AUGUSTUS gene 948301 948498 0.62 + . g610 Scaffold_8 AUGUSTUS transcript 948301 948498 0.62 + . g610.t1 Scaffold_8 AUGUSTUS start_codon 948301 948303 . + 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_8 AUGUSTUS CDS 948301 948498 0.62 + 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_8 AUGUSTUS stop_codon 948496 948498 . + 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MAGDVGATVLALVWMGRYRYSKASGTAGVMDDDDDDDDETMDMRIKAEEWVKGQFGGGEHAEKRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 Scaffold_8 AUGUSTUS gene 951495 952748 0.14 + . g611 Scaffold_8 AUGUSTUS transcript 951495 952748 0.14 + . g611.t1 Scaffold_8 AUGUSTUS start_codon 951495 951497 . + 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_8 AUGUSTUS CDS 951495 951972 0.14 + 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_8 AUGUSTUS CDS 952216 952748 0.22 + 2 transcript_id "g611.t1"; gene_id "g611"; Scaffold_8 AUGUSTUS stop_codon 952746 952748 . + 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNIGDINLPFAADVPKTDR # NYLQALKPKVEDEFKDLLGIKLESFPRGIDGRKQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSN # QSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 Scaffold_8 AUGUSTUS gene 953022 954042 0.38 + . g612 Scaffold_8 AUGUSTUS transcript 953022 954042 0.38 + . g612.t1 Scaffold_8 AUGUSTUS start_codon 953022 953024 . + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_8 AUGUSTUS CDS 953022 953544 0.4 + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_8 AUGUSTUS CDS 953663 954042 0.72 + 2 transcript_id "g612.t1"; gene_id "g612"; Scaffold_8 AUGUSTUS stop_codon 954040 954042 . + 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MKEQDRSMRTLRSAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPS # VTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLNG # ETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAV # TPEINNKDEEIESVLDQGSQIVVIDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 Scaffold_8 AUGUSTUS gene 954081 954917 0.66 + . g613 Scaffold_8 AUGUSTUS transcript 954081 954917 0.66 + . g613.t1 Scaffold_8 AUGUSTUS start_codon 954081 954083 . + 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_8 AUGUSTUS CDS 954081 954917 0.66 + 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_8 AUGUSTUS stop_codon 954915 954917 . + 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVG # TYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENEFKRKFSFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQETFSKKELSEAYVLASREHL # KSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETT # TESM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 Scaffold_8 AUGUSTUS gene 954994 955329 0.59 + . g614 Scaffold_8 AUGUSTUS transcript 954994 955329 0.59 + . g614.t1 Scaffold_8 AUGUSTUS start_codon 954994 954996 . + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_8 AUGUSTUS CDS 954994 955329 0.59 + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_8 AUGUSTUS stop_codon 955327 955329 . + 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE # TNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 Scaffold_8 AUGUSTUS gene 955532 956086 0.72 + . g615 Scaffold_8 AUGUSTUS transcript 955532 956086 0.72 + . g615.t1 Scaffold_8 AUGUSTUS start_codon 955532 955534 . + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_8 AUGUSTUS CDS 955532 956086 0.72 + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_8 AUGUSTUS stop_codon 956084 956086 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTI # FYEMKYHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 Scaffold_8 AUGUSTUS gene 956331 957440 0.8 + . g616 Scaffold_8 AUGUSTUS transcript 956331 957440 0.8 + . g616.t1 Scaffold_8 AUGUSTUS start_codon 956331 956333 . + 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_8 AUGUSTUS CDS 956331 957440 0.8 + 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_8 AUGUSTUS stop_codon 957438 957440 . + 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGSTCRTHQMNPWVKWPPMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 Scaffold_8 AUGUSTUS gene 957558 958797 0.88 + . g617 Scaffold_8 AUGUSTUS transcript 957558 958797 0.88 + . g617.t1 Scaffold_8 AUGUSTUS start_codon 957558 957560 . + 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_8 AUGUSTUS CDS 957558 957563 0.89 + 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_8 AUGUSTUS CDS 957682 958797 0.88 + 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_8 AUGUSTUS stop_codon 958795 958797 . + 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MITDELLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLP # FDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMV # VIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGED # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 Scaffold_8 AUGUSTUS gene 959057 959578 0.14 - . g618 Scaffold_8 AUGUSTUS transcript 959057 959578 0.14 - . g618.t1 Scaffold_8 AUGUSTUS stop_codon 959057 959059 . - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_8 AUGUSTUS CDS 959057 959473 0.23 - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_8 AUGUSTUS CDS 959564 959578 0.14 - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_8 AUGUSTUS start_codon 959576 959578 . - 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MFLLTQAYQSCSCSSRIFNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQ # DSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 Scaffold_8 AUGUSTUS gene 970486 971136 0.91 - . g619 Scaffold_8 AUGUSTUS transcript 970486 971136 0.91 - . g619.t1 Scaffold_8 AUGUSTUS stop_codon 970486 970488 . - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_8 AUGUSTUS CDS 970486 971136 0.91 - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_8 AUGUSTUS start_codon 971134 971136 . - 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEECSSSKSSMNKPKVFKGKDGAEARCFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTKMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKRQSNGPYRWMSTCTIPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 Scaffold_8 AUGUSTUS gene 978456 978773 0.84 - . g620 Scaffold_8 AUGUSTUS transcript 978456 978773 0.84 - . g620.t1 Scaffold_8 AUGUSTUS stop_codon 978456 978458 . - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_8 AUGUSTUS CDS 978456 978773 0.84 - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_8 AUGUSTUS start_codon 978771 978773 . - 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MVELYFAEQSAIQASPTASGSMSVDSASTPDDMLQAPIDINSPTTSSGLSVSSNLGAIPESPLYHPSIHPPTTIGSQK # ITTAEQTYTSDFLDYFAGGTSWLNSSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 Scaffold_8 AUGUSTUS gene 986469 988447 0.22 + . g621 Scaffold_8 AUGUSTUS transcript 986469 988447 0.22 + . g621.t1 Scaffold_8 AUGUSTUS start_codon 986469 986471 . + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_8 AUGUSTUS CDS 986469 986782 0.42 + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_8 AUGUSTUS CDS 986914 987341 0.23 + 1 transcript_id "g621.t1"; gene_id "g621"; Scaffold_8 AUGUSTUS CDS 987453 988447 0.77 + 2 transcript_id "g621.t1"; gene_id "g621"; Scaffold_8 AUGUSTUS stop_codon 988445 988447 . + 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MSLQPQPSHTSLSSVTSLSRYASAKSPSIDPYNGNPSRDFCNSFWGGDGDAGVNVLFARMRGGVRTIEGLKGFWKERA # AIEEDYAKRMGELAGVDFGRDEIGWVTEMEDPAAAMLNKLSDHKRLVMSAVEKRHKAKLQAEVYVAKAREKYYGDCVRIGVCRQQLQQLQENPNSGDL # DKVRSKLKRLEQTVAANEKDYAAFTKSLADSLPAWESEWRSFCDGCQDLEEERLDFMKDNLWAYANSVSTVYRDILAFVQEYGTGSSIPNPPEFVPFP # ASTMDPSSNPTSSQLSTTISTHPATFSRKSRKSGVPPAAPPYVAAQTGSSANPSSHPASHSGHSGPSASSITTAPTTAPPVPPPNVPPPSIPAPTMPT # SSIQQRGGGATPSSTSSPARVSPGSQQPATTNMNNAVSSPPRNTSSSPQQQRDQRDQREPNHQQRDQRNGYSNLNPNGHSNAARERGDQQSDSLTSRQ # QQTIQPTASTPATLEQRRLTLPPQPTDNEVAAPIPPVPTMGTGGSTGGGAGGERNKILFYGEFRGLFLSNVCPSLSSLLYLPLHSLISFNSFHSQRVS # LSNSMAIRMK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 Scaffold_8 AUGUSTUS gene 991014 991361 0.95 - . g622 Scaffold_8 AUGUSTUS transcript 991014 991361 0.95 - . g622.t1 Scaffold_8 AUGUSTUS stop_codon 991014 991016 . - 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_8 AUGUSTUS CDS 991014 991361 0.95 - 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_8 AUGUSTUS start_codon 991359 991361 . - 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MCFIADYFQQNEIELRDILNALHARGFQTNRGYMDAGPVLSAWHNASGYYLSSASLIYNKIHLTLGFADVGASQLIAD # GKIKLKSGGNIAKIAADKVLFDDGSHLEADVIIFATG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 Scaffold_8 AUGUSTUS gene 997047 997403 0.82 - . g623 Scaffold_8 AUGUSTUS transcript 997047 997403 0.82 - . g623.t1 Scaffold_8 AUGUSTUS stop_codon 997047 997049 . - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_8 AUGUSTUS CDS 997047 997403 0.82 - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_8 AUGUSTUS start_codon 997401 997403 . - 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MDIDATHTSNGILGKHSWPACGDDALAVVLKVMSSKTAHTKKLPAATVDIEDIWKQSARTSSWDSDETEADASNLGAS # RYQLRDPRHSPWSQDNDREVKIRDQALGVWLFIHNPVCEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 Scaffold_8 AUGUSTUS gene 997500 998120 0.98 - . g624 Scaffold_8 AUGUSTUS transcript 997500 998120 0.98 - . g624.t1 Scaffold_8 AUGUSTUS stop_codon 997500 997502 . - 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_8 AUGUSTUS CDS 997500 998120 0.98 - 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_8 AUGUSTUS start_codon 998118 998120 . - 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MLTPIPPATPAPPASAEDLMTQLIKQVANLATAMEERLSSKSSMNKPEVFKGKDSNEARRFRAQFQNWASEQPDLSNS # QAKLIKSALGFFTEGAGDWATPHLLNFNAENPPFEGDWQKFLTEFSQQFESIDPGMEARNMIQSLKQSKGQTVAEFAQKFQDIGSRTEMSDIDLRERF # YSALLPEIRQNLITVNIGQGVARTLKEAIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 Scaffold_8 AUGUSTUS gene 1002219 1003220 0.95 + . g625 Scaffold_8 AUGUSTUS transcript 1002219 1003220 0.95 + . g625.t1 Scaffold_8 AUGUSTUS start_codon 1002219 1002221 . + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_8 AUGUSTUS CDS 1002219 1003220 0.95 + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_8 AUGUSTUS stop_codon 1003218 1003220 . + 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPP # FGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGL # SRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATRAPLIRTSPPKLDK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 Scaffold_8 AUGUSTUS gene 1003337 1007044 1 + . g626 Scaffold_8 AUGUSTUS transcript 1003337 1007044 1 + . g626.t1 Scaffold_8 AUGUSTUS start_codon 1003337 1003339 . + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_8 AUGUSTUS CDS 1003337 1007044 1 + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_8 AUGUSTUS stop_codon 1007042 1007044 . + 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 Scaffold_8 AUGUSTUS gene 1016273 1016758 0.65 - . g627 Scaffold_8 AUGUSTUS transcript 1016273 1016758 0.65 - . g627.t1 Scaffold_8 AUGUSTUS stop_codon 1016273 1016275 . - 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_8 AUGUSTUS CDS 1016273 1016758 0.65 - 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_8 AUGUSTUS start_codon 1016756 1016758 . - 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQGIFIPTYDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFTYNNAPNASTGITPFFANKGYHPNITVWPPRSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 Scaffold_8 AUGUSTUS gene 1017526 1019997 0.3 - . g628 Scaffold_8 AUGUSTUS transcript 1017526 1019997 0.3 - . g628.t1 Scaffold_8 AUGUSTUS stop_codon 1017526 1017528 . - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_8 AUGUSTUS CDS 1017526 1018635 0.93 - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_8 AUGUSTUS CDS 1018712 1019064 0.36 - 2 transcript_id "g628.t1"; gene_id "g628"; Scaffold_8 AUGUSTUS CDS 1019706 1019997 0.73 - 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_8 AUGUSTUS start_codon 1019995 1019997 . - 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MARLPEPATLADYQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNSQPSGSSAPFTPKPKPFSG # GKPNNNGKPQNSSNSGQSGVLGYSFLSRYNPLIDWASRNITFHNTSHFDSPQTSVPSANNPVVAKVAVPLPELSPSVSPTILETPPGDSLRSRPRSRS # RTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVNIALRSRPAPPTAPPLHPSIPEEYAEFADVFDEIAPDSLPEHRPYDLKIDLEEGALPPLGRIY # PLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLCLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGD # EWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYI # LSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFWVFANFHRRFIYNYSDIVVPMTWLTRKGASWIWDSSCQEAFENLKTAFTSAPILAHWEPKSPTYRGD # RRLRLRHCGYSFHPIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 Scaffold_8 AUGUSTUS gene 1032152 1033095 0.65 + . g629 Scaffold_8 AUGUSTUS transcript 1032152 1033095 0.65 + . g629.t1 Scaffold_8 AUGUSTUS start_codon 1032152 1032154 . + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_8 AUGUSTUS CDS 1032152 1032618 0.72 + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_8 AUGUSTUS CDS 1032756 1033095 0.69 + 1 transcript_id "g629.t1"; gene_id "g629"; Scaffold_8 AUGUSTUS stop_codon 1033093 1033095 . + 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MIGCLRANYAVHPISTRNSPEAVAHLLEKTNASHLLVGVEESIQELAKHATKLAASNITVSCSLMPSFEDIYDPLQEF # KELSYNRPDPDAPAVILHSSGKFCNKNLIYVGSEPRIPGTKAFPKPVVWTHFRLLQLSTVPCKKIVTPFSIAKTSLNLLIQATSGLIMAAFKPQQPAI # QPSPDTVIAGSIATKSDILFVSLHLLRFALLKFEYVFRLCTKFHSKVLVPQARICGTYEKYTWFGEEFLSSCSPNSDNQKALWWGSIEQTCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 Scaffold_8 AUGUSTUS gene 1036635 1037825 0.89 - . g630 Scaffold_8 AUGUSTUS transcript 1036635 1037825 0.89 - . g630.t1 Scaffold_8 AUGUSTUS stop_codon 1036635 1036637 . - 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_8 AUGUSTUS CDS 1036635 1037825 0.89 - 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_8 AUGUSTUS start_codon 1037823 1037825 . - 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MALSQSEFPLELYLDFPRDNSECVTEEEEEEEEGFTTYSDDKTLVQEIHDLLNQILGHYPYLNRIRSLELSGDSLFFT # PVFLLPSMSLQGVEKACMHIADYFHDGVQPPIREFLLGSKLRHVEIVDSYLESYLVIFMLPAEQLVDLQIVVTSSNLGFDPFVYADFLRRCSSLVRLA # INPPSCSQYNSPITERVSLPMLKSLDFTFHGSSGDDEFPGVSLLHILAVPLLEEMSLDLRRIELEDFATDMTALQGNSLTPNLKSLTLELGRIHDDSN # DLTSALALFPTITSLRLNGILFDMNPLFKAMTYNFRQSNTDSVLLPRIANLELEYRRDTTSSTPSELISMMLSRSSVADTEFINLLKRVSILRADCLK # KTDEDLTRIAELPDSVIYSESRDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 Scaffold_8 AUGUSTUS gene 1038739 1039347 0.49 - . g631 Scaffold_8 AUGUSTUS transcript 1038739 1039347 0.49 - . g631.t1 Scaffold_8 AUGUSTUS stop_codon 1038739 1038741 . - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_8 AUGUSTUS CDS 1038739 1039347 0.49 - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_8 AUGUSTUS start_codon 1039345 1039347 . - 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MLKSLHFTFHLPSEGDETPGVNLLHILAVPLLEEMTLILGYVEFHDFSRDLTALQGNSPTSNLKSLTLEMNWTFKAID # ATDLASVLLLFPTITSFRLLGIQSDLNPLFQAMTYHNLNDDSVTLLPMILNLELEYRKKTRYPSELISMILSRSWQNGHQPQTGAGLVARLQQVSILR # AGHLQKTDEYSVRIAEVPDSVVYSES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 Scaffold_8 AUGUSTUS gene 1061422 1062640 0.21 - . g632 Scaffold_8 AUGUSTUS transcript 1061422 1062640 0.21 - . g632.t1 Scaffold_8 AUGUSTUS stop_codon 1061422 1061424 . - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_8 AUGUSTUS CDS 1061422 1062020 0.76 - 2 transcript_id "g632.t1"; gene_id "g632"; Scaffold_8 AUGUSTUS CDS 1062119 1062581 0.51 - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_8 AUGUSTUS CDS 1062638 1062640 0.37 - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_8 AUGUSTUS start_codon 1062638 1062640 . - 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MGIDIPDIGIVVQYGSPQSLSTWYQRAGRAVRDLSLQGTAVVLVEPKFFDAEKHAAFKAARQAENVSKQAAAEAARVR # EALMASASASEAYVHAGKPKRKRGAGDTSMRKKGRPESQPEVTDLKTCETDIFGYPIKIERAMDDFINAENRPGKCRQRHVNTSCCSRAGCSPPAITH # CCNICEPEYSPFLTNEHIPTSRPRMKKLKDYTRGEAEVELRRVIAVERDAWFLWKLGPHAMLMPEALWPDSVVDAIVDWAHEGKLDTVESFCNLITWA # YAEELAPKLLEKIQAYTPSLPAPPPPPLLPPSPFISYRTSPVINEFTRINTKQVFRPENCTGTLQSLSNRGSLQYVECSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 Scaffold_8 AUGUSTUS gene 1068708 1069228 0.4 + . g633 Scaffold_8 AUGUSTUS transcript 1068708 1069228 0.4 + . g633.t1 Scaffold_8 AUGUSTUS start_codon 1068708 1068710 . + 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_8 AUGUSTUS CDS 1068708 1068903 0.4 + 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_8 AUGUSTUS CDS 1068963 1069228 0.62 + 2 transcript_id "g633.t1"; gene_id "g633"; Scaffold_8 AUGUSTUS stop_codon 1069226 1069228 . + 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MENSALEQLKVDLLDILEGEAIESGYHRPELSMNRSVEFEEGDPRRSTPAVPDEVDGEMLGDVDVDVSVPSMPASPST # PDYEGLPELFAPQPPPPQPLQHVPIPIQPIHDQDIGPRRSTRIRGPSARQLQFQESAEREHSALERNLLGPKTPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 Scaffold_8 AUGUSTUS gene 1072326 1074410 0.15 + . g634 Scaffold_8 AUGUSTUS transcript 1072326 1074410 0.15 + . g634.t1 Scaffold_8 AUGUSTUS start_codon 1072326 1072328 . + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_8 AUGUSTUS CDS 1072326 1072923 0.47 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_8 AUGUSTUS CDS 1073319 1073458 0.2 + 2 transcript_id "g634.t1"; gene_id "g634"; Scaffold_8 AUGUSTUS CDS 1073601 1074410 0.27 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_8 AUGUSTUS stop_codon 1074408 1074410 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MKAELGSYWLSGYQSITDPRNGATEQFPFYVLEFWTQVEETTKMQESWGKAIQYVERQKEKVSDTGPKAVLAKAWEML # HAIGWNECLPHYNMYTTALIGFLGSGWLSGDQIDLMVGHMSMRLEAQGSKSRRRVVIAPLAFANKIQNPFIQNSLRKVGEVQDTVLKHFETVIVEDRI # EVLYAPVHVNGNHWIAVAVDFGRAKPSRRLCLVDLLNPIASIPSNIGSTAELSGSSESDDDSESDNDCYPKGESRSAVHSMKIRQSQRDGTFVVTNAR # LASWKNGLQEMDSGVECRDNGIDFCHSKCRKWYKAKQAYDLTRARAHMKTCSLSSTKSKTTQAILSSHKITAFFQKSSAPLPSMKTSKPNLLPKMVAC # CGLTASYDPRIETYLSRTGYSGGGGTNVAEIAKTLFNMTFSTLDEEQRQKVITTQELSQTWENKHHLVPPAVYSRRCTKETLDLSPHLPLPCNECLTV # YKSRAFKNAIRRQKPSAKNLFIPTTDFGLKYWVKFTLLVLGQRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 Scaffold_8 AUGUSTUS gene 1085827 1086500 0.52 - . g635 Scaffold_8 AUGUSTUS transcript 1085827 1086500 0.52 - . g635.t1 Scaffold_8 AUGUSTUS stop_codon 1085827 1085829 . - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_8 AUGUSTUS CDS 1085827 1086143 0.57 - 2 transcript_id "g635.t1"; gene_id "g635"; Scaffold_8 AUGUSTUS CDS 1086290 1086500 0.78 - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_8 AUGUSTUS start_codon 1086498 1086500 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MREFNARWNTTTKSSEIIVSDNDSDSVTSGIESTMHKFDHLATYGDSQDPRTYHYDPKRYGSESYDLLDKAYTADSPV # LEIENHIVDSAQEKPIYDAAALLATNMELKCRLKDSEDELASVKAHVDELENKLHLWKEIFNRMGVISTSVADGSFEADKVLDSLNRHLISEYRETQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 Scaffold_8 AUGUSTUS gene 1095813 1096159 0.48 - . g636 Scaffold_8 AUGUSTUS transcript 1095813 1096159 0.48 - . g636.t1 Scaffold_8 AUGUSTUS stop_codon 1095813 1095815 . - 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_8 AUGUSTUS CDS 1095813 1095949 0.79 - 2 transcript_id "g636.t1"; gene_id "g636"; Scaffold_8 AUGUSTUS CDS 1096096 1096159 0.48 - 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_8 AUGUSTUS start_codon 1096157 1096159 . - 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MALNKGVGKKYIKEMFEEFDHKEISKAQMEGYTYDPNWKDSLNSGNEPIGSPKLPRASVQDSEKIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 Scaffold_8 AUGUSTUS gene 1115841 1117940 0.99 - . g637 Scaffold_8 AUGUSTUS transcript 1115841 1117940 0.99 - . g637.t1 Scaffold_8 AUGUSTUS stop_codon 1115841 1115843 . - 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_8 AUGUSTUS CDS 1115841 1117940 0.99 - 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_8 AUGUSTUS start_codon 1117938 1117940 . - 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MVYLDDIVIYSRNQEDHGHHVEQVLTALDKEKLVLNLDKCTWAEDELLYLGHIVSGNGIQVNPDKVRAVLEWPTPSNI # TELRGFLNLAGYYRRFVRGFAKTALPLTNLLAGSPKKGSAINWSTDCDAAFKHLKRALTNTHILIHPTPWHVFVIDSDASGNCLGAVLQQSLTPFKDL # DKGRDDSKSESRFEFKEKDLRPIAYESRKMTPTEQKYSAQEREMLAVVHALKKWRAYTEGSPVLVRTDHESLKYFLTQKHLGRRLARFHDDVAHFDVK # ILYRPGTSQIAADALSRREGHADVPDKDYEPLYSFPLDMDPNDRSAIFNTLEKYRKDLLAGKVSGDTERYSVHGQKLFKDISTNNNEDSQIVLVPTSV # TEALMVVKSLHIDLGHLGMNSVLEALRSRVWIPYGSEMVEHIVRTCNECQFTKRDITPSQPLFPLPRTSAGDVYAFDFIGPLPKTKRGNQYILTAMEL # GTNYTFAKPLVQRSADAVIHLFRSIIAMFGKSKAVLTDNGEEFMSYAFQNLLQRMTIKHLHTTPYHPQTNGRLEKFNDTLVQMLARFCAPDRQDQWDE # YVPDVLLAYRAHRNPSTGASPAYMMYGFEPRLPQDTVFDTVRVPPSDTKFKSSKKNALNMSKTWNDSERNPTHKHWHDLKKKRRGEKMGIQKEDLVLE # TWFCERMNVSQRFILVGMDLSLFAIQRTKILTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 Scaffold_8 AUGUSTUS gene 1117979 1118830 0.95 - . g638 Scaffold_8 AUGUSTUS transcript 1117979 1118830 0.95 - . g638.t1 Scaffold_8 AUGUSTUS stop_codon 1117979 1117981 . - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_8 AUGUSTUS CDS 1117979 1118830 0.95 - 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_8 AUGUSTUS start_codon 1118828 1118830 . - 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MTIVAPNTGVAVRIKPKQISGLKKRELYHTESRSAGYTPLPAEEFTYTEDEDVASIEAVIDEQESMQALSIKSPISST # PALTNSNLDLHNTIEEKQEERKSEVKSRTTFGKKLKDFALNKFPGLFRKKVGYPPARKWVHEIDTGPAQPVQVRGRPHSPRENEEIKKFLDNAEADGV # IEPSDSPWSAPILLIPKKDGTLRPCVDLRALNNLTRKNAYPLPRIDECYVNLHDATIFTTLDLKSGYWQVRLSEDAKPKTAFTCRLVTTNFESCHLDL # PMLLQHFNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 Scaffold_8 AUGUSTUS gene 1118956 1120479 0.96 - . g639 Scaffold_8 AUGUSTUS transcript 1118956 1120479 0.96 - . g639.t1 Scaffold_8 AUGUSTUS stop_codon 1118956 1118958 . - 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_8 AUGUSTUS CDS 1118956 1120479 0.96 - 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_8 AUGUSTUS start_codon 1120477 1120479 . - 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MAEVIEQLRAVLPPEMFEVITPIFTGLAHRLTESENRVAELQQGHISMEQLSASFREALSHNPSPPVQPVPPPQVHPA # TARAPLRTELPIFRGRPEDNARAFTSIAKDLLQATHISLDDWGVIISGCFRDAALTWYLAKKQENGDKPLTWDKLEKDLLAQFDNPSRTDDIRTKLVK # CNYKNNVSDFITQFQKLEMQLPPTEMTFGDRKFNFFRSIPYDLCFHIANSQPASMAEVYEAARIWERHHRISGRTSDPRRNHPSHTSNSSNHPSSATL # TPARSHVSSNDPTPMDLDTFSLRPMAPKNDKFKFRCYNCNKPGHYSKDCRLPDRRKERFNGNSQGPIRRTPQSMFFMGESLSLRPGIHRAARKTHPYQ # LPLLIRRTAEKSATPAKASLQEVDSFLQACKPESKPLISKPAQNEVFTFSFDDDQNIGLPVYLAMLYGPRLPNKPWKHEAILRAFGISDTGAHWNYIT # RKSAELVRAKIFDLVEPRTLPVLAIQSRNLSVVSGSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 Scaffold_8 AUGUSTUS gene 1125009 1125773 0.75 + . g640 Scaffold_8 AUGUSTUS transcript 1125009 1125773 0.75 + . g640.t1 Scaffold_8 AUGUSTUS start_codon 1125009 1125011 . + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_8 AUGUSTUS CDS 1125009 1125027 0.75 + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_8 AUGUSTUS CDS 1125145 1125773 1 + 2 transcript_id "g640.t1"; gene_id "g640"; Scaffold_8 AUGUSTUS stop_codon 1125771 1125773 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MKVSSISLKKPPPGNKKQKNKGEFVNEQLNAAMKGIDVNDEFPVTSATGQLKGTTSADCLLSELTSEVSTPLEGVDPT # PIGTESFAAPSDDKIEKFRPAAAPFVKSKPKLIPLVRIPDPAEPVQLTTPEAVSIAGELIAAASDANAGPEQFPQGPAAESNEKQLYCPECYLPLHPD # PVPEKLYIFLHALRYTTSLGTFETEMPAWSAEGFTWDMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 Scaffold_8 AUGUSTUS gene 1141806 1142846 0.97 + . g641 Scaffold_8 AUGUSTUS transcript 1141806 1142846 0.97 + . g641.t1 Scaffold_8 AUGUSTUS start_codon 1141806 1141808 . + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_8 AUGUSTUS CDS 1141806 1142846 0.97 + 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_8 AUGUSTUS stop_codon 1142844 1142846 . + 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MITTPVIKPTVRLNTPSAVKIASNAWGSQGKTVATPPSTTHGPTPASVPVKPPQGAWGSRRPAVTTPVSTKAWGLPKS # FAVSPSSTSSAPLSAPPAISTAVPSVPPGLIRDSASGSSSGSSSFDWASEVEAELPIHFNPNLNNLAGNTDTLDISNTMAKVLGFDEDEDIDPEDQIA # STFVDVDVPPGLGLPTPAVQYDTTQETVKQNLWEDVSPVEESKEDECPVHGVLCSKGICQVAKKKKRQQANEQKNKDGRTGSSRNRGRGRGWRRNGGE # RNSRSNEGDHDDNNNNGMCCSQTKERPTELMMIQITGRPATTTATRMVTFAILIVLRTRAPLGVVLYLERTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 Scaffold_8 AUGUSTUS gene 1159715 1161411 0.6 + . g642 Scaffold_8 AUGUSTUS transcript 1159715 1161411 0.6 + . g642.t1 Scaffold_8 AUGUSTUS start_codon 1159715 1159717 . + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_8 AUGUSTUS CDS 1159715 1160117 0.6 + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_8 AUGUSTUS CDS 1160240 1161411 1 + 2 transcript_id "g642.t1"; gene_id "g642"; Scaffold_8 AUGUSTUS stop_codon 1161409 1161411 . + 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MSTGSSLRPMSTTSSTSCISSGSSAASVRWDEAGLETVKELRRKEKETKRQSIEDAEADAKRKKANHESRRHSEGRRR # TPITDVFPDAQEDFPGPAAFVRTVSDGAPLLTLEEATSDGHERMSEDELSTPMKCARVISILSAATNDLAQLINHLDLEATPGATPGKSPDASPWRRT # AGFQSSDTNQDSPTKKTLRGTMTSISSLRPYAQYRELTTAKPANSQDLLDQQIAPWPVLNSYLPQNEVPAKEASSVTTSKVRGMHKRTMSPSGYLPEA # SPPPPLRPLRPAKSRNVVASFNLLPLGPPPSIDLPVQPLSPVNAGRAPSSLTFGSRSSSRGGESSISSLNDIHSRNPVFKPTHGHNRNRSSLLSSQPG # GGSQGSIPEENFTTSRPLSVEARRQLGMKGTMGGSDVSAYAVDDLDTSDPDSDIPDELQVILANQSPRTSVHSIEDHTSFRSLDSPDAPQDVSSLVDP # ESEFESTGGREVVDLPVFHLIDVDDNHADLDDMLDVDETTRRNVRFHRRTREIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 Scaffold_8 AUGUSTUS gene 1161564 1162487 0.91 + . g643 Scaffold_8 AUGUSTUS transcript 1161564 1162487 0.91 + . g643.t1 Scaffold_8 AUGUSTUS start_codon 1161564 1161566 . + 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_8 AUGUSTUS CDS 1161564 1162487 0.91 + 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_8 AUGUSTUS stop_codon 1162485 1162487 . + 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MDSSKSVELTNSSISSQEAHYGGSTQATSSSLEIFPISRLLDAKEPTLLPGSDSISSTDSRDLPDTFAPKVLESSVSS # ASRPSDGELNKSFKFGGFTKSLSQEVELEKPISFSDIIPSPSRVRALSNASSYVDDSVINSIIAKASEVPAARQLNDSTGKRNARDNSIMQSLANITY # RHSRHDSTNSFNGFDSFEEVRRGFEFHDYRPSFYPPPVSNSTGSRRNNHSKQESMMSFASISSYGHVVNAGVPDPFDYGLPSLRERPSSEEMTSTSFS # MSIDDTFSFLKHAPPRKRVESDASSFYFNASGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 Scaffold_8 AUGUSTUS gene 1162516 1164028 0.66 + . g644 Scaffold_8 AUGUSTUS transcript 1162516 1164028 0.66 + . g644.t1 Scaffold_8 AUGUSTUS start_codon 1162516 1162518 . + 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_8 AUGUSTUS CDS 1162516 1163398 0.66 + 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_8 AUGUSTUS CDS 1163448 1164028 0.85 + 2 transcript_id "g644.t1"; gene_id "g644"; Scaffold_8 AUGUSTUS stop_codon 1164026 1164028 . + 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MSVVSQGPPISLYNRSFGHRRNDSSTSVSSMAHSYVIHGANGGRAAWAHHRQDASIDSVDSQFSARQLGRPGIGDKMF # DTAANFGAPLTSISASPPGSSYSQSCSSFDSIMDDEPRSSVDDSLFDKTGHRTSLCSESVFGYDGSSRYAQGHLLPQNAFRPVSYLSINSIHSPSKDD # DTMISVRVSFICLSRLTDMLQMIGGGHVRRRSVGSVIEASPIVRAVGHLGKRKHVAFGSVKDGSDKGHVRIIEKASIDSTSSSKFGGERMIRATKGLL # ERQSLEESCLIAEGEDLSASYSVPVFTRPSPTTRSRSSTCTSSSSGVDTPPLSASDGSSISGGSQSSIDLAQINRILANATHPISNIALQRDRARARG # EGHRRRISQARMSRSSVYETIEEEIYSPGDTPLSQSTASKKSSPTAIQPVFIVDPADNASIHSIDSWDEERGIVALRRYHELRSEAEYTVSESRRLWV # DTPFSIYALQSKASIYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 Scaffold_8 AUGUSTUS gene 1167945 1168301 0.65 + . g645 Scaffold_8 AUGUSTUS transcript 1167945 1168301 0.65 + . g645.t1 Scaffold_8 AUGUSTUS start_codon 1167945 1167947 . + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_8 AUGUSTUS CDS 1167945 1168301 0.65 + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_8 AUGUSTUS stop_codon 1168299 1168301 . + 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MSSSHYSKSVHSTRSHRDSDIESWGTAYSDSRTPTPTHTSSNYAQPSGAYSHRSNPSYPSPSYGPSSPFGGFSASLAS # YPQTPGTPYLGSVPLPQQYVDTAAPQTPYLSTIPLPGGKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 Scaffold_8 AUGUSTUS gene 1170637 1170948 0.77 + . g646 Scaffold_8 AUGUSTUS transcript 1170637 1170948 0.77 + . g646.t1 Scaffold_8 AUGUSTUS start_codon 1170637 1170639 . + 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_8 AUGUSTUS CDS 1170637 1170948 0.77 + 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_8 AUGUSTUS stop_codon 1170946 1170948 . + 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MEKVSSVYQRNVGFGHEILNRTIDRNRTKDEQDDHYSSSPRSKQSQREYSSAANLMGDIKVSGPNAFTYANNFKIHGG # DVSAVGGNQTVSELASNISDPNDNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 Scaffold_8 AUGUSTUS gene 1175680 1175871 0.83 - . g647 Scaffold_8 AUGUSTUS transcript 1175680 1175871 0.83 - . g647.t1 Scaffold_8 AUGUSTUS stop_codon 1175680 1175682 . - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_8 AUGUSTUS CDS 1175680 1175871 0.83 - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_8 AUGUSTUS start_codon 1175869 1175871 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MGFIQSGKDQGATVVLGGDRNGTEGYFINPTIFTDTTPDMKIVQEEIFGPVGVVIKFEDEEGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 Scaffold_8 AUGUSTUS gene 1189793 1190624 0.49 + . g648 Scaffold_8 AUGUSTUS transcript 1189793 1190624 0.49 + . g648.t1 Scaffold_8 AUGUSTUS start_codon 1189793 1189795 . + 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_8 AUGUSTUS CDS 1189793 1189795 0.49 + 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_8 AUGUSTUS CDS 1189908 1190624 0.92 + 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_8 AUGUSTUS stop_codon 1190622 1190624 . + 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MKKRKGDEYEPDTSIGRSTSSLKKLKTDDAAVGKSCSSISYPGIWLIYRPLAPAPATKSRKSSKSAKSEDAKKLDVSK # DLKSPLPKPAKKSIQDTTSSSSSMNQSKSKSSPTTSQPLNSRVRSVPTPIGQSISTPSQSNAVFHVPPTQKAPASEKGSVSSNSGPRPSVKPSTGSQG # SNPTAPTAQLTQVPISNVKPSAQSVIPRAGLLPVSMHHPRHHYSDGSIIVIYPTQNSSFIEVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 Scaffold_8 AUGUSTUS gene 1197810 1198436 0.29 - . g649 Scaffold_8 AUGUSTUS transcript 1197810 1198436 0.29 - . g649.t1 Scaffold_8 AUGUSTUS stop_codon 1197810 1197812 . - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_8 AUGUSTUS CDS 1197810 1198436 0.29 - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_8 AUGUSTUS start_codon 1198434 1198436 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MSAYSQASASTRIHKAWEDDTQIPPIPKIPSYLYNAYIAPEVADENTSLARGNTTKVAALLKSRARRAQRGKPLTRSS # TKISRIERSDSLEYIPFTPRTKHTEAERLHRDASTLGTKSPAPSEAASLTIRNPFADTSSSSRSTSVTTSIASHTIHTVDPPYYAHRLSVIDNEEAET # ESLYADEVPTFPATIDTPPLRISKNQVSNARS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 Scaffold_8 AUGUSTUS gene 1200753 1201142 0.42 + . g650 Scaffold_8 AUGUSTUS transcript 1200753 1201142 0.42 + . g650.t1 Scaffold_8 AUGUSTUS start_codon 1200753 1200755 . + 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_8 AUGUSTUS CDS 1200753 1201142 0.42 + 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_8 AUGUSTUS stop_codon 1201140 1201142 . + 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MIRMAKTKSRHNGADEEEIDVEDSRIDVESPEVERKRKRTAGDEDPDDPNPEKTPDQSPSRGLSNSKKKAKGRQEIFP # GGGRRGVSSGLSTIVRKGGGGSTTDSDRPKTQWWKELGNAGSSGLKGSLRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 Scaffold_8 AUGUSTUS gene 1201621 1202608 0.21 + . g651 Scaffold_8 AUGUSTUS transcript 1201621 1202608 0.21 + . g651.t1 Scaffold_8 AUGUSTUS start_codon 1201621 1201623 . + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_8 AUGUSTUS CDS 1201621 1201962 0.33 + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_8 AUGUSTUS CDS 1202018 1202608 0.36 + 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_8 AUGUSTUS stop_codon 1202606 1202608 . + 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MHFSIPFLTRSKNLTVTDQSEDSGVTIDDDARTMDELLENDDNVFEELPVETRRRLLRWKLAVYFFTGVIFILLVTLV # VIGIQPRSGKELEEPGDDEPVWDDDSEHIADDPRLEKYQTPSDTTFCAPWPLTAAESRSSLNLDTKTSQVSFDIPANSDLIFFISRGQPTKGHLTVTS # NRMRRLETIAVNVTAEYDHRGHLEQTKACYSENDTEGGIMIWVCVHRHSLCDIRNKTLLFTQAKDIDSSLLPSFNISIELPWSSFRDFSTDLSGGAYT # QSFGDFFDLWSPNGFAVVRLKGGNETIRSLVSMFAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 Scaffold_8 AUGUSTUS gene 1202916 1203308 0.95 + . g652 Scaffold_8 AUGUSTUS transcript 1202916 1203308 0.95 + . g652.t1 Scaffold_8 AUGUSTUS start_codon 1202916 1202918 . + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_8 AUGUSTUS CDS 1202916 1203308 0.95 + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_8 AUGUSTUS stop_codon 1203306 1203308 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MASDFNAVKLNASLHTTNGVLNVTMPRMPFLDPDYKFIIDASTTNAASSVFLSPDFAGTFDLRTSHNGKTQVRWDSGM # RDPWGKGRKHKLDMAHYEDVHKSGKVYWGDEAPETMGDIRVKTTQENVWLYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 Scaffold_8 AUGUSTUS gene 1208677 1209431 0.86 + . g653 Scaffold_8 AUGUSTUS transcript 1208677 1209431 0.86 + . g653.t1 Scaffold_8 AUGUSTUS start_codon 1208677 1208679 . + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_8 AUGUSTUS CDS 1208677 1209154 0.86 + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_8 AUGUSTUS CDS 1209232 1209431 0.96 + 2 transcript_id "g653.t1"; gene_id "g653"; Scaffold_8 AUGUSTUS stop_codon 1209429 1209431 . + 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MLTALQKHHDGFSLFDTGNTTNRSAVVLGPKRDLLKELFDAAAEKPHIHRGTYYSLPEWFNPDYAKYGFGEWPGGLAR # NPFNTTPAFEPYTGHLNISDYIEDLQYPQMLNLATQYNTEIMVRSAKSKNTVSKCGTQWCDIGGPNNTLEFAAEFYNHAFASCGAVPDFNTPEYETFN # SIQTSSWESSEGMDPFSYGLNTATNANEYKNGTTIVQTLVDIVSKNGNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 Scaffold_8 AUGUSTUS gene 1210174 1213499 0.49 - . g654 Scaffold_8 AUGUSTUS transcript 1210174 1213499 0.49 - . g654.t1 Scaffold_8 AUGUSTUS stop_codon 1210174 1210176 . - 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_8 AUGUSTUS CDS 1210174 1212701 0.76 - 2 transcript_id "g654.t1"; gene_id "g654"; Scaffold_8 AUGUSTUS CDS 1212755 1213499 0.49 - 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_8 AUGUSTUS start_codon 1213497 1213499 . - 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MLQIKPLPPPPPTSKVILNKEPSSSMIISDRDKGKGETPLDSLSSPRLLSASERRVLFHPEVISGRTSENLSEVHTEE # EGAASDDEADAVDLVGGRKKLPVVSSPHISDRKHPHIIMESDADSDRSGSTLSSPVFAHTENDSPFSDGPARSYGYSNGQFGGTSEWRRKGIKINSST # TLKRGGMWYKEEDEGNTEVDTSYVVVSGADDNAEGPSSTKGSNTRQNLTSQNSGKKLDPESEWVVLDLGDDFAFKSFLRVIHRHAPHVVDSSFLSNLP # PFQMPKSSNVPAAPAPTPTFPSSFPTPEQAMPPSFARWSWSTQNQERRSSPDEVSPITLSAKELNQSSSSPLARIEAPTEVISNPNSSWVNDTPAGTQ # SLVSPITAPKDSRQFRLPPSPRLLATMSNTQNSSTHTSSLLNSTLGRRQSETKQLNILSSQQKNSLGTFGALPYPEWRLEVVTKAQRAGMGELTKAMD # QFLWGDNPGLAQLTRELGLRIAPMELIRSPSIQSAAGDRIFDNEEGDSAEDAISMRRQRKRKDRKLTLEQENIAIGLKFPGGGNLSSRTLIDSGQQIA # LVSTTNISTSSSDILRPSLRLDYVDIDSSESGEESSDAEWVGWMADLHRQARLHREENARLDRLETESLASSTDTNDYWDYQQQDDHRRYQEERRALE # PTGVVTSSSPYTIPTSPNTILTSPLVRQKEVGLPQYASSTSIPSETTINCVPGSTASVGTSAVTPTFQRPATPDNILVVGGPSFLTSPSSNESLNRPH # GRRLSFGLSPSDPPSSATSPSLSQAGHSVEMTLLEHQQLNSRSNKHTRQISGMVRDGPNLSHYASTGLIGTTSELLELELQNSSLTSARRPSMPILGS # TSFATQPDKPPTPPLIPDFHHTGTTLGGLSAESSRLAAGAKLARLIGSDKSYDHTVAVTIPRRSSITGSVSSVSLGRSSSKAPGLLRKKGSENAKGRN # IMEKREAGHNQDREMLFVQQKEKSRKGKGKEREIDKIVQDHSGEDKSRRQRLSLPLSNSLTHTHVSTSKMLSPLPTSPVLPSRDIRRTKSGQRLREEI # PVIKKEKKRGLVREKAERLLQNLESKLDFVDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 Scaffold_8 AUGUSTUS gene 1213915 1214889 0.76 - . g655 Scaffold_8 AUGUSTUS transcript 1213915 1214889 0.76 - . g655.t1 Scaffold_8 AUGUSTUS stop_codon 1213915 1213917 . - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_8 AUGUSTUS CDS 1213915 1214889 0.76 - 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_8 AUGUSTUS start_codon 1214887 1214889 . - 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MGYEEDDEWDSQEDESDIDELELELDTNPRMGRRANRNQYLGFYDRPSIGQRSVLPPSVASRILPSKTRVNPASLPRG # SHTTYHPNFLNLIRFSTGQILEKHYTIVDYDIQPYELLEVHRLGVVTKLPREITSKYIEPYWEGWVKALRLVFREPHVVTEVRSLAREGSSRRKDASV # EEVSKAASSHAETARRTMEVLAGGPVKVASFSPADVALGLRPPPSSRVKMKKDRHSVGNDLDIHTSMWKSTKLSNSNYHDMASLSRNATAPTSKSSLT # QNISNNRHRSKGKGGKLEWRERWVFIKDGVLHLKKENSVSFILRLFDPFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 Scaffold_8 AUGUSTUS gene 1224938 1227661 0.49 + . g656 Scaffold_8 AUGUSTUS transcript 1224938 1227661 0.49 + . g656.t1 Scaffold_8 AUGUSTUS start_codon 1224938 1224940 . + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_8 AUGUSTUS CDS 1224938 1227661 0.49 + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_8 AUGUSTUS stop_codon 1227659 1227661 . + 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MDLTSRNPNSLDLSSIGFNSSQPSSPSSPLRSTYGLGDLRAISRRAWSKSADDLSKLSADVSPAMEEKIAQYRNRSNS # NTSPLSPGGPPSAPPFFERSLSHGTGVQPFPSLPRINTPSSATPTVSISISAPVIDEAAHKPAPSPTHVHTRSYSFTPKLASKLSAPRFMPPSPKRKG # SAGSEMEGTSTPPVPTRGAFPFSSSSRTLLPDSSSSSSTSQPVHRSTTLLAPPNIVEPFNESSESSSPKRASQIVYHSGFINKFADGTASPHQLGTAK # AWKPFKLELKGSKLYFYKPPSDRAAAIKELFPTELVPVNQQDEDEIGNIGGVEGELEDDPFASATATNTRMDMRPTRQENSIAQRKKRAFWGRRTHPD # LSKDAEGIIEKGTFEALTHEAVFGTTFFGLVEGEVTAAEISSGIGKAKIGSMEQWKDFAASILLCMPHLVDQTKFETELMRCCEFLVSGAEEEKKSAE # KQRVVWLAAEYLRYHGRPLEFPDWPEWKAEIAPEAITVPPPAMPLPRSTSTQALYNPTPVASPNIGMFSPRPGESSNMSLVNALIENGREATATPQPG # SGNSYFDPTTPGALSLSTPFGTPSSPTVNRTPWASALDREGLSRDVLLLIDPNTIARSLTVFHLAVLQQLPENLTANFVLGPEGSESHPWSTQQPLSS # LSATSLFGSDDHPHWLTKLLLVQILGADTSTGYATLRGAQLSSPSRRSEDRGPTSRTHSRSEVISAWIKIGELCRLNGDECSWRAILHAICAAPVARL # EKAWKRVNPVAIATVESWVQPVKDGDPVNGIREPRITPWGGNMRSIIREHLSQASVPGSTGDVLMLATLDRVRMLFEGFRTSVSLCPRKTTILEEGSN # EEVQKLVSYWKDIVADGGASSGLGIKFHRYAISTHSTLDCELTSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # start gene g657 Scaffold_8 AUGUSTUS gene 1260341 1260919 0.78 - . g657 Scaffold_8 AUGUSTUS transcript 1260341 1260919 0.78 - . g657.t1 Scaffold_8 AUGUSTUS stop_codon 1260341 1260343 . - 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_8 AUGUSTUS CDS 1260341 1260919 0.78 - 0 transcript_id "g657.t1"; gene_id "g657"; Scaffold_8 AUGUSTUS start_codon 1260917 1260919 . - 0 transcript_id "g657.t1"; gene_id "g657"; # protein sequence = [MEARGMDLTGLVFTTCPTGSLQELIEAAINIDNRQITRAWEQGKKLVDDGILTNFRPSTVATPFTAPTRDPNAMDIDA # TTTRSPDAFRCFMIGQCYGCGSKEHRKADGHHERDICRHCGLNGHVEAVCCRKFLGLPGRKATTISATSIPDTTQSATPGTIIAATPDLAMLLKQLAA # NQQVLAGQIAEVHKKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g657 ### # start gene g658 Scaffold_8 AUGUSTUS gene 1263784 1264270 0.52 + . g658 Scaffold_8 AUGUSTUS transcript 1263784 1264270 0.52 + . g658.t1 Scaffold_8 AUGUSTUS start_codon 1263784 1263786 . + 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_8 AUGUSTUS CDS 1263784 1264017 0.54 + 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_8 AUGUSTUS CDS 1264115 1264270 0.87 + 0 transcript_id "g658.t1"; gene_id "g658"; Scaffold_8 AUGUSTUS stop_codon 1264268 1264270 . + 0 transcript_id "g658.t1"; gene_id "g658"; # protein sequence = [MLDKRDMVAADQQELQEFLTLQQNEAVVAAKRKCNRSPMPVAGSSSKKIWLDAPKKHSRHKSPVVEVNPEPPHRVRVV # GPSDLVQLATVADQRAGADRGPSSGIKGTSQDLLSSIMPPSRSPYYPSLSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g658 ### # start gene g659 Scaffold_8 AUGUSTUS gene 1270123 1270812 0.99 + . g659 Scaffold_8 AUGUSTUS transcript 1270123 1270812 0.99 + . g659.t1 Scaffold_8 AUGUSTUS start_codon 1270123 1270125 . + 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_8 AUGUSTUS CDS 1270123 1270812 0.99 + 0 transcript_id "g659.t1"; gene_id "g659"; Scaffold_8 AUGUSTUS stop_codon 1270810 1270812 . + 0 transcript_id "g659.t1"; gene_id "g659"; # protein sequence = [MEPSTSCYPLRGRGPRRRRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPL # SEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEW # KTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVVSSSILTIFYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g659 ### # start gene g660 Scaffold_8 AUGUSTUS gene 1271520 1271960 0.81 + . g660 Scaffold_8 AUGUSTUS transcript 1271520 1271960 0.81 + . g660.t1 Scaffold_8 AUGUSTUS start_codon 1271520 1271522 . + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_8 AUGUSTUS CDS 1271520 1271960 0.81 + 0 transcript_id "g660.t1"; gene_id "g660"; Scaffold_8 AUGUSTUS stop_codon 1271958 1271960 . + 0 transcript_id "g660.t1"; gene_id "g660"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASFELPSWKVLLRASIIMDIEALHQAII # LALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVSAISMIIHSPAISARTAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g660 ### # start gene g661 Scaffold_8 AUGUSTUS gene 1275196 1275630 0.64 - . g661 Scaffold_8 AUGUSTUS transcript 1275196 1275630 0.64 - . g661.t1 Scaffold_8 AUGUSTUS stop_codon 1275196 1275198 . - 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_8 AUGUSTUS CDS 1275196 1275630 0.64 - 0 transcript_id "g661.t1"; gene_id "g661"; Scaffold_8 AUGUSTUS start_codon 1275628 1275630 . - 0 transcript_id "g661.t1"; gene_id "g661"; # protein sequence = [MRHPKNLVDLTNSIPLELFDVQPTSTGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHDPVIDWKE # LCLTLQDRNVRISAALALEIVQPGAEEGTEELGRGVNGEEIHEGTLQPPPEAPQQPPEAPQQPLDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g661 ### # start gene g662 Scaffold_8 AUGUSTUS gene 1286930 1287361 0.55 - . g662 Scaffold_8 AUGUSTUS transcript 1286930 1287361 0.55 - . g662.t1 Scaffold_8 AUGUSTUS stop_codon 1286930 1286932 . - 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_8 AUGUSTUS CDS 1286930 1287361 0.55 - 0 transcript_id "g662.t1"; gene_id "g662"; Scaffold_8 AUGUSTUS start_codon 1287359 1287361 . - 0 transcript_id "g662.t1"; gene_id "g662"; # protein sequence = [MRSVGVEWNVYHRKESAVADGLEGEDWEFIEDDTTTTPKPSTTTSVSEITPIVAPIPAKPECSVIPDIPPPVPTTAVE # IPAKRTRKPSAHILDIIAGNAVASTRPSDPVIPKGIRLLPTVVEEEPKVLELRGGHCGLDDGHGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g662 ### # start gene g663 Scaffold_8 AUGUSTUS gene 1298040 1298372 0.58 - . g663 Scaffold_8 AUGUSTUS transcript 1298040 1298372 0.58 - . g663.t1 Scaffold_8 AUGUSTUS stop_codon 1298040 1298042 . - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_8 AUGUSTUS CDS 1298040 1298372 0.58 - 0 transcript_id "g663.t1"; gene_id "g663"; Scaffold_8 AUGUSTUS start_codon 1298370 1298372 . - 0 transcript_id "g663.t1"; gene_id "g663"; # protein sequence = [MEACGAQEHFQVADLNSANEFYDIMEDDANALKRLSLGSQKVFSRFVDSVVAIAEDTQFVRHRLWKSFKVWIVQARNW # PSDKDVFATLITNQDLSRFIQDWIVERCVLAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g663 ### # start gene g664 Scaffold_8 AUGUSTUS gene 1307715 1309685 0.45 + . g664 Scaffold_8 AUGUSTUS transcript 1307715 1309685 0.45 + . g664.t1 Scaffold_8 AUGUSTUS start_codon 1307715 1307717 . + 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_8 AUGUSTUS CDS 1307715 1309685 0.45 + 0 transcript_id "g664.t1"; gene_id "g664"; Scaffold_8 AUGUSTUS stop_codon 1309683 1309685 . + 0 transcript_id "g664.t1"; gene_id "g664"; # protein sequence = [MRAFLRACMKVNRMGISETFRLWAFPLQYGYSRKWRHLEDAQAAAQRSRQAFIPLIAAISFFLRLLYHVENSWGELFA # NRDIAAPEPNPFWSTRQNEEEALRYGPVPSKWEWQEKLRQETSISSEWLMYFHEIMEIPMVGAFMDAHHSGCSSLLPVFFETKMPLVLYWGTIDNWRV # PTALSAPPGIGLPDGAMVNALISRRAPYKPSRPPPPSQPTPPTLSHESRVNSRIRFPRLDGGTQPRRQESIFEFLKRREADRVKLISSEGPTARQSRL # AREENASKHRPPGRKGARVYYWDLIEGVRVRTPVGRNNYEDIWERYGQHQKHYDSVADEWDICTELDPDDGPDYPDDVDGGDDDYFITTQSVLDRETE # HNTGTASSLAYLERLHPVSSSSDRVVFNDTVDDVVRHRFGFTLRSNVSDRSTILSEKIWNKALGLIGCGRPPRLPIHDMQAASRLCTFLFDMLKATHL # YSAPQNFDLVSLRPRLPFELDVLPSRNGLYFIIQAPEAHDNEPFVLAFSSAGTVMEIARRRWGPKTTDIVQRLIQEGFSFNTLSPYLPPTNQVLPPQR # RSVVLGRRPSNFNPGLAEYLAYEYRRNSFLRSTRGRAAILAGGIIARLARRIVDENDVFDGPTDEALHGQQALCVWTRHSLLPFGMIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g664 ### # start gene g665 Scaffold_8 AUGUSTUS gene 1310801 1313769 0.67 - . g665 Scaffold_8 AUGUSTUS transcript 1310801 1313769 0.67 - . g665.t1 Scaffold_8 AUGUSTUS stop_codon 1310801 1310803 . - 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_8 AUGUSTUS CDS 1310801 1313400 0.99 - 2 transcript_id "g665.t1"; gene_id "g665"; Scaffold_8 AUGUSTUS CDS 1313609 1313641 0.67 - 2 transcript_id "g665.t1"; gene_id "g665"; Scaffold_8 AUGUSTUS CDS 1313739 1313769 0.95 - 0 transcript_id "g665.t1"; gene_id "g665"; Scaffold_8 AUGUSTUS start_codon 1313767 1313769 . - 0 transcript_id "g665.t1"; gene_id "g665"; # protein sequence = [MISASRTCSIEYGKEGENPELHANVIRIQAPGEAEAELAFLNRTGIIDGILSDDVDNFLFGAHTVIRNHSSTHAEAKS # TIEKAKVYTYTLPHPLFPNINREELIFIALCSGGDYGTGLDNCGIKISYGLACAGFGKRLCLAALTYSENSDDLQNFLRQWKSELSQELKTNASGFLP # RKSPKLANTIPNSFPDIKVLLAYLRPVTSESLGRSERYDDLLVDAGGHDGWLKKDPSLPLLAKNCEFYFEWGFLESIIKRFRTVIFHGITLRIMRRAC # ILKQTWDAKTIDLKTIRTHFTAGDHTTEDEESPCPEFIENVSKTRTHESTSNTLEYRVAINPTILVQLATRGVTGIRRPDEKGEWADYEEEVEHASEN # EGGATERARKYPDPTLPLKLWLPAELVKEAVPGLIAAYEEVRRQKEEKARKGGKVKAVEPKVMSPKKARLKPSAAATVAANMFLSQRALKTNHYDISN # DDDMDYNSRLFISSRPAQSTTHSRKDQMSRISHDASSTPSTSASPPRKSQSTGSSHSETNSHGIKSFLKVSKSSAWHKGKQKATVFRDDSLLSTIDDI # ITPKKNRKDGIHQISRFESSSKKTTPRPFPVLVANSSDEDSGGDGSNNPFHSPAPSAPPQTPSPQKRTRKANAVISSDSSFEENGSPRKVGVLNKSPR # KSKDHRYPKGLSYDGDINGEQVKKMIRDTSDPSRVARAASPTPVRHTLHKLSSISTSAFTSTKAAASACVPSSSSPSPFTNSSTGPLPSSAITPTTAG # PIIISDSEDEEQQSLRKIIPLVHSQPKSCPRPKIKADVTSDTPKSYLDLKLGGYSPLRTGRTELFDIEDDIPPLLHARASAKVDQQPSSKVKTAANVR # TAMTTTTAMRTKTVVNLIELSDDSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g665 ### # start gene g666 Scaffold_8 AUGUSTUS gene 1316243 1316629 1 + . g666 Scaffold_8 AUGUSTUS transcript 1316243 1316629 1 + . g666.t1 Scaffold_8 AUGUSTUS start_codon 1316243 1316245 . + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_8 AUGUSTUS CDS 1316243 1316629 1 + 0 transcript_id "g666.t1"; gene_id "g666"; Scaffold_8 AUGUSTUS stop_codon 1316627 1316629 . + 0 transcript_id "g666.t1"; gene_id "g666"; # protein sequence = [MPIARRTSSTQSKLNFGTSKSSPAVVGGKKGKHSDRKALELPKVEPEFEDVGGYSSSSSSEHDNINEPNESEPVEHPI # AVTTLKRKRNGLGEGKEKKKAGVKNEGQEAQAGIFLVSLSQLIVCSEPIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g666 ### # start gene g667 Scaffold_8 AUGUSTUS gene 1335531 1336271 0.72 + . g667 Scaffold_8 AUGUSTUS transcript 1335531 1336271 0.72 + . g667.t1 Scaffold_8 AUGUSTUS start_codon 1335531 1335533 . + 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_8 AUGUSTUS CDS 1335531 1336271 0.72 + 0 transcript_id "g667.t1"; gene_id "g667"; Scaffold_8 AUGUSTUS stop_codon 1336269 1336271 . + 0 transcript_id "g667.t1"; gene_id "g667"; # protein sequence = [MCAGSFYEKLGEVPVISSSTRSNILNRTLLSKKDQQPHPSVPTNTLSILERLAGFSSTSSFLTSTSSLEKPAKDGKED # NEGKKGQWWVEEMGKKPPKVKKGKGADLDLDDDDEEEDKIEKKDDEEDDWRKFFDEQNTNGESNTKKANLGERIKGRKHTLTLHQSLHNTPSHRAAFT # HAWLALLSRLSGYSSNNNDVEAEDVEGTKDLELAVRALNVMHRGVLPYLTRPVLVMDWIGACVDYGKWAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g667 ### # start gene g668 Scaffold_8 AUGUSTUS gene 1344408 1344863 0.98 + . g668 Scaffold_8 AUGUSTUS transcript 1344408 1344863 0.98 + . g668.t1 Scaffold_8 AUGUSTUS start_codon 1344408 1344410 . + 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_8 AUGUSTUS CDS 1344408 1344863 0.98 + 0 transcript_id "g668.t1"; gene_id "g668"; Scaffold_8 AUGUSTUS stop_codon 1344861 1344863 . + 0 transcript_id "g668.t1"; gene_id "g668"; # protein sequence = [MTTRRNGKSPGKDSRTLNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKP # KLIDQVYGTSNERIEKFDDSNRRLSASMTCGGAVRKCDEIGQTDTSGMLGKDLVARDGNHKDTGSNPCGTHPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g668 ### # start gene g669 Scaffold_8 AUGUSTUS gene 1345304 1345783 0.38 + . g669 Scaffold_8 AUGUSTUS transcript 1345304 1345783 0.38 + . g669.t1 Scaffold_8 AUGUSTUS start_codon 1345304 1345306 . + 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_8 AUGUSTUS CDS 1345304 1345783 0.38 + 0 transcript_id "g669.t1"; gene_id "g669"; Scaffold_8 AUGUSTUS stop_codon 1345781 1345783 . + 0 transcript_id "g669.t1"; gene_id "g669"; # protein sequence = [MAIGILRAWMPESHVREASEEMVLAIQNLSHATATEAVTNLKSHKRFVRGTRGRELKLRTTIENINNGVQIEMEALLD # SGATGSCVNKDFVEQHQLTVKELPVKMPVYNTNGTLNKNGSIEGYVQVRMVIGDHAEQVDMAVYQSRQDRYLSRHRLATLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g669 ### # start gene g670 Scaffold_8 AUGUSTUS gene 1346411 1346797 0.54 + . g670 Scaffold_8 AUGUSTUS transcript 1346411 1346797 0.54 + . g670.t1 Scaffold_8 AUGUSTUS start_codon 1346411 1346413 . + 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_8 AUGUSTUS CDS 1346411 1346797 0.54 + 0 transcript_id "g670.t1"; gene_id "g670"; Scaffold_8 AUGUSTUS stop_codon 1346795 1346797 . + 0 transcript_id "g670.t1"; gene_id "g670"; # protein sequence = [MEGSIQDRGLFEPTVMFFGLINSPATFQAFMNHILRELIDQGHVIVYMDDILIFTDNIEGHQVIVRKVLDILKANKLY # LKPEKCTFEAKEVEYLGIIVGNGQIRMDLKKVEAVQTWQPPEKKRELQSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g670 ### # start gene g671 Scaffold_8 AUGUSTUS gene 1352198 1352979 0.48 - . g671 Scaffold_8 AUGUSTUS transcript 1352198 1352979 0.48 - . g671.t1 Scaffold_8 AUGUSTUS stop_codon 1352198 1352200 . - 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_8 AUGUSTUS CDS 1352198 1352644 0.52 - 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_8 AUGUSTUS CDS 1352698 1352979 0.87 - 0 transcript_id "g671.t1"; gene_id "g671"; Scaffold_8 AUGUSTUS start_codon 1352977 1352979 . - 0 transcript_id "g671.t1"; gene_id "g671"; # protein sequence = [MQDWANPLVRPHMQLYPEVSGPIRESWQAAKWTTEVYLDELSPMWADWKYTPHQQYYIKELAQLEDSTYVVPLRWITV # NGEEYMDALPAHYIQTRNEFEIQNTDFMQHIPSKHLHRNFLDVQSAFSGRKLNISGKQYFLTMSGESTSFYDMCQITDGSPIFTMPHALRVKAKSKPV # FRMRIMPWSDDVSGNVSKQYNAHTNIYAVSLNLLHKKLSQEFFVRFCSTSANASSSEQFTALAKDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g671 ### # start gene g672 Scaffold_8 AUGUSTUS gene 1353439 1353777 0.53 - . g672 Scaffold_8 AUGUSTUS transcript 1353439 1353777 0.53 - . g672.t1 Scaffold_8 AUGUSTUS stop_codon 1353439 1353441 . - 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_8 AUGUSTUS CDS 1353439 1353777 0.53 - 0 transcript_id "g672.t1"; gene_id "g672"; Scaffold_8 AUGUSTUS start_codon 1353775 1353777 . - 0 transcript_id "g672.t1"; gene_id "g672"; # protein sequence = [MLSLPHRFKEQEQSYIPDFPPSTEHAPVYDVQKDSMGNYIDSDGNKIIFLAGPNPEDEQRAQLQSLVRQMNALDLLPH # HTSLNNFHDNNEEPDDELEDLMQFGELTPQMICR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g672 ### # start gene g673 Scaffold_8 AUGUSTUS gene 1365162 1366225 0.38 - . g673 Scaffold_8 AUGUSTUS transcript 1365162 1366225 0.38 - . g673.t1 Scaffold_8 AUGUSTUS stop_codon 1365162 1365164 . - 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_8 AUGUSTUS CDS 1365162 1365908 0.55 - 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_8 AUGUSTUS CDS 1366025 1366225 0.72 - 0 transcript_id "g673.t1"; gene_id "g673"; Scaffold_8 AUGUSTUS start_codon 1366223 1366225 . - 0 transcript_id "g673.t1"; gene_id "g673"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFYIRIYCSYQQD # DWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAHLVTRNKLTGKESRTRSSRSAPKYSFLL # STFVLLVLLKNSQKNILVLSRSSVDLVLCLMSSSSQTIFAEFTRFPRLTVEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRY # YIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g673 ### # start gene g674 Scaffold_8 AUGUSTUS gene 1369684 1370723 0.9 - . g674 Scaffold_8 AUGUSTUS transcript 1369684 1370723 0.9 - . g674.t1 Scaffold_8 AUGUSTUS stop_codon 1369684 1369686 . - 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_8 AUGUSTUS CDS 1369684 1370396 0.91 - 2 transcript_id "g674.t1"; gene_id "g674"; Scaffold_8 AUGUSTUS CDS 1370468 1370723 0.98 - 0 transcript_id "g674.t1"; gene_id "g674"; Scaffold_8 AUGUSTUS start_codon 1370721 1370723 . - 0 transcript_id "g674.t1"; gene_id "g674"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPR # SPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAK # EWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g674 ### # start gene g675 Scaffold_8 AUGUSTUS gene 1371324 1373291 0.55 + . g675 Scaffold_8 AUGUSTUS transcript 1371324 1373291 0.55 + . g675.t1 Scaffold_8 AUGUSTUS start_codon 1371324 1371326 . + 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_8 AUGUSTUS CDS 1371324 1373291 0.55 + 0 transcript_id "g675.t1"; gene_id "g675"; Scaffold_8 AUGUSTUS stop_codon 1373289 1373291 . + 0 transcript_id "g675.t1"; gene_id "g675"; # protein sequence = [MEARGMDLTAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIF # EAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQ # LTASLRATFLEGPALRASIIMDIEALHQAIILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNR # TLEAVHRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLA # ELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGI # TPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFRSAPKYLFLLSIFAPLVLLKNSLKNILVLSRSS # VDLVLYLTSSSSRTTFAEFTRFSTSHSWSRLRRILSRIELNLLHLQLKLMVKRSTTLPKSSTPSWTEGINVVLYVTTFGGPVTKYRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g675 ### # start gene g676 Scaffold_8 AUGUSTUS gene 1376433 1377695 0.65 + . g676 Scaffold_8 AUGUSTUS transcript 1376433 1377695 0.65 + . g676.t1 Scaffold_8 AUGUSTUS start_codon 1376433 1376435 . + 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_8 AUGUSTUS CDS 1376433 1377695 0.65 + 0 transcript_id "g676.t1"; gene_id "g676"; Scaffold_8 AUGUSTUS stop_codon 1377693 1377695 . + 0 transcript_id "g676.t1"; gene_id "g676"; # protein sequence = [MDVYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKL # MDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLP # FAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMI # NSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDR # AESYFANMEDDEDDKVMDQQMNPNVNLCQVHAAGLHSAARYSEDLLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g676 ### # start gene g677 Scaffold_8 AUGUSTUS gene 1378283 1378864 0.43 + . g677 Scaffold_8 AUGUSTUS transcript 1378283 1378864 0.43 + . g677.t1 Scaffold_8 AUGUSTUS start_codon 1378283 1378285 . + 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_8 AUGUSTUS CDS 1378283 1378864 0.43 + 0 transcript_id "g677.t1"; gene_id "g677"; Scaffold_8 AUGUSTUS stop_codon 1378862 1378864 . + 0 transcript_id "g677.t1"; gene_id "g677"; # protein sequence = [MSVCSTKIVQMEKISTPMKEQDRSMRTLRSNAVAPEESEKTKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGN # QKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSR # PGVEEDIAKKIFDAKVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g677 ### # start gene g678 Scaffold_8 AUGUSTUS gene 1378912 1379790 0.99 + . g678 Scaffold_8 AUGUSTUS transcript 1378912 1379790 0.99 + . g678.t1 Scaffold_8 AUGUSTUS start_codon 1378912 1378914 . + 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_8 AUGUSTUS CDS 1378912 1379790 0.99 + 0 transcript_id "g678.t1"; gene_id "g678"; Scaffold_8 AUGUSTUS stop_codon 1379788 1379790 . + 0 transcript_id "g678.t1"; gene_id "g678"; # protein sequence = [MRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIV # ESFLRDLSIDDERRNIALVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLN # QTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNESKNVTPDN # EKSTGENDSKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g678 ### # start gene g679 Scaffold_8 AUGUSTUS gene 1380114 1380551 0.52 + . g679 Scaffold_8 AUGUSTUS transcript 1380114 1380551 0.52 + . g679.t1 Scaffold_8 AUGUSTUS start_codon 1380114 1380116 . + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_8 AUGUSTUS CDS 1380114 1380551 0.52 + 0 transcript_id "g679.t1"; gene_id "g679"; Scaffold_8 AUGUSTUS stop_codon 1380549 1380551 . + 0 transcript_id "g679.t1"; gene_id "g679"; # protein sequence = [MEGSSLNPYERKFRRGDLSNLYCKNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEIL # KRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVLNEPPTNKLEERIKLNQQDRSPIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g679 ### # start gene g680 Scaffold_8 AUGUSTUS gene 1381293 1382330 0.57 + . g680 Scaffold_8 AUGUSTUS transcript 1381293 1382330 0.57 + . g680.t1 Scaffold_8 AUGUSTUS start_codon 1381293 1381295 . + 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_8 AUGUSTUS CDS 1381293 1382330 0.57 + 0 transcript_id "g680.t1"; gene_id "g680"; Scaffold_8 AUGUSTUS stop_codon 1382328 1382330 . + 0 transcript_id "g680.t1"; gene_id "g680"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN # VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV # YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATMVLMDYHESHLVDGKQNVQN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g680 ### # start gene g681 Scaffold_8 AUGUSTUS gene 1382381 1383426 0.2 + . g681 Scaffold_8 AUGUSTUS transcript 1382381 1383426 0.2 + . g681.t1 Scaffold_8 AUGUSTUS start_codon 1382381 1382383 . + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_8 AUGUSTUS CDS 1382381 1382973 0.2 + 0 transcript_id "g681.t1"; gene_id "g681"; Scaffold_8 AUGUSTUS CDS 1383015 1383426 0.24 + 1 transcript_id "g681.t1"; gene_id "g681"; Scaffold_8 AUGUSTUS stop_codon 1383424 1383426 . + 0 transcript_id "g681.t1"; gene_id "g681"; # protein sequence = [MGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDE # EFVQNNPYPEAHRSSEGNRLDELIPLIGEYLSNPSDESLGEMSKDERVKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGH # KGVFATNDFLQNDSGGLTYIKTQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g681 ### # start gene g682 Scaffold_8 AUGUSTUS gene 1384615 1385781 0.84 + . g682 Scaffold_8 AUGUSTUS transcript 1384615 1385781 0.84 + . g682.t1 Scaffold_8 AUGUSTUS start_codon 1384615 1384617 . + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_8 AUGUSTUS CDS 1384615 1385781 0.84 + 0 transcript_id "g682.t1"; gene_id "g682"; Scaffold_8 AUGUSTUS stop_codon 1385779 1385781 . + 0 transcript_id "g682.t1"; gene_id "g682"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g682 ### # start gene g683 Scaffold_8 AUGUSTUS gene 1385832 1387265 0.54 + . g683 Scaffold_8 AUGUSTUS transcript 1385832 1387265 0.54 + . g683.t1 Scaffold_8 AUGUSTUS start_codon 1385832 1385834 . + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_8 AUGUSTUS CDS 1385832 1387265 0.54 + 0 transcript_id "g683.t1"; gene_id "g683"; Scaffold_8 AUGUSTUS stop_codon 1387263 1387265 . + 0 transcript_id "g683.t1"; gene_id "g683"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g683 ### # start gene g684 Scaffold_8 AUGUSTUS gene 1395407 1396012 0.68 - . g684 Scaffold_8 AUGUSTUS transcript 1395407 1396012 0.68 - . g684.t1 Scaffold_8 AUGUSTUS stop_codon 1395407 1395409 . - 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_8 AUGUSTUS CDS 1395407 1396012 0.68 - 0 transcript_id "g684.t1"; gene_id "g684"; Scaffold_8 AUGUSTUS start_codon 1396010 1396012 . - 0 transcript_id "g684.t1"; gene_id "g684"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRLGQPPMVAPARGRSTTRIESPILQAIARRAASESPRDPPPHFDLDAGDHDDQDPPVDPDDPGADNNHDDLDDDSGGLPRGEPVTQWTWRAG # GPGGPGGPGGPVAWWTRWTSFPNLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g684 ### # start gene g685 Scaffold_8 AUGUSTUS gene 1398337 1399407 1 - . g685 Scaffold_8 AUGUSTUS transcript 1398337 1399407 1 - . g685.t1 Scaffold_8 AUGUSTUS stop_codon 1398337 1398339 . - 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_8 AUGUSTUS CDS 1398337 1399407 1 - 0 transcript_id "g685.t1"; gene_id "g685"; Scaffold_8 AUGUSTUS start_codon 1399405 1399407 . - 0 transcript_id "g685.t1"; gene_id "g685"; # protein sequence = [MDFIEQLPISNGYTAILIVVDRSSKQAIFIPTFDTITSEQLAELFVIHVFSKHGVPNHVTSDCRSEFVSAFFRALSKA # LSMELHYTSGYHPEANGQTERVNQTLEQYIRIYCSYQQDDWSHLLPIAEFAYNNAPNASTDITPFFANKGYHPNITVRPEVDMKSDLAREFVINLNEL # HVFLREEILLAQSRYKEQADRKRTSHPEFPIGSEVFVLAKHIRSTHPTEKFSEKYLGPFKVISQTGGTLSYELKLPDYLRRIHPAFHVSQLEPVAPNL # FPNRTQSPPPPIELDGEEEYNIAEILDSKLDRRYKCCPLRYYIQWASYKGTDDEFSWVAADELHADELVPAFHARYPLEPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g685 ### # start gene g686 Scaffold_8 AUGUSTUS gene 1403575 1404771 0.86 - . g686 Scaffold_8 AUGUSTUS transcript 1403575 1404771 0.86 - . g686.t1 Scaffold_8 AUGUSTUS stop_codon 1403575 1403577 . - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_8 AUGUSTUS CDS 1403575 1404771 0.86 - 0 transcript_id "g686.t1"; gene_id "g686"; Scaffold_8 AUGUSTUS start_codon 1404769 1404771 . - 0 transcript_id "g686.t1"; gene_id "g686"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVK # QNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPATPSPANQDFSTQIGQIRELLDVLM # LCPPRPLAFNRVFKEGTRFGCTESTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g686 ### # start gene g687 Scaffold_8 AUGUSTUS gene 1407600 1409378 0.99 + . g687 Scaffold_8 AUGUSTUS transcript 1407600 1409378 0.99 + . g687.t1 Scaffold_8 AUGUSTUS start_codon 1407600 1407602 . + 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_8 AUGUSTUS CDS 1407600 1409378 0.99 + 0 transcript_id "g687.t1"; gene_id "g687"; Scaffold_8 AUGUSTUS stop_codon 1409376 1409378 . + 0 transcript_id "g687.t1"; gene_id "g687"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLNEGSQREPN # HTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQ # PWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGA # RYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKH # DLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLR # EAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDTPTSNS # GAQHKTLPVDKPDGPSIYHGLIFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g687 ### # start gene g688 Scaffold_8 AUGUSTUS gene 1410143 1410988 0.34 + . g688 Scaffold_8 AUGUSTUS transcript 1410143 1410988 0.34 + . g688.t1 Scaffold_8 AUGUSTUS start_codon 1410143 1410145 . + 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_8 AUGUSTUS CDS 1410143 1410988 0.34 + 0 transcript_id "g688.t1"; gene_id "g688"; Scaffold_8 AUGUSTUS stop_codon 1410986 1410988 . + 0 transcript_id "g688.t1"; gene_id "g688"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK # HPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g688 ### # start gene g689 Scaffold_8 AUGUSTUS gene 1412872 1414439 0.26 - . g689 Scaffold_8 AUGUSTUS transcript 1412872 1414439 0.26 - . g689.t1 Scaffold_8 AUGUSTUS stop_codon 1412872 1412874 . - 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_8 AUGUSTUS CDS 1412872 1413683 0.44 - 2 transcript_id "g689.t1"; gene_id "g689"; Scaffold_8 AUGUSTUS CDS 1413834 1414329 0.29 - 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_8 AUGUSTUS CDS 1414437 1414439 0.62 - 0 transcript_id "g689.t1"; gene_id "g689"; Scaffold_8 AUGUSTUS start_codon 1414437 1414439 . - 0 transcript_id "g689.t1"; gene_id "g689"; # protein sequence = [MDKESSGQLDIQGQLCIFTLSFKSGNNYLYCFHNEDIKHTQPHWMITSGCIRDWSQVKDGTVLKVSWPQAAKWNLEAR # MFSACTGDFGSPDHIISFEACYEDGSPVSNSIFLPSANDNLENVFWNLHSAKPPPVYLKPDFHSLCFSLTRDEGETLENCTSAFELMESATSLRKDFS # ALPVGNLILPSSTGDIGSLNSFPKLLAAVKNDKHRRSIADIACKIHEHAELLTSGAGCKAIWTDWDMGADMAGYFESAHDGTVSVSGFPRFCHCLNIT # DSVAKGTPQFMSMGLLDAEFDNEIQSPADDIESFLWVGLWSTLRNTKFPNGAKKEIRWSKRIAEGYAFRETTVINIQESLGTIMKGVPEPYSNMFRTM # APILSEWYDAIHQLRKDWILDWSETNHDDSKDVNLLFHSFAYRGVLDFIEIFQKHKEDLEKTVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g689 ### # start gene g690 Scaffold_8 AUGUSTUS gene 1414838 1415722 0.82 - . g690 Scaffold_8 AUGUSTUS transcript 1414838 1415722 0.82 - . g690.t1 Scaffold_8 AUGUSTUS stop_codon 1414838 1414840 . - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_8 AUGUSTUS CDS 1414838 1415722 0.82 - 0 transcript_id "g690.t1"; gene_id "g690"; Scaffold_8 AUGUSTUS start_codon 1415720 1415722 . - 0 transcript_id "g690.t1"; gene_id "g690"; # protein sequence = [MVRLIPTWFLAQGYQHWQHTQIEISSNFLRKDFSALPVGNLILPSSTRDIGSLNSFPKLLAAVKNDKYRRSIADIACK # IHEHAEVLTSGAGCKAIWTDGDMGADMARYFESAHDGSVSVSGFPRFCHCLIITESVAKGTTQFMSKGLLNEEPENEIQSPADDIESFLWVGLWSTLR # NTKFPSSAKKEIRWSQSITKGHDSRETTVIGIQETLDDIKDGFPQPYSNLLHAMAPILDEWFDAIRQLRKDWKQDWRNTNRDRAEDVNLLFHSFAYRG # VLDFIEIFQKHKEDLEQTIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g690 ### # start gene g691 Scaffold_8 AUGUSTUS gene 1415778 1416315 0.4 - . g691 Scaffold_8 AUGUSTUS transcript 1415778 1416315 0.4 - . g691.t1 Scaffold_8 AUGUSTUS stop_codon 1415778 1415780 . - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_8 AUGUSTUS CDS 1415778 1416223 0.82 - 2 transcript_id "g691.t1"; gene_id "g691"; Scaffold_8 AUGUSTUS CDS 1416306 1416315 0.48 - 0 transcript_id "g691.t1"; gene_id "g691"; Scaffold_8 AUGUSTUS start_codon 1416313 1416315 . - 0 transcript_id "g691.t1"; gene_id "g691"; # protein sequence = [MDPNNNRLYRFHNKDIKFTLPRWKLTSGNIQDWSEVKDGGVLKGSWPQAAKRNLEARMFSACTGNFGSPDHIMSFEAC # YEDGSPVSNSIFLPSANDNLENVFWNLHGAKSPLVYPKPDFRSLCFSLTRDEGETLENCTSAFELMDVCFTQC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g691 ### # start gene g692 Scaffold_8 AUGUSTUS gene 1416641 1417588 0.49 - . g692 Scaffold_8 AUGUSTUS transcript 1416641 1417588 0.49 - . g692.t1 Scaffold_8 AUGUSTUS stop_codon 1416641 1416643 . - 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_8 AUGUSTUS CDS 1416641 1417588 0.49 - 0 transcript_id "g692.t1"; gene_id "g692"; Scaffold_8 AUGUSTUS start_codon 1417586 1417588 . - 0 transcript_id "g692.t1"; gene_id "g692"; # protein sequence = [MAVRCRACGTHAFSKETKTRKSLVPENGGYTADPLDLPSTHDFHYLVDDLDVKAAFEARFNKHKFDYHSPSSIGERSH # YDPLVCFLNECVAIGNQVYMDVFVGRRQASHRSRFPIVDIKDRWWLYLTFHTYDRPTGDGIGNASPLKPDLVGVDSEGAPILKLPSDVGKADNLKAEI # AIATEAKDNWPEMIWQSATYGRAEMATIPLRAFSLVIAFNSKSQMLRFLIFHHGGISATKELSVKDQLCCKDICLVMLSILLWQSPTDAGIPPFTNGI # NFLLPPLVDRDESREGMARLLMFCIMPFCSWSEYMDCLDQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g692 ### # start gene g693 Scaffold_8 AUGUSTUS gene 1421666 1422718 0.17 + . g693 Scaffold_8 AUGUSTUS transcript 1421666 1422718 0.17 + . g693.t1 Scaffold_8 AUGUSTUS start_codon 1421666 1421668 . + 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_8 AUGUSTUS CDS 1421666 1422718 0.17 + 0 transcript_id "g693.t1"; gene_id "g693"; Scaffold_8 AUGUSTUS stop_codon 1422716 1422718 . + 0 transcript_id "g693.t1"; gene_id "g693"; # protein sequence = [MQPFSAAAGAPPRRNTATRPQSTPAASAPRPVPTPSPEFRPHSNYVPPPQPSYSSYPAYPSSYPNPQNSNPPPAPPRP # QQYHPYASYTPNSGASRSSHNLHVPPGHVPPRPGSVPPRQRASSAAPATRTPPPAPPPPAPTLDQLLSMTTESMSSLSISSLKAILFANHVNSSMILE # KGDLVRRVVGLVEDERRERREHEERELEEQRQREETERIEREREEREDQERIRVQHEMMEAFEREKRERESREQELNREREETARREEERIDGLQSDL # MQVDSESESRHTYNGEHNTNPTSSSSPPPPPTPPKTSPAPSKVSHKAPATAAFVERTGLCVVCQDEEANIAIVDCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g693 ### # start gene g694 Scaffold_8 AUGUSTUS gene 1423286 1423675 0.99 - . g694 Scaffold_8 AUGUSTUS transcript 1423286 1423675 0.99 - . g694.t1 Scaffold_8 AUGUSTUS stop_codon 1423286 1423288 . - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_8 AUGUSTUS CDS 1423286 1423675 0.99 - 0 transcript_id "g694.t1"; gene_id "g694"; Scaffold_8 AUGUSTUS start_codon 1423673 1423675 . - 0 transcript_id "g694.t1"; gene_id "g694"; # protein sequence = [MYTKVGGKEAWIMFIGEQYAFRAKEEQGEDTLEATEVRSPELLEGPLYPLGTSVHFKDDAAMQDAFRKICAIRPRSKL # VFIKQALEVLLEEGALFDLKGKQHSSVDAMYSDFKTSVERRKANRKPKTRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g694 ### # start gene g695 Scaffold_8 AUGUSTUS gene 1427147 1428196 0.18 + . g695 Scaffold_8 AUGUSTUS transcript 1427147 1428196 0.18 + . g695.t1 Scaffold_8 AUGUSTUS start_codon 1427147 1427149 . + 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_8 AUGUSTUS CDS 1427147 1427156 0.25 + 0 transcript_id "g695.t1"; gene_id "g695"; Scaffold_8 AUGUSTUS CDS 1427691 1428196 0.75 + 2 transcript_id "g695.t1"; gene_id "g695"; Scaffold_8 AUGUSTUS stop_codon 1428194 1428196 . + 0 transcript_id "g695.t1"; gene_id "g695"; # protein sequence = [MKLPRSYATEAKQVVGSVKTVIGAVVDVQFDTENLPPILNALEVQDFHGGRLVLEVASHLGENSVRTIAMDGTEGLVR # GQKVVDTGAPILVPVGTGTLGRIMNVIGEPIDERGPIKGVKLSPIHADPPPFVEQSTTAEVLETGIKVVDLLAPYARVEKLVFSEVLVLARRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g695 ### # start gene g696 Scaffold_8 AUGUSTUS gene 1428230 1429384 0.17 + . g696 Scaffold_8 AUGUSTUS transcript 1428230 1429384 0.17 + . g696.t1 Scaffold_8 AUGUSTUS start_codon 1428230 1428232 . + 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_8 AUGUSTUS CDS 1428230 1428550 0.55 + 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_8 AUGUSTUS CDS 1428648 1428788 0.24 + 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_8 AUGUSTUS CDS 1428884 1429384 0.8 + 0 transcript_id "g696.t1"; gene_id "g696"; Scaffold_8 AUGUSTUS stop_codon 1429382 1429384 . + 0 transcript_id "g696.t1"; gene_id "g696"; # protein sequence = [MVVSLSSVVRPVCFLHASIFNWLHLGVGERTREGNDLYHEMIETGVINLEGDSKVALVFGQMNEPPGARARVALTGLT # IAEYFRDEEGQDVLLFIDNIFRFTQAGSEKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVGREHYDVATAVQKILQDYKSL # QDIIAILGMDELSEEDKLTVSFFLDVFYIVIDSPLLQVERARKIQRFMSQPFQVAQVFTGYEGKLVSLKDTVRSFKEILSGAHDSLPESAFYMVSIHH # MHYLAEFELTSFRSPVPSRMSKPRLSSLPRRWVIRQLGCALCFGIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g696 ### # start gene g697 Scaffold_8 AUGUSTUS gene 1435879 1436738 0.72 + . g697 Scaffold_8 AUGUSTUS transcript 1435879 1436738 0.72 + . g697.t1 Scaffold_8 AUGUSTUS start_codon 1435879 1435881 . + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_8 AUGUSTUS CDS 1435879 1435969 0.73 + 0 transcript_id "g697.t1"; gene_id "g697"; Scaffold_8 AUGUSTUS CDS 1436215 1436738 1 + 2 transcript_id "g697.t1"; gene_id "g697"; Scaffold_8 AUGUSTUS stop_codon 1436736 1436738 . + 0 transcript_id "g697.t1"; gene_id "g697"; # protein sequence = [MDAARLAGVKSIIVTGSQVTYNIEGPFGPRVDPTYIFGPFVPNYKYIVNNPKLYSAESTNYFVHFLLRPDNEVFVVYP # GWVDLRNIADAHVNAIHNTAIDQLEPRDRRFLLGAPEEHNWKKVIEHVKEVRPELAARLSDPEKAPVWPMQVTDLERNEKYLGIKKDSYHSFNKSIVD # TIDGILDVEKYWKEQGFEISLPNEHLFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g697 ### # start gene g698 Scaffold_8 AUGUSTUS gene 1437323 1438396 0.97 + . g698 Scaffold_8 AUGUSTUS transcript 1437323 1438396 0.97 + . g698.t1 Scaffold_8 AUGUSTUS start_codon 1437323 1437325 . + 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_8 AUGUSTUS CDS 1437323 1438396 0.97 + 0 transcript_id "g698.t1"; gene_id "g698"; Scaffold_8 AUGUSTUS stop_codon 1438394 1438396 . + 0 transcript_id "g698.t1"; gene_id "g698"; # protein sequence = [MNSSRLKRFCQSLTAPNKFGLLLKCPFRLAGRLTGIVGTCFSRYTGLPLNISCYRKLRPFSIFILELGETRPIVYSTS # DLTLNQGEGEEEEGKREFKSFVFTVVERPSEFYLLEYHGEPTLFKISLSKSEDSSSEQIQQLTEPLLVELLATPDKLTFEHIEHSPEGSAALQRIFAR # DRDVIPELEKFLGYIPEHTEIWEENPQNSHPEYTTKSAEMGESSEKTAEDEKIAEVNYLLKEIEERSPEFKEASQAWDRGILDVSSSMSDNEIDPDSV # EHSMSAIGLKEEIAQLEDMMDNADGEISKLDESLQETLTSLDTKSVNHESLSPLQVEVDEANEDHVRLSVPFKEERGKDPKSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g698 ### # start gene g699 Scaffold_8 AUGUSTUS gene 1441010 1441447 0.91 - . g699 Scaffold_8 AUGUSTUS transcript 1441010 1441447 0.91 - . g699.t1 Scaffold_8 AUGUSTUS stop_codon 1441010 1441012 . - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_8 AUGUSTUS CDS 1441010 1441447 0.91 - 0 transcript_id "g699.t1"; gene_id "g699"; Scaffold_8 AUGUSTUS start_codon 1441445 1441447 . - 0 transcript_id "g699.t1"; gene_id "g699"; # protein sequence = [MNPLALHLERGGPKNLPIARVLVDDDEDEDMHRIARDKPRLVVVGGGWGAMGVLQTLHLGDYHVTVVSNETFTTFTPL # LPSAAVGTIQIRSLIEPIRKIVARLRGHFVNGKAVDVDFGQRLIEIECVGNGERVYIPWVPTFYLVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g699 ### # start gene g700 Scaffold_8 AUGUSTUS gene 1442848 1444624 0.18 + . g700 Scaffold_8 AUGUSTUS transcript 1442848 1444624 0.18 + . g700.t1 Scaffold_8 AUGUSTUS start_codon 1442848 1442850 . + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_8 AUGUSTUS CDS 1442848 1443554 0.56 + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_8 AUGUSTUS CDS 1443632 1443880 0.33 + 1 transcript_id "g700.t1"; gene_id "g700"; Scaffold_8 AUGUSTUS CDS 1444032 1444197 0.47 + 1 transcript_id "g700.t1"; gene_id "g700"; Scaffold_8 AUGUSTUS CDS 1444361 1444624 0.76 + 0 transcript_id "g700.t1"; gene_id "g700"; Scaffold_8 AUGUSTUS stop_codon 1444622 1444624 . + 0 transcript_id "g700.t1"; gene_id "g700"; # protein sequence = [MSPILSTLPEAFASNAADRVTGSALYDGMEPHHMESPRSLMLPPFSAQSVSPSVPGASNKLIPEVQLPPMSTISIPFT # STVLAPMSIRYLFPNPQPPPPPPTKPYLMQADGKAKKSEICQEFVAVETYTQKLLHDVTVLAKENQIMKEYLGNHELYFDACLRALEENIDLRVKMAV # AAEIDKLQKGEGAEPEDNDSDEDELEDDEVEKKKEVKREGLTSHAASNSNLIKVYCRLFDLTTKENLLGASVPNGDKLPLIPGMDVHQIRFDWENTAK # KSGNGAKLETIAKFAKTHGHDYKSGVKELLDIIQLGDLKSCVETKNLKLEFKRNNLPEDNEYKNMKYNTAMVIQMQSDDEKDPAEPKKFISRAATWHS # RELEGRARRWMVSTEWLNNHPEFDTPNRLADNGRLWGDAKDPEDLERLEAENKKAKKEIKEGKRKVLDDSDVESNRKKKKDNKNQKSRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g700 ### # start gene g701 Scaffold_8 AUGUSTUS gene 1446917 1447966 0.18 + . g701 Scaffold_8 AUGUSTUS transcript 1446917 1447966 0.18 + . g701.t1 Scaffold_8 AUGUSTUS start_codon 1446917 1446919 . + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_8 AUGUSTUS CDS 1446917 1447966 0.18 + 0 transcript_id "g701.t1"; gene_id "g701"; Scaffold_8 AUGUSTUS stop_codon 1447964 1447966 . + 0 transcript_id "g701.t1"; gene_id "g701"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIVRPRPQHLLLHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g701 ### # start gene g702 Scaffold_8 AUGUSTUS gene 1448136 1449569 0.89 + . g702 Scaffold_8 AUGUSTUS transcript 1448136 1449569 0.89 + . g702.t1 Scaffold_8 AUGUSTUS start_codon 1448136 1448138 . + 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_8 AUGUSTUS CDS 1448136 1449569 0.89 + 0 transcript_id "g702.t1"; gene_id "g702"; Scaffold_8 AUGUSTUS stop_codon 1449567 1449569 . + 0 transcript_id "g702.t1"; gene_id "g702"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g702 ### # start gene g703 Scaffold_8 AUGUSTUS gene 1451207 1451818 0.56 + . g703 Scaffold_8 AUGUSTUS transcript 1451207 1451818 0.56 + . g703.t1 Scaffold_8 AUGUSTUS start_codon 1451207 1451209 . + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_8 AUGUSTUS CDS 1451207 1451818 0.56 + 0 transcript_id "g703.t1"; gene_id "g703"; Scaffold_8 AUGUSTUS stop_codon 1451816 1451818 . + 0 transcript_id "g703.t1"; gene_id "g703"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSGTRSQPQSSTKNCSGLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g703 ### # start gene g704 Scaffold_8 AUGUSTUS gene 1453278 1454252 0.16 - . g704 Scaffold_8 AUGUSTUS transcript 1453278 1454252 0.16 - . g704.t1 Scaffold_8 AUGUSTUS stop_codon 1453278 1453280 . - 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_8 AUGUSTUS CDS 1453278 1454252 0.16 - 0 transcript_id "g704.t1"; gene_id "g704"; Scaffold_8 AUGUSTUS start_codon 1454250 1454252 . - 0 transcript_id "g704.t1"; gene_id "g704"; # protein sequence = [MCTQGPITQSNLSKSLSEACQKHGLPIPTAAAAARPRTRSSARPEGSSDREGSDRRISTGIDIESSSDDDGHFEVGTN # GDEEPRPHEDRDRDPSPLPRPRAVAPDTEFREVKMPEAAELSLDPDFASGVAPTFRLGEIPGVRLAYLQAVYLNAMNNMSVKATTENLDMSLNILAST # KALDGGPIPVQTLVSAKQCLGIDPDSCIIQYAICTRCWKHHTPTQVSSLDSPDCTVPNCEGKIYEEFQDTNGNTRRRALKILPQVSLIHNLRRIIRRK # GFRNLFVTRGTLLRMLTMIPILLCMICMMAQCGTNSGLVSSGSRELRGCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g704 ### # start gene g705 Scaffold_8 AUGUSTUS gene 1456077 1456562 0.35 + . g705 Scaffold_8 AUGUSTUS transcript 1456077 1456562 0.35 + . g705.t1 Scaffold_8 AUGUSTUS start_codon 1456077 1456079 . + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_8 AUGUSTUS CDS 1456077 1456562 0.35 + 0 transcript_id "g705.t1"; gene_id "g705"; Scaffold_8 AUGUSTUS stop_codon 1456560 1456562 . + 0 transcript_id "g705.t1"; gene_id "g705"; # protein sequence = [MIKRIDSQAPSIVTLYAPDEEWVFYVGNTHAFQPMVKDKRLIPKELNKPPRYNTPNKNSPSYLEVYVNFENREAMESA # FEMMCRMIRGFDTNLQFIDRAIGLLVKELKVVYERDSRTNVVKQVTELPKKWIAMYNAMKPLGPAGAKVPEDTSSNEVVEKAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g705 ### # start gene g706 Scaffold_8 AUGUSTUS gene 1459347 1459733 0.88 + . g706 Scaffold_8 AUGUSTUS transcript 1459347 1459733 0.88 + . g706.t1 Scaffold_8 AUGUSTUS start_codon 1459347 1459349 . + 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_8 AUGUSTUS CDS 1459347 1459733 0.88 + 0 transcript_id "g706.t1"; gene_id "g706"; Scaffold_8 AUGUSTUS stop_codon 1459731 1459733 . + 0 transcript_id "g706.t1"; gene_id "g706"; # protein sequence = [MRSNQWSKNERLIPKELNNPPDFNLARKNTPSYLEVYANFESPEALASAFNMMCGMIRGFDTNLQFIDRAIGFLVKEL # KVIYEYDSQGVRKQGNRVAGEVDYIVQYDEAHRSSWCEVRYCSEIVKRHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g706 ### # start gene g707 Scaffold_8 AUGUSTUS gene 1465257 1465664 0.98 + . g707 Scaffold_8 AUGUSTUS transcript 1465257 1465664 0.98 + . g707.t1 Scaffold_8 AUGUSTUS start_codon 1465257 1465259 . + 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_8 AUGUSTUS CDS 1465257 1465664 0.98 + 0 transcript_id "g707.t1"; gene_id "g707"; Scaffold_8 AUGUSTUS stop_codon 1465662 1465664 . + 0 transcript_id "g707.t1"; gene_id "g707"; # protein sequence = [MPSDLTTFGVDPLIIKVDELKHWFKAFKESSTFTLTTNSDRPGAVAPLTVDSVFLSATGVAPSSRTFQSSLSLERNYG # YYTPPEETAIAESHNDFVSLEDTTQNRFPDSGTTHVGDSTEEMINIRSKPCMSNSKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g707 ### # start gene g708 Scaffold_8 AUGUSTUS gene 1471298 1471528 1 - . g708 Scaffold_8 AUGUSTUS transcript 1471298 1471528 1 - . g708.t1 Scaffold_8 AUGUSTUS stop_codon 1471298 1471300 . - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_8 AUGUSTUS CDS 1471298 1471528 1 - 0 transcript_id "g708.t1"; gene_id "g708"; Scaffold_8 AUGUSTUS start_codon 1471526 1471528 . - 0 transcript_id "g708.t1"; gene_id "g708"; # protein sequence = [MVEEEEGIEEDEDANAGEDGEDEEGDEEGDEEGEIDDAEEVEEESIVDDASIDLDAEGDTDEEVEWKTRIVVSSCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g708 ### # start gene g709 Scaffold_8 AUGUSTUS gene 1480582 1481451 1 - . g709 Scaffold_8 AUGUSTUS transcript 1480582 1481451 1 - . g709.t1 Scaffold_8 AUGUSTUS stop_codon 1480582 1480584 . - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_8 AUGUSTUS CDS 1480582 1481451 1 - 0 transcript_id "g709.t1"; gene_id "g709"; Scaffold_8 AUGUSTUS start_codon 1481449 1481451 . - 0 transcript_id "g709.t1"; gene_id "g709"; # protein sequence = [MYSFSSSQFFRVYRERDQQRGIFAPLNDIWSLGVILVNLVTRHNPWNYAHSSDPCFDAFLANRDSLRDALPISDPLNL # LLRRIFDFNPVSRINIPTLRNDVLSVETFYAPDEPIDSDLTSCAGPVHPPDGQINSVSSEPSPNIENIQVEVEVDVEVVVGSLQGVSTSNPPTSWSNA # EWNEHKNRLQLLQGLPPRPHKLFVVGSQSISDSSSQDDLLVTPPHGPVELAIEIPEIFDVNRDRSSSSGSPPLRRQPRFAVSPCVAFFKDERMREPEP # IRIVRRMVDALITTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g709 ### # start gene g710 Scaffold_8 AUGUSTUS gene 1482585 1483604 0.54 - . g710 Scaffold_8 AUGUSTUS transcript 1482585 1483604 0.54 - . g710.t1 Scaffold_8 AUGUSTUS stop_codon 1482585 1482587 . - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_8 AUGUSTUS CDS 1482585 1483273 0.65 - 2 transcript_id "g710.t1"; gene_id "g710"; Scaffold_8 AUGUSTUS CDS 1483355 1483604 0.61 - 0 transcript_id "g710.t1"; gene_id "g710"; Scaffold_8 AUGUSTUS start_codon 1483602 1483604 . - 0 transcript_id "g710.t1"; gene_id "g710"; # protein sequence = [MSEFAHFRGPVPSGWSGLGGQCKSAYHPKGSPGGSSSGSGVAASVGLVTVTLGTETDGSITSPSANNNVVGIKPTVGL # TSRAGAAQDTVGPMTRTVQDAAIVLSVIAGEDPNDRRTLSQPHPVPDYSKALDVNALRGKRIGVPRSSIPSDTIDVQSILSAFDESLRIMESLGATIV # DPANLPSAEEIKGLNRLQVLHVDFKIELNEYLAALKEVPTGVRTLADLIQFNIDHAELELPEGYSNQGILIDSEATNGRDEAYGKALARNLELGATRG # IDAALKEYKLDALVLPARDTTTPAAIAGYPTVTGMCNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g710 ### # start gene g711 Scaffold_8 AUGUSTUS gene 1485785 1487231 0.11 + . g711 Scaffold_8 AUGUSTUS transcript 1485785 1487231 0.11 + . g711.t1 Scaffold_8 AUGUSTUS start_codon 1485785 1485787 . + 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_8 AUGUSTUS CDS 1485785 1485931 0.23 + 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_8 AUGUSTUS CDS 1486069 1486248 0.21 + 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_8 AUGUSTUS CDS 1486396 1486656 0.86 + 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_8 AUGUSTUS CDS 1486704 1487231 0.87 + 0 transcript_id "g711.t1"; gene_id "g711"; Scaffold_8 AUGUSTUS stop_codon 1487229 1487231 . + 0 transcript_id "g711.t1"; gene_id "g711"; # protein sequence = [MHMVTSEQDIPNHVQHNKTLDPGLALGPQNCIYTSKNLETGQACSTPTSYKQVKLFSSEVTKLPLNIKPKFYRTCERK # SITLVITNLKAFCTLNIINLSVHPSELVFDLPKLTTIAPKKSQVQLTQLDLEAAKTALRQKQEEQKQQRAQRSARRESYKELSSNISKLTEGSSSQRI # PSPEKKSSTPIETKLCRNCRRAASLLISPLAQHIPLPNSPELTLRQIEKLPASNSIPGSFDHQASEEEDHSINSEQEQSFVEFENFASTQLFPPEFSE # SEEGQELELPESSSAVEQIKQEETDSESLFDLEYKEGSKTPPPFAFSFGQAISPGFLNFNPNSQQTSSPEIHYIKQLSQCLDLLAQCLDLVLEMHQG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g711 ### # start gene g712 Scaffold_8 AUGUSTUS gene 1487383 1488898 0.66 + . g712 Scaffold_8 AUGUSTUS transcript 1487383 1488898 0.66 + . g712.t1 Scaffold_8 AUGUSTUS start_codon 1487383 1487385 . + 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_8 AUGUSTUS CDS 1487383 1487433 0.66 + 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_8 AUGUSTUS CDS 1487567 1488898 0.69 + 0 transcript_id "g712.t1"; gene_id "g712"; Scaffold_8 AUGUSTUS stop_codon 1488896 1488898 . + 0 transcript_id "g712.t1"; gene_id "g712"; # protein sequence = [MSEYSTATSTFTDFKKVSSKERANPPQVAGAAVQPEPLVTNRELVEKFTRALDIGFRNAIFAALHIKGKTRTVPAGQK # VRPDDMYDIDEVIAQGEAIARGTMPGTDPMSSVATNASSSYAPPVHIKQEQFQQQINDLISEKIAVLMDTIKISQDQVRQENSKQINEFMRTYQQNNV # PRGSVPQGYASHQMPAGFEANPVKSQNVEMRDNNKAPYDWHGNLSKVVCYFCSEEGHVANDCHHRQDLLELGRIVLVNGRARLPGNYPIPRQPIGAVS # EKDRIDYYYLEKEKRDKDNAKQVNLVQSTPNNIPGMINTATMSTYLSNQLSDKDLRIANLEKELQSLNNPASQMMYQMPGQMNQFMQQPFYMPQHNPM # MQSQFSQVGWNPSSQMNSYIPSTSPTMHMLNSMYQNQNSMTPNYLTWVCIHNLSSQCLLWLRLRHLFKQEGKRKSRKNEEFNDWDTYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g712 ### # start gene g713 Scaffold_8 AUGUSTUS gene 1489077 1490048 0.23 + . g713 Scaffold_8 AUGUSTUS transcript 1489077 1490048 0.23 + . g713.t1 Scaffold_8 AUGUSTUS start_codon 1489077 1489079 . + 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_8 AUGUSTUS CDS 1489077 1489161 0.25 + 0 transcript_id "g713.t1"; gene_id "g713"; Scaffold_8 AUGUSTUS CDS 1489294 1490048 0.75 + 2 transcript_id "g713.t1"; gene_id "g713"; Scaffold_8 AUGUSTUS stop_codon 1490046 1490048 . + 0 transcript_id "g713.t1"; gene_id "g713"; # protein sequence = [MKGIQAVDEECMIDQYNRLTSLRLDQHIRVTQQRVNSGEQPKSTQVKAQFEELQLDSDTIDIDSLPSVTWEKKTERTN # SGEQISAFVVGDVVLQYLETLAPKETAKQIVVAKDSQSLRSIYPLLNGREHVESLLDSGSQIVSTSQEKAEKAGLIWDPDIVIYMQSANKGLEKSLGL # ARNVPFLIGDMTVLLQVHVIKEPAYDLLLGRPFDALLQTHIQNFADGRQIITLTEPLTNRRITVPTFARGTATILANSSKMEKATESTTANPVAQGFL # IASRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g713 ### # start gene g714 Scaffold_8 AUGUSTUS gene 1491797 1493815 0.56 + . g714 Scaffold_8 AUGUSTUS transcript 1491797 1493815 0.56 + . g714.t1 Scaffold_8 AUGUSTUS start_codon 1491797 1491799 . + 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_8 AUGUSTUS CDS 1491797 1493815 0.56 + 0 transcript_id "g714.t1"; gene_id "g714"; Scaffold_8 AUGUSTUS stop_codon 1493813 1493815 . + 0 transcript_id "g714.t1"; gene_id "g714"; # protein sequence = [MDELKKAIKESPALRKLDYNSDSNVILSVDSSFKGVGFYICQEDEKDKRKRHYARFGSITYNDREARFSQPKRELYGL # YRALQACKYWLFGVRKLTIEVDAKYIKGMLQHPDEVPNAAINRWIEQILMFHFELKHIPGKKHGSDGLSRRDLQPGDKIYVNPEEEYQDEPPAFTVTF # ENGIDTTIPFEAFKDKIDTRTGYTQEIAESVQDFVQLVEEASRNEAKLRAKFVQQYPANGAFLTTLPQIIKPQNFISEERYEEKHRSNKGKEQDNRLL # LVRKWLKNPKWKPDNMSENQYLNFKQFARQFFTKDDKLYQRNIEGKHRLVVGKEHRMSIMKAAHDGLGHRGVYATKSLLMERFWWPELERDANWYVKT # CHLCQQRLKDHIRTPPRLTATPSIFQVLHADTMHMPVSNGKKYFVHGRCHVTSWMEGRALRKETSKTIGDWIYEEIICRWGCLAVIYTDNGTPFLNAI # KYLEERYGIKGIQIAPYRSQANGKIERPHWDVRQALYKAANGIQSRWSYYVVEIMWADRITVRKRLGCSPFFALTGAHPVLPFDIMQATWLMQIPGHV # LSTTELIGLRARALALHTEQVKEIMSKIDQKKQKDTLRYEHMHTNTIKNFDFKPGELVLVRNSQVENSLNAKMLPRWMGPCIVIRRNSWRLLCASRNG # WCSIPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g714 ### # start gene g715 Scaffold_8 AUGUSTUS gene 1493900 1494106 0.92 + . g715 Scaffold_8 AUGUSTUS transcript 1493900 1494106 0.92 + . g715.t1 Scaffold_8 AUGUSTUS start_codon 1493900 1493902 . + 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_8 AUGUSTUS CDS 1493900 1494106 0.92 + 0 transcript_id "g715.t1"; gene_id "g715"; Scaffold_8 AUGUSTUS stop_codon 1494104 1494106 . + 0 transcript_id "g715.t1"; gene_id "g715"; # protein sequence = [MEALDAIANGPEPDNSEAIELESSRIEESLEIEYENDDSIIEPLIRGELNANSGVDYENELSDDEDET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g715 ### # start gene g716 Scaffold_8 AUGUSTUS gene 1494798 1495377 0.93 - . g716 Scaffold_8 AUGUSTUS transcript 1494798 1495377 0.93 - . g716.t1 Scaffold_8 AUGUSTUS stop_codon 1494798 1494800 . - 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_8 AUGUSTUS CDS 1494798 1494941 0.98 - 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_8 AUGUSTUS CDS 1495003 1495164 1 - 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_8 AUGUSTUS CDS 1495225 1495377 0.95 - 0 transcript_id "g716.t1"; gene_id "g716"; Scaffold_8 AUGUSTUS start_codon 1495375 1495377 . - 0 transcript_id "g716.t1"; gene_id "g716"; # protein sequence = [MPACHSAVRALTKRIHEVRAATQPAASVASAINTAGNSNAVTSVPPVMKTKTTRRSNRKGKAPKSVPMIVDTSSEDEE # EVQIIGGDIAMGDSTPPVNNTTSTDSVMSVDSVVPGTTLSVEPMAASTPSIPAPLPANIKFNKNKDKEPIVEVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g716 ### # start gene g717 Scaffold_8 AUGUSTUS gene 1498471 1499472 0.82 - . g717 Scaffold_8 AUGUSTUS transcript 1498471 1499472 0.82 - . g717.t1 Scaffold_8 AUGUSTUS stop_codon 1498471 1498473 . - 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_8 AUGUSTUS CDS 1498471 1499472 0.82 - 0 transcript_id "g717.t1"; gene_id "g717"; Scaffold_8 AUGUSTUS start_codon 1499470 1499472 . - 0 transcript_id "g717.t1"; gene_id "g717"; # protein sequence = [MLSQSQKAFPLVDVPPPQNPLRAAVGRCASMDCGLKLEPSKLKSFQTKAKNRLNVTDMEMLPSLSSPDPGATGELGET # ENVETNDSEALCDQCTWRRLPPDVRRSRKVEVHRRVRIVLDCERDSTKLHTDGGGPSQLKPCIRPNVPVIKLPQRPIPPPKVCFYRTLIRFLIDLDIC # SILQPRNPTPYPEYQSISHLICDLQSLFKSFIQAQGFYLAFSLTCKQNSTASTGHTNKPSEPPHVLNSEAPFSDTTSTNAIHPCNSFNSSKFSNNPSS # LSASKLNPIIPRTMSKFAFDGEFSIVAPDFELLERKDEVNEFVTSAMHQIEKVASVKFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g717 ### # start gene g718 Scaffold_8 AUGUSTUS gene 1499537 1500361 0.4 - . g718 Scaffold_8 AUGUSTUS transcript 1499537 1500361 0.4 - . g718.t1 Scaffold_8 AUGUSTUS stop_codon 1499537 1499539 . - 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_8 AUGUSTUS CDS 1499537 1500361 0.4 - 0 transcript_id "g718.t1"; gene_id "g718"; Scaffold_8 AUGUSTUS start_codon 1500359 1500361 . - 0 transcript_id "g718.t1"; gene_id "g718"; # protein sequence = [MRGWTSGNYVPPAESMKKPAQVVQKRKSSKKRVSWFDGYGKDERESQDAMDVDEDEEIQVVSTETDDDALGADVLIRG # WDSDLTESDEDDFNLNSMLANEPDLSADCNAVLSSGYSSITCTIKHCRNFLPLNYTWKCCPTCRKYRRDHQRKRLGCDIEKDKYQGDQSTFVPSSGSA # SIPLKVHSSSHDVQDHRLIAYIFRRSSQKTNWDHTPYTIPQVLSLSEPGYAPSVAASTSFPTKLSTSSSCASLVGFAVLGVPGFGKQERSSRKPCQAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g718 ### # start gene g719 Scaffold_8 AUGUSTUS gene 1501743 1502252 0.88 + . g719 Scaffold_8 AUGUSTUS transcript 1501743 1502252 0.88 + . g719.t1 Scaffold_8 AUGUSTUS start_codon 1501743 1501745 . + 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_8 AUGUSTUS CDS 1501743 1502252 0.88 + 0 transcript_id "g719.t1"; gene_id "g719"; Scaffold_8 AUGUSTUS stop_codon 1502250 1502252 . + 0 transcript_id "g719.t1"; gene_id "g719"; # protein sequence = [MTLPIDEFIVWEPGTGSKRSQWSCLACDDHVWRDANLARRHENGKGHQQAVKHHREASHYSAPDPFVPNPGTSRRVSP # PLESLLMDLSEGPYETQGHDEPFDFENVQPSSDRNTQPVYGITFDPTEDFTLQPSDVERGMARFAEEMHAWLLEEPDSEXSTIVYTVQYML] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g719 ### # start gene g720 Scaffold_8 AUGUSTUS gene 1503979 1504215 0.77 - . g720 Scaffold_8 AUGUSTUS transcript 1503979 1504215 0.77 - . g720.t1 Scaffold_8 AUGUSTUS stop_codon 1503979 1503981 . - 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_8 AUGUSTUS CDS 1503979 1504215 0.77 - 0 transcript_id "g720.t1"; gene_id "g720"; Scaffold_8 AUGUSTUS start_codon 1504213 1504215 . - 0 transcript_id "g720.t1"; gene_id "g720"; # protein sequence = [MPRVDPLIHNYSQFSSSSSGPHLTSQDEENKEDEEDKENEKEDPIHPFQGDFLVMTTPRGIPRFDDDEVEMMKMGRRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g720 ### # start gene g721 Scaffold_8 AUGUSTUS gene 1506795 1507025 0.65 + . g721 Scaffold_8 AUGUSTUS transcript 1506795 1507025 0.65 + . g721.t1 Scaffold_8 AUGUSTUS start_codon 1506795 1506797 . + 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_8 AUGUSTUS CDS 1506795 1507025 0.65 + 0 transcript_id "g721.t1"; gene_id "g721"; Scaffold_8 AUGUSTUS stop_codon 1507023 1507025 . + 0 transcript_id "g721.t1"; gene_id "g721"; # protein sequence = [MTTQDGWCNQQHLDAVDWDAIENSNDDNDSSGDDESRVYPNPVGDSEDVASVHSGNSHHTEASTTPALAMISTPSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g721 ### # start gene g722 Scaffold_8 AUGUSTUS gene 1517625 1518137 0.11 - . g722 Scaffold_8 AUGUSTUS transcript 1517625 1518137 0.11 - . g722.t1 Scaffold_8 AUGUSTUS stop_codon 1517625 1517627 . - 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_8 AUGUSTUS CDS 1517625 1518137 0.11 - 0 transcript_id "g722.t1"; gene_id "g722"; Scaffold_8 AUGUSTUS start_codon 1518135 1518137 . - 0 transcript_id "g722.t1"; gene_id "g722"; # protein sequence = [MGTASSHGNDPMSATPVVNLPIHTSSPTLPVETDSSSPSTGSAAATTDASPTHTSSSASSDSSSKDPSSSDSKSTVLC # VIYLQIQIYSYSSCCCSRREVPGAEVQLSEGAENSDKKKKENHGNGPRKRKGDREKKHCGTGSSEKSHGGEKETSPKKQRPLAKNMGRVSRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g722 ### # start gene g723 Scaffold_8 AUGUSTUS gene 1522416 1523171 0.99 + . g723 Scaffold_8 AUGUSTUS transcript 1522416 1523171 0.99 + . g723.t1 Scaffold_8 AUGUSTUS start_codon 1522416 1522418 . + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_8 AUGUSTUS CDS 1522416 1523171 0.99 + 0 transcript_id "g723.t1"; gene_id "g723"; Scaffold_8 AUGUSTUS stop_codon 1523169 1523171 . + 0 transcript_id "g723.t1"; gene_id "g723"; # protein sequence = [MTDRPQIEVLTASVPMYFHVSNQDLSLDLAHTLTALNILFADLGKLYENPPPLNPLLPVQHEYPYPRRFKCGNQVITF # TYLKRVDPIRLVFEVETEERKLLYIKYTQQYGAEAHRKAYEFGIAPELLAYDDTLPGGWKMVVMNPIPKGYVEIDGIEGSEEQGKVQAVVIAKMRPYF # DEGFVHGDLRAANIFVDGERQNIMVIDYDWAGRNKEVTYPPDVHSSIDIWRPRAELSLRPIETEHDCQMLKHLYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g723 ### # start gene g724 Scaffold_8 AUGUSTUS gene 1524048 1524623 0.9 - . g724 Scaffold_8 AUGUSTUS transcript 1524048 1524623 0.9 - . g724.t1 Scaffold_8 AUGUSTUS stop_codon 1524048 1524050 . - 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_8 AUGUSTUS CDS 1524048 1524623 0.9 - 0 transcript_id "g724.t1"; gene_id "g724"; Scaffold_8 AUGUSTUS start_codon 1524621 1524623 . - 0 transcript_id "g724.t1"; gene_id "g724"; # protein sequence = [MRFVRKRTTIPVPFIVDYLVSDDNESYLIMELILGETLADQYGSLTEDVCRIIIRDLIDITNELRSIPPPSRPPLVRG # LGSIPIDCRRIQLNGSSSFGPFDSVKAFHEELIKFSNLEFPNQETESAALSKIHRLYEKPHRIVFTHNDLHPGNVMVDANFRIVGILDWESSGWMPEY # WLAFEMCLLVSLHQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g724 ### # start gene g725 Scaffold_8 AUGUSTUS gene 1525322 1525921 0.59 - . g725 Scaffold_8 AUGUSTUS transcript 1525322 1525921 0.59 - . g725.t1 Scaffold_8 AUGUSTUS stop_codon 1525322 1525324 . - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_8 AUGUSTUS CDS 1525322 1525921 0.59 - 0 transcript_id "g725.t1"; gene_id "g725"; Scaffold_8 AUGUSTUS start_codon 1525919 1525921 . - 0 transcript_id "g725.t1"; gene_id "g725"; # protein sequence = [MSTTNTDTPRTLTLKPIVMFPQIVLGLNIVRPFPDPAFHWFLFVANPRSIQGEGTKLHVTDSKNGVWEFEVVTNFTIN # SSSEAITTALIIGEIPEGKLNDVTGLIDICEHQIKLNEVPAADKGKEPKFTCRVWMKEAVRCLNTAGYLRCTDVDELEKEAIARGCAALEEIDGIDAL # DIPQSQKRFVAKLHKSKVSHTVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g725 ### # start gene g726 Scaffold_8 AUGUSTUS gene 1527582 1528019 1 + . g726 Scaffold_8 AUGUSTUS transcript 1527582 1528019 1 + . g726.t1 Scaffold_8 AUGUSTUS start_codon 1527582 1527584 . + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_8 AUGUSTUS CDS 1527582 1528019 1 + 0 transcript_id "g726.t1"; gene_id "g726"; Scaffold_8 AUGUSTUS stop_codon 1528017 1528019 . + 0 transcript_id "g726.t1"; gene_id "g726"; # protein sequence = [MNILTPRRFKCGDQDITFTYLKRVDPIRLVFEVETEEKKLLYIKYTQQYGAEAHRKAYGFGIAPELLAYDDTLPGRWK # MVVMNPIPKGYVETDSIEGSEDQGKVQAVVIAKMKCYFDEGFVHGDLRAANIFVDSERQNIMVIDYD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g726 ### # start gene g727 Scaffold_8 AUGUSTUS gene 1535936 1536262 0.94 - . g727 Scaffold_8 AUGUSTUS transcript 1535936 1536262 0.94 - . g727.t1 Scaffold_8 AUGUSTUS stop_codon 1535936 1535938 . - 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_8 AUGUSTUS CDS 1535936 1536262 0.94 - 0 transcript_id "g727.t1"; gene_id "g727"; Scaffold_8 AUGUSTUS start_codon 1536260 1536262 . - 0 transcript_id "g727.t1"; gene_id "g727"; # protein sequence = [MVDPAIPVKSGDIQAALDFAGIKISEAYLRFQQCKHDAIAQTAPGDFETRSEIMRYVDILLETIDGNIVWQIDPGQYA # TMSLRHPRNAHNGWYQFALRIDDKCNEACG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g727 ### # start gene g728 Scaffold_8 AUGUSTUS gene 1548321 1549142 0.85 - . g728 Scaffold_8 AUGUSTUS transcript 1548321 1549142 0.85 - . g728.t1 Scaffold_8 AUGUSTUS stop_codon 1548321 1548323 . - 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_8 AUGUSTUS CDS 1548321 1548527 0.9 - 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_8 AUGUSTUS CDS 1548570 1549142 0.87 - 0 transcript_id "g728.t1"; gene_id "g728"; Scaffold_8 AUGUSTUS start_codon 1549140 1549142 . - 0 transcript_id "g728.t1"; gene_id "g728"; # protein sequence = [MLKAKDDAVTGLTKGVEFLFKQNKVDYIKGSASFVSPTTISVALNDGGETQVETKNVIIATGSEVAPFPGGGIVIDEE # QIVSSTGALSLQKVPEKMVVIGGGVIGLELGSVWSRLGADVTVVEFLGGIGGAGIDEEVAKQFQRNLTKQGLKFKLNTKVLSAEKENGKVVLKTEAAK # GGKEETVSLILPGLSLDADVVLVSVGRRPYVTGLNIEAVGLEMDNKGRIVIDDQFNTSVKNVKCIGDVTFGPMLAHKAEEEGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g728 ### # start gene g729 Scaffold_8 AUGUSTUS gene 1556527 1557213 0.81 - . g729 Scaffold_8 AUGUSTUS transcript 1556527 1557213 0.81 - . g729.t1 Scaffold_8 AUGUSTUS stop_codon 1556527 1556529 . - 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_8 AUGUSTUS CDS 1556527 1557213 0.81 - 0 transcript_id "g729.t1"; gene_id "g729"; Scaffold_8 AUGUSTUS start_codon 1557211 1557213 . - 0 transcript_id "g729.t1"; gene_id "g729"; # protein sequence = [MLRGISKIVLCCASSGLAALLLPKGHTAHSTFKIPIDIFEGKTCSIKKNSELAELLQKVSLIIWDEVPMQNRYCQEAV # NLTMQDIKSNDQPFGGVTVVFGGDFQQILPVVHKGRREQIVGQCIQRSRLWHDIEVLHLTENKRLSSGTVEDREYANWLLQVGHGSINTLENQVKLDP # SMKCGDTIESLITAIYPSLNLIHPAVNNDSWFLERTILCPRNDLVDQLNMIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g729 ### # start gene g730 Scaffold_8 AUGUSTUS gene 1558633 1559007 0.43 - . g730 Scaffold_8 AUGUSTUS transcript 1558633 1559007 0.43 - . g730.t1 Scaffold_8 AUGUSTUS stop_codon 1558633 1558635 . - 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_8 AUGUSTUS CDS 1558633 1559007 0.43 - 0 transcript_id "g730.t1"; gene_id "g730"; Scaffold_8 AUGUSTUS start_codon 1559005 1559007 . - 0 transcript_id "g730.t1"; gene_id "g730"; # protein sequence = [MAISRHFGKPDLFMTITANPNASETKDALLQGQQANDRPDLIARVFREKVRLMLKLIDNGSFGKCRGRVHTIEFQKRG # LPHIHILIFLHPSARLEDSHKIDQLISAQLPDPETQPRLFRLVENL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g730 ### # start gene g731 Scaffold_8 AUGUSTUS gene 1559806 1560533 0.85 - . g731 Scaffold_8 AUGUSTUS transcript 1559806 1560533 0.85 - . g731.t1 Scaffold_8 AUGUSTUS stop_codon 1559806 1559808 . - 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_8 AUGUSTUS CDS 1559806 1560417 0.85 - 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_8 AUGUSTUS CDS 1560510 1560533 0.9 - 0 transcript_id "g731.t1"; gene_id "g731"; Scaffold_8 AUGUSTUS start_codon 1560531 1560533 . - 0 transcript_id "g731.t1"; gene_id "g731"; # protein sequence = [MQPQIHLQLGFHLTQFNPQIEITGEEAEVGVEATTENHNQVHENNEEQNHNPHYREQYAPAGPLPLAMQPIQNDGVYN # ELSLGKMEIKCSNCKAFHWKAEMLTASRGEEKLFGTCCLSGKVRLPLLEEPPVELLQLFNGEDHNSQHFLENIRTYNAAYAFVSLGLKLQPQNDPELP # QTGVKQFKIKGELWHSLGSLLPEPGKILSMPNYIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g731 ### # start gene g732 Scaffold_8 AUGUSTUS gene 1563858 1564460 0.51 + . g732 Scaffold_8 AUGUSTUS transcript 1563858 1564460 0.51 + . g732.t1 Scaffold_8 AUGUSTUS start_codon 1563858 1563860 . + 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_8 AUGUSTUS CDS 1563858 1564460 0.51 + 0 transcript_id "g732.t1"; gene_id "g732"; Scaffold_8 AUGUSTUS stop_codon 1564458 1564460 . + 0 transcript_id "g732.t1"; gene_id "g732"; # protein sequence = [MQSPPTMIDDRGERRTARQIYLRLKAAYQAAPDRKACLRIQDELLNSQIHGMDIEKFNLKWSSTLTTLRNYGYIPWDT # LISKYISKLPSGPRYVYLKQTLEEDFDQPGVIPNRDLFDKFAIRLENTRNRELLDLADSGGGAYNRRFQRNGTGGTSDKLPDQQKPKDSPNMSKPNTK # PTAYVTTTTSSLPKLLPRLKLWIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g732 ### # start gene g733 Scaffold_8 AUGUSTUS gene 1566391 1567479 0.83 + . g733 Scaffold_8 AUGUSTUS transcript 1566391 1567479 0.83 + . g733.t1 Scaffold_8 AUGUSTUS start_codon 1566391 1566393 . + 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_8 AUGUSTUS CDS 1566391 1567479 0.83 + 0 transcript_id "g733.t1"; gene_id "g733"; Scaffold_8 AUGUSTUS stop_codon 1567477 1567479 . + 0 transcript_id "g733.t1"; gene_id "g733"; # protein sequence = [MLSRPDLNEWLTAEEKEITGLFDLGVFEEVPICPKGRFPIGLKMVYDLKMDGTKKARLVAQGFTQRPEDYGNVHAPVT # RMVSYRIVMAWTAQMDLELFSFDVKQAFLNAPLVEEIYVKQIPGRPIANHPNAVYRLRRALYGLHQASAAWYSTLCKALDEIGFHRCDCDNAVFIGRW # SISPDPSISMPTNGDPLIMLIPVHVDDGLVSTNSIELYQWFITQINRRFKVIDLGPTSTFLGIRIYRDCPRHLLWLSQESYVEDLLEQYGLTECITHD # LPLRYKFDGPEPNSSVYADVDPESLTKIYQALIGCLLFLALCTRPDIAYTVMFLSQFNSKPSPRHLIAAKGTLCYLAKNSDMVSTVRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g733 ### # start gene g734 Scaffold_8 AUGUSTUS gene 1567526 1568002 0.83 + . g734 Scaffold_8 AUGUSTUS transcript 1567526 1568002 0.83 + . g734.t1 Scaffold_8 AUGUSTUS start_codon 1567526 1567528 . + 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_8 AUGUSTUS CDS 1567526 1568002 0.83 + 0 transcript_id "g734.t1"; gene_id "g734"; Scaffold_8 AUGUSTUS stop_codon 1568000 1568002 . + 0 transcript_id "g734.t1"; gene_id "g734"; # protein sequence = [MALSDADWGSNSLDRKSISGFGIFLFGGLVAWSASKQKSIALSSTEAEYMGLTHVLKELLWVQVFTALISLPIPHPFP # LISDNRSSIDIANSRSVSNRSKHIDIRYHFIRSHIEDDSITTIWCSSLDMIADIFTKSLPTDLHYKHSLSLGLVPLPTVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g734 ### # start gene g735 Scaffold_8 AUGUSTUS gene 1568519 1568947 0.75 - . g735 Scaffold_8 AUGUSTUS transcript 1568519 1568947 0.75 - . g735.t1 Scaffold_8 AUGUSTUS stop_codon 1568519 1568521 . - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_8 AUGUSTUS CDS 1568519 1568947 0.75 - 0 transcript_id "g735.t1"; gene_id "g735"; Scaffold_8 AUGUSTUS start_codon 1568945 1568947 . - 0 transcript_id "g735.t1"; gene_id "g735"; # protein sequence = [MWSQAVGAENQRGSNQQGTLAAHRGTVPPQGAPFGTPFVTETQVNQPGTIVNSARSQELAIMIQQQAQVIETLQEQLH # EVRRGSAVEGILTGRPVSKTGNTAGLAQGGSNFIGKIRSGHESYIKFVKMYRSRRVAKFQAMRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g735 ### # start gene g736 Scaffold_8 AUGUSTUS gene 1576658 1577068 0.94 + . g736 Scaffold_8 AUGUSTUS transcript 1576658 1577068 0.94 + . g736.t1 Scaffold_8 AUGUSTUS start_codon 1576658 1576660 . + 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_8 AUGUSTUS CDS 1576658 1577068 0.94 + 0 transcript_id "g736.t1"; gene_id "g736"; Scaffold_8 AUGUSTUS stop_codon 1577066 1577068 . + 0 transcript_id "g736.t1"; gene_id "g736"; # protein sequence = [MIDTPGPRYEFPALEPLGFAGEPNSAMEVDAGTPMVGDEHPISPSVEGSTEVGPRGEATTLEGGRETELLVGGSEGPK # GARTPLFLPDSYPSSPRAPLSSVPAIPVVIDLTMVDDDDDDLYESREEFEARVQEKRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g736 ### # start gene g737 Scaffold_8 AUGUSTUS gene 1579737 1580630 0.48 - . g737 Scaffold_8 AUGUSTUS transcript 1579737 1580630 0.48 - . g737.t1 Scaffold_8 AUGUSTUS stop_codon 1579737 1579739 . - 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_8 AUGUSTUS CDS 1579737 1580630 0.48 - 0 transcript_id "g737.t1"; gene_id "g737"; Scaffold_8 AUGUSTUS start_codon 1580628 1580630 . - 0 transcript_id "g737.t1"; gene_id "g737"; # protein sequence = [MLRSLWAMEFGARHDTLGKALSMKLHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNA # STGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSERYLGP # FKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVA # ADELHADGLVPAFHARYPLKPGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g737 ### # start gene g738 Scaffold_8 AUGUSTUS gene 1583904 1586552 0.86 - . g738 Scaffold_8 AUGUSTUS transcript 1583904 1586552 0.86 - . g738.t1 Scaffold_8 AUGUSTUS stop_codon 1583904 1583906 . - 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_8 AUGUSTUS CDS 1583904 1586552 0.86 - 0 transcript_id "g738.t1"; gene_id "g738"; Scaffold_8 AUGUSTUS start_codon 1586550 1586552 . - 0 transcript_id "g738.t1"; gene_id "g738"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSVLWLSTGFLKRVPASAAPRVPRNQFVMFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNH # VRCAPLHKPIDVFNIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLA # ATHTETPILELPELEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEM # VPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKL # NEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDI # LIFSNDLEEHRRMVREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g738 ### # start gene g739 Scaffold_8 AUGUSTUS gene 1592453 1593052 0.4 + . g739 Scaffold_8 AUGUSTUS transcript 1592453 1593052 0.4 + . g739.t1 Scaffold_8 AUGUSTUS start_codon 1592453 1592455 . + 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_8 AUGUSTUS CDS 1592453 1593052 0.4 + 0 transcript_id "g739.t1"; gene_id "g739"; Scaffold_8 AUGUSTUS stop_codon 1593050 1593052 . + 0 transcript_id "g739.t1"; gene_id "g739"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTQLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQNRNVRIAAASHRKLSNQALREVLGARKGVNGEGIHKGTLQPPPEAPQQPPEAPQPPSEVPQQSPEAPLRAPRTGVKLEEVKDEEYEASQPGP # HKLFPSDRDLGPDDPILMGINEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g739 ### # start gene g740 Scaffold_8 AUGUSTUS gene 1596478 1597083 0.58 + . g740 Scaffold_8 AUGUSTUS transcript 1596478 1597083 0.58 + . g740.t1 Scaffold_8 AUGUSTUS start_codon 1596478 1596480 . + 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_8 AUGUSTUS CDS 1596478 1597083 0.58 + 0 transcript_id "g740.t1"; gene_id "g740"; Scaffold_8 AUGUSTUS stop_codon 1597081 1597083 . + 0 transcript_id "g740.t1"; gene_id "g740"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLELVQGAEVNEYASNLKELHAYLQERIRVANEVYAQYANQKRQEAP # DWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSK # PKKGRPEEVEYLVKWEVIAKNSTLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g740 ### # start gene g741 Scaffold_8 AUGUSTUS gene 1598363 1598803 0.49 - . g741 Scaffold_8 AUGUSTUS transcript 1598363 1598803 0.49 - . g741.t1 Scaffold_8 AUGUSTUS stop_codon 1598363 1598365 . - 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_8 AUGUSTUS CDS 1598363 1598803 0.49 - 0 transcript_id "g741.t1"; gene_id "g741"; Scaffold_8 AUGUSTUS start_codon 1598801 1598803 . - 0 transcript_id "g741.t1"; gene_id "g741"; # protein sequence = [MEDCRVLDQFPALDEALPGAPGQVSTSFSPRFPPLFNPSSQSVSERFRKVQEDLQNATRERRVAVEKLITSTRKNSQL # RTTLLHQQGLVDESNALATRQRRLVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLRNLKGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g741 ### # start gene g742 Scaffold_8 AUGUSTUS gene 1600408 1601682 0.9 + . g742 Scaffold_8 AUGUSTUS transcript 1600408 1601682 0.9 + . g742.t1 Scaffold_8 AUGUSTUS start_codon 1600408 1600410 . + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_8 AUGUSTUS CDS 1600408 1601682 0.9 + 0 transcript_id "g742.t1"; gene_id "g742"; Scaffold_8 AUGUSTUS stop_codon 1601680 1601682 . + 0 transcript_id "g742.t1"; gene_id "g742"; # protein sequence = [MWTSRHTKTGLKSIPKCLYTTQGLGSWLKFFLNRPKIDECLSQAFSKLQNPNPIYQDKMCDIQESPAWQSLRGFLTSK # YHLVFAVYIDWFNPYTNKIAGNILVFSPIELLFLTSDFSQGKVVSCGAIILYCLNLPPEIRFLPENVFIIGMMPAPHSPTIWTISHILVSFQRAIAEF # DLPGKIIPTHSHPGGITVAIRIIPLIADLQAIRKVAGFLSHAAGLFCSFCNCHRDDIEDLDYNSWQMRDGATVRAQAAEWKNLVTVTAKETLARQTGV # RWTPMHDFSYWNPTKHVVLGFMHNFLEGVLAYQLRALWGIGRTKEMVKKIAQILDDESNSSIDTEEYIQESQDLENEAEQASQHGSATGLTEDFNDMD # VDDIGEESNNYDEERDPTPTPQLFIPLDDGEDETDEDFVPQDIETAFNFTPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g742 ### # start gene g743 Scaffold_8 AUGUSTUS gene 1610398 1611352 0.91 - . g743 Scaffold_8 AUGUSTUS transcript 1610398 1611352 0.91 - . g743.t1 Scaffold_8 AUGUSTUS stop_codon 1610398 1610400 . - 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_8 AUGUSTUS CDS 1610398 1610901 0.95 - 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_8 AUGUSTUS CDS 1611047 1611352 0.93 - 0 transcript_id "g743.t1"; gene_id "g743"; Scaffold_8 AUGUSTUS start_codon 1611350 1611352 . - 0 transcript_id "g743.t1"; gene_id "g743"; # protein sequence = [MSPVVCPPLVPRILSQHLYRVENERLAARVRLLESQLASSRQENATLTSALCDTSVSLEARQGELDQLRESVSSAAQQ # QELYDRLLDQVETLKRALPGPPNEAQRGAQNILSSATILGGRVQCSGRSAAEENRSPARGGPLLPGQGDPQEESSDHHEEVSALQEGEGGGQEKGSVH # PEEVSALQEGEGGVTATVLLFLPDPLSPTPIASAASPPSLPPRFSSVATLVIDMTADEDDEDIYESPGSIEHRNYLEGNPGEDDPMEDGPVVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g743 ### # start gene g744 Scaffold_8 AUGUSTUS gene 1615427 1616002 1 + . g744 Scaffold_8 AUGUSTUS transcript 1615427 1616002 1 + . g744.t1 Scaffold_8 AUGUSTUS start_codon 1615427 1615429 . + 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_8 AUGUSTUS CDS 1615427 1616002 1 + 0 transcript_id "g744.t1"; gene_id "g744"; Scaffold_8 AUGUSTUS stop_codon 1616000 1616002 . + 0 transcript_id "g744.t1"; gene_id "g744"; # protein sequence = [MSFGSDPESFLEYALSLPDPVGPDPETSDSSDQSSPSDHNSEQESVQSGTISNPDQSSYDSEFPGPFDYDYLHESSDF # DSDHPGPYDLRYLHSYPSSSASDSVESFHSFASDNSEAPELRPGGDGSGHPHLGPDGRLLDSERERRRVLGLCFYCGGKHMKVDCLKLQARTGQNYDA # DNSESDVPGSDDGSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g744 ### # start gene g745 Scaffold_8 AUGUSTUS gene 1617044 1617526 0.86 - . g745 Scaffold_8 AUGUSTUS transcript 1617044 1617526 0.86 - . g745.t1 Scaffold_8 AUGUSTUS stop_codon 1617044 1617046 . - 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_8 AUGUSTUS CDS 1617044 1617526 0.86 - 0 transcript_id "g745.t1"; gene_id "g745"; Scaffold_8 AUGUSTUS start_codon 1617524 1617526 . - 0 transcript_id "g745.t1"; gene_id "g745"; # protein sequence = [MWVGENSIQRYFKENPSAKTWILNIPPKLTPQLSPTLAGMDVSCHNAYTLHSYQGPSMLATAAAYTLQGESDPTEVAA # VRDLIFKMETHRSKGCSDMRNSSTSPPSEPSSSDTNAGTTPDPEPSKSIPPRIVPPTKPPKPIIGKLPENYVPPQERTVGIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g745 ### # start gene g746 Scaffold_8 AUGUSTUS gene 1619669 1620271 1 - . g746 Scaffold_8 AUGUSTUS transcript 1619669 1620271 1 - . g746.t1 Scaffold_8 AUGUSTUS stop_codon 1619669 1619671 . - 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_8 AUGUSTUS CDS 1619669 1620271 1 - 0 transcript_id "g746.t1"; gene_id "g746"; Scaffold_8 AUGUSTUS start_codon 1620269 1620271 . - 0 transcript_id "g746.t1"; gene_id "g746"; # protein sequence = [MTSCRTGLQNCLSVEDEALLAQFHQGHIDIDFEELLSPVDGPEATHNHITRLEEETGSSEFRNHPVTPLPSISPTPPS # PLTPLSHCTSLPILSPKESVMTTPLPKRDKCSAPKFDLKNEALLPNFLEEFEPTAKAAGIDEDTEKMRRTVLGYLDAKTMRFWQSLDTFDDDMKTWED # FKTEILDYYPGATGTAEVTTEELV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g746 ### # start gene g747 Scaffold_8 AUGUSTUS gene 1622904 1623476 0.98 + . g747 Scaffold_8 AUGUSTUS transcript 1622904 1623476 0.98 + . g747.t1 Scaffold_8 AUGUSTUS start_codon 1622904 1622906 . + 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_8 AUGUSTUS CDS 1622904 1623476 0.98 + 0 transcript_id "g747.t1"; gene_id "g747"; Scaffold_8 AUGUSTUS stop_codon 1623474 1623476 . + 0 transcript_id "g747.t1"; gene_id "g747"; # protein sequence = [MKARIKYAQDSGFNDRLKSLIAEPECNSEDEDADDGSLHILVKNLRSENATHFIKHDIDKGIRTVADLTGSNRHSYRK # KPRKLHPSNKKSIFRKLPKYCALDWFIPEQFNSLPPQIRRRYVNAKIALPSLDKRKKLKVADWAFLSEENFMKKYGNEVQKLYKFPTEEELNAMDPDD # SGSDDASAMDEDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g747 ### # start gene g748 Scaffold_8 AUGUSTUS gene 1628095 1629161 0.37 + . g748 Scaffold_8 AUGUSTUS transcript 1628095 1629161 0.37 + . g748.t1 Scaffold_8 AUGUSTUS start_codon 1628095 1628097 . + 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_8 AUGUSTUS CDS 1628095 1628118 0.37 + 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_8 AUGUSTUS CDS 1628178 1629161 0.81 + 0 transcript_id "g748.t1"; gene_id "g748"; Scaffold_8 AUGUSTUS stop_codon 1629159 1629161 . + 0 transcript_id "g748.t1"; gene_id "g748"; # protein sequence = [MRPYRGLLGISERFRKVQEDLQNATRDRRVAVEKLITSTRKNSQLRTTLLHQQGLVDESNALATRQRRRVEELQEEVH # RVRGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHHLYRCDPATILHHHHCYLGAIIEAVVAFLRRCLDSDDLDVIVHNFRL # ALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYRMILEHSRFDSDSPFLTAAHHAGFVPPPDDSVEPPLHRRMLALSTALPHSDGVGRWENIV # PALPSIDQLTADWEQMMLQYIHHITDTPLSGTDTQGPMSSVEPANELLPEVLCHALPQKLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g748 ### # start gene g749 Scaffold_8 AUGUSTUS gene 1638693 1639484 0.76 - . g749 Scaffold_8 AUGUSTUS transcript 1638693 1639484 0.76 - . g749.t1 Scaffold_8 AUGUSTUS stop_codon 1638693 1638695 . - 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_8 AUGUSTUS CDS 1638693 1639484 0.76 - 0 transcript_id "g749.t1"; gene_id "g749"; Scaffold_8 AUGUSTUS start_codon 1639482 1639484 . - 0 transcript_id "g749.t1"; gene_id "g749"; # protein sequence = [MEARGMDLTTSYYALTTVFMFLITAIYAFKSSVLHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRN # KPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFR # ALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPITEFAYNNAPNASTGITPFFANKGYHPNITVRPRSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g749 ### # start gene g750 Scaffold_8 AUGUSTUS gene 1642700 1644234 0.19 - . g750 Scaffold_8 AUGUSTUS transcript 1642700 1644234 0.19 - . g750.t1 Scaffold_8 AUGUSTUS stop_codon 1642700 1642702 . - 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_8 AUGUSTUS CDS 1642700 1643139 1 - 2 transcript_id "g750.t1"; gene_id "g750"; Scaffold_8 AUGUSTUS CDS 1643210 1643360 0.99 - 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_8 AUGUSTUS CDS 1643720 1643868 0.3 - 2 transcript_id "g750.t1"; gene_id "g750"; Scaffold_8 AUGUSTUS CDS 1643943 1644234 0.53 - 0 transcript_id "g750.t1"; gene_id "g750"; Scaffold_8 AUGUSTUS start_codon 1644232 1644234 . - 0 transcript_id "g750.t1"; gene_id "g750"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDGQP # VQVLTPRRGQPPWSLRLGAAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDTAVYRVWSAKEWFVPDILDPDLDSLPAWTSSFKAL # VKELQDNFGVYDAQGEAEDSLVPNWDSAALKWAYGRGLAECIKDKMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKT # GSANQHNNSQPSGSTAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEEKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g750 ### # start gene g751 Scaffold_8 AUGUSTUS gene 1644943 1647480 0.52 - . g751 Scaffold_8 AUGUSTUS transcript 1644943 1647480 0.52 - . g751.t1 Scaffold_8 AUGUSTUS stop_codon 1644943 1644945 . - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_8 AUGUSTUS CDS 1644943 1647480 0.52 - 0 transcript_id "g751.t1"; gene_id "g751"; Scaffold_8 AUGUSTUS start_codon 1647478 1647480 . - 0 transcript_id "g751.t1"; gene_id "g751"; # protein sequence = [MTLRLEDVIRIQECIPEDVAMVLREVLESMGIEILGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLW # LYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILYRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKID # EESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRHMHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNL # ERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPR # VNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAP # FGTPFVTGAQMNRPGMAFESAHSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQ # ATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQ # GGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEG # RSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g751 ### # start gene g752 Scaffold_8 AUGUSTUS gene 1647570 1648199 0.66 - . g752 Scaffold_8 AUGUSTUS transcript 1647570 1648199 0.66 - . g752.t1 Scaffold_8 AUGUSTUS stop_codon 1647570 1647572 . - 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_8 AUGUSTUS CDS 1647570 1648199 0.66 - 0 transcript_id "g752.t1"; gene_id "g752"; Scaffold_8 AUGUSTUS start_codon 1648197 1648199 . - 0 transcript_id "g752.t1"; gene_id "g752"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g752 ### # start gene g753 Scaffold_8 AUGUSTUS gene 1650602 1651030 0.77 - . g753 Scaffold_8 AUGUSTUS transcript 1650602 1651030 0.77 - . g753.t1 Scaffold_8 AUGUSTUS stop_codon 1650602 1650604 . - 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_8 AUGUSTUS CDS 1650602 1651030 0.77 - 0 transcript_id "g753.t1"; gene_id "g753"; Scaffold_8 AUGUSTUS start_codon 1651028 1651030 . - 0 transcript_id "g753.t1"; gene_id "g753"; # protein sequence = [MVQKSACKGRLEGLLHDNQFTNPATQKLAKILEPRDIFAFMSTPETMTGSQIAKALSDGEPLSKTHYAILLKYMNNSG # REYKSAYTNCRYPSGTLILPTRAKCHSQIPFNNTTSAVPNPMKDKVISNFYSRWIWRYLGNRIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g753 ### # start gene g754 Scaffold_8 AUGUSTUS gene 1654409 1656301 0.49 + . g754 Scaffold_8 AUGUSTUS transcript 1654409 1656301 0.49 + . g754.t1 Scaffold_8 AUGUSTUS start_codon 1654409 1654411 . + 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_8 AUGUSTUS CDS 1654409 1656301 0.49 + 0 transcript_id "g754.t1"; gene_id "g754"; Scaffold_8 AUGUSTUS stop_codon 1656299 1656301 . + 0 transcript_id "g754.t1"; gene_id "g754"; # protein sequence = [MVQCEPESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRTEVPEFFNPGNTATRSPQLRSGTSPNVHALAQNATPPPR # VNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQGVRTNEERWQFTKRRYNTAGLS # GRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKG # GFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRY # DPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAAL # SHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGRE # EPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVQGWLSRFPGLELAPEAPYKSPLRGTRSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g754 ### # start gene g755 Scaffold_8 AUGUSTUS gene 1658104 1659176 0.17 + . g755 Scaffold_8 AUGUSTUS transcript 1658104 1659176 0.17 + . g755.t1 Scaffold_8 AUGUSTUS start_codon 1658104 1658106 . + 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_8 AUGUSTUS CDS 1658104 1658607 0.27 + 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_8 AUGUSTUS CDS 1658694 1659176 0.21 + 0 transcript_id "g755.t1"; gene_id "g755"; Scaffold_8 AUGUSTUS stop_codon 1659174 1659176 . + 0 transcript_id "g755.t1"; gene_id "g755"; # protein sequence = [MDRLLREGTPAYFLHISPRRRSPLLKKCSGRVIAAPEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSI # PVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCAKIFTKID # LRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVDTSGRSLNDYGNHLHAKPEKC # AFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGSQTSIGGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g755 ### # start gene g756 Scaffold_8 AUGUSTUS gene 1662045 1662446 0.43 - . g756 Scaffold_8 AUGUSTUS transcript 1662045 1662446 0.43 - . g756.t1 Scaffold_8 AUGUSTUS stop_codon 1662045 1662047 . - 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_8 AUGUSTUS CDS 1662045 1662446 0.43 - 0 transcript_id "g756.t1"; gene_id "g756"; Scaffold_8 AUGUSTUS start_codon 1662444 1662446 . - 0 transcript_id "g756.t1"; gene_id "g756"; # protein sequence = [MLQYMHHITDTPLPVPDPPVPMSSTGPVPESSVEANVDSPLKRRLSRCPPFWWFPSSSPLFLSEQESPTSPSPPPRSP # VLPLLFGSVASLSIDLTGDDDELYETEEAYASRIDVAMEGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g756 ### # start gene g757 Scaffold_8 AUGUSTUS gene 1665901 1667040 0.86 - . g757 Scaffold_8 AUGUSTUS transcript 1665901 1667040 0.86 - . g757.t1 Scaffold_8 AUGUSTUS stop_codon 1665901 1665903 . - 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_8 AUGUSTUS CDS 1665901 1667040 0.86 - 0 transcript_id "g757.t1"; gene_id "g757"; Scaffold_8 AUGUSTUS start_codon 1667038 1667040 . - 0 transcript_id "g757.t1"; gene_id "g757"; # protein sequence = [MWTSRHTKTGLKSIPKCLYTTQGLGSWLKFFLNRPKIDECLSQAFSKLQNPNPIYQDKMCDIQESPAWQSLRGFLTSK # YHLVFAVYIDWFNPYTNKIAGNILVFSPIELLFLTSDFSQGKVVSCGAIILYCLNLPPEIRFLPENVFIIGMMPAPHSPTIWTISHILVSFQRAIAEF # DLPGKIIPTHSHPGGITVAIRIIPLIADLQAIRKVAGFLSHAAGLFCSFCNCHRDDIEDLDYNSWQMRDGATVRAQAAEWKNLVTVTAKETLARQTGV # RWTPMHDFSYWNPTKHVVLGFMHNFLEGVLAYQLRALWGIGRTKEMVKKIAQILDDESNSSIDTEEYIQESQDLENEAEQASQHGSATGLTEDFNDMD # VDDIGEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g757 ### # start gene g758 Scaffold_8 AUGUSTUS gene 1667443 1667727 0.72 - . g758 Scaffold_8 AUGUSTUS transcript 1667443 1667727 0.72 - . g758.t1 Scaffold_8 AUGUSTUS stop_codon 1667443 1667445 . - 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_8 AUGUSTUS CDS 1667443 1667727 0.72 - 0 transcript_id "g758.t1"; gene_id "g758"; Scaffold_8 AUGUSTUS start_codon 1667725 1667727 . - 0 transcript_id "g758.t1"; gene_id "g758"; # protein sequence = [MPPRPKVICTCSNCSNLTCENTHGIRVPGQRVSPQTRIEHIRKDKESKESKEQGANPSTSDSRERSMETGGAQLLEEI # EITSQTPQIFDLSAGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g758 ### # start gene g759 Scaffold_8 AUGUSTUS gene 1668027 1668398 0.75 - . g759 Scaffold_8 AUGUSTUS transcript 1668027 1668398 0.75 - . g759.t1 Scaffold_8 AUGUSTUS stop_codon 1668027 1668029 . - 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_8 AUGUSTUS CDS 1668027 1668398 0.75 - 0 transcript_id "g759.t1"; gene_id "g759"; Scaffold_8 AUGUSTUS start_codon 1668396 1668398 . - 0 transcript_id "g759.t1"; gene_id "g759"; # protein sequence = [MPFSLTKAPAAFQPFVNNIFSDMLDVCVIVYINDILIYSDTPEEHQEHVKEVLWWLQKYWPYANPDKCKFNMNTIEYL # GYILSPDGLTMSKEKVQTILEWPVPRKVKDIQSFLGFANFYCHFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g759 ### # start gene g760 Scaffold_8 AUGUSTUS gene 1668714 1668938 0.59 - . g760 Scaffold_8 AUGUSTUS transcript 1668714 1668938 0.59 - . g760.t1 Scaffold_8 AUGUSTUS stop_codon 1668714 1668716 . - 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_8 AUGUSTUS CDS 1668714 1668938 0.59 - 0 transcript_id "g760.t1"; gene_id "g760"; Scaffold_8 AUGUSTUS start_codon 1668936 1668938 . - 0 transcript_id "g760.t1"; gene_id "g760"; # protein sequence = [MEPILLHAIHSEVAACAADHSSTAPTVPPLHHSIPEEYAKSADVFDEIAADSLPEHRLYNWKIDLEEGTSPPLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g760 ### # start gene g761 Scaffold_8 AUGUSTUS gene 1669735 1670801 0.43 - . g761 Scaffold_8 AUGUSTUS transcript 1669735 1670801 0.43 - . g761.t1 Scaffold_8 AUGUSTUS stop_codon 1669735 1669737 . - 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_8 AUGUSTUS CDS 1669735 1670606 0.73 - 2 transcript_id "g761.t1"; gene_id "g761"; Scaffold_8 AUGUSTUS CDS 1670660 1670684 0.7 - 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_8 AUGUSTUS CDS 1670775 1670801 0.61 - 0 transcript_id "g761.t1"; gene_id "g761"; Scaffold_8 AUGUSTUS start_codon 1670799 1670801 . - 0 transcript_id "g761.t1"; gene_id "g761"; # protein sequence = [MSASPRRPVPVGGDPDDVQKQEDLALVFNDHPKYFTDQWKVNYTLSYLSGSAKEWFVPNILDPDLDSLPIWTSSFKAL # VKELQDNFSIYDAQGEAEDSLGNLKMKETKNIQFNTLAASTNWDSAALKWVYGRGLAECIKDEMALLPEPATLADYCQEVLCIDNCYWKREETKKHEA # GKPFIAQNPKKGSLDFKAGSTNQQNNSQPSGSSAPFMLKPKPFNGGKPQNSSNSGQTGSQCPVFNHLSANGKVLPSERERRMKNNLCLFCGGKHQIAD # CNKQKARESKGCAAEVEETPDTTPIVVEEELEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g761 ### # start gene g762 Scaffold_8 AUGUSTUS gene 1673419 1676171 0.61 - . g762 Scaffold_8 AUGUSTUS transcript 1673419 1676171 0.61 - . g762.t1 Scaffold_8 AUGUSTUS stop_codon 1673419 1673421 . - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_8 AUGUSTUS CDS 1673419 1673819 0.83 - 2 transcript_id "g762.t1"; gene_id "g762"; Scaffold_8 AUGUSTUS CDS 1673921 1676171 0.61 - 0 transcript_id "g762.t1"; gene_id "g762"; Scaffold_8 AUGUSTUS start_codon 1676169 1676171 . - 0 transcript_id "g762.t1"; gene_id "g762"; # protein sequence = [MIHQEEQTSNHVQVIEEEQVLEGNEGEEVIWGAVIELERLQEEEAIGLAVTRGNNEGATKHEEQTKPHTTPRTQPAFN # YESKAVDPQAANRMFKRILAVVVPDVTVNDLVSLSSDLRKELIEHTRTQRAPRDKVPPPSSSLLTKSLQLDYSTPLREIPVTLAGKKVEVGLLDEGSE # IVVVRKDLWEEIGFKVNPMVKMLMQTANGGKEEMEGCAEFLEVVVDGLRTWVHAFVVPRAPYKLLLGRPWQKSMKLAKEEHSDGRVDVIIHDPMGLEH # PRRIPTTARTGRGGSFVMNTEAVTNLWKEEPNMTTPPSANPGSTDLPLSFSNFLLSSTHHYDQINHVFAYRKVANKVLPVPTVMPEYAKIIRRIPEDP # LLTLPTVSQHPPPFTPGTRLTQERMDALGIFKNEFLWPEEKLLAAHVLMNNEMALAWNEAEKGLFREDYFPPAKIPMIAHTPWADRTLPIPPGIRDKV # IQHIRDKIASGLYEPSNSSYRSQWFIVMKPNGGLRMVHNLRKLNAVTIRDTGQPPLIHLYVEQCGGRGIYTGLDIFVGYDHGALHVDSRDPTTFDTPI # GTLRLARIPQGWTGSMPIFHGHMAFLLQDEMEVAPNFVDDVPVLGSKTRYELEGGRFEVLEDNPGIRRFVWEHLVDVNRVLHRLKHAGATASAKKLLI # GVPELKITGTICTYEGRRPDNTKVVKIQTWPSCESVTEVRGFLGTAGVVRIWILNFALITRPLVELTKRHRVPMASRTPTGYGQKSLSPNTTRRIDVD # HPDSGPSLGTNVNPGTPKQKSNFMASSVAFHSMKLYLIGVQKLTVEMDASYVKGMINNPDMHPNAAMNRWIAAIQLFDFELKHVPGKDFVGPDGLSRR # RQTEDEGDEGKGKQTHGLRRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g762 ### # start gene g763 Scaffold_8 AUGUSTUS gene 1676439 1677526 0.38 - . g763 Scaffold_8 AUGUSTUS transcript 1676439 1677526 0.38 - . g763.t1 Scaffold_8 AUGUSTUS stop_codon 1676439 1676441 . - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_8 AUGUSTUS CDS 1676439 1676473 0.38 - 2 transcript_id "g763.t1"; gene_id "g763"; Scaffold_8 AUGUSTUS CDS 1676530 1677526 0.38 - 0 transcript_id "g763.t1"; gene_id "g763"; Scaffold_8 AUGUSTUS start_codon 1677524 1677526 . - 0 transcript_id "g763.t1"; gene_id "g763"; # protein sequence = [MSTTRATTKGPAAMPAPGSSKAPTKFTGEAQDLKDFIEEFEDCADAQELTSEEKVKMVAKYVDRETKRYWKTLDAYAK # KDWGALKKELLKAYPGAEKGHRFSVLGLRRLAQKQARKRIASENDLVKYYQHFQVMSAALKADNKLTDNEVNRYFWFGIHQDDRRDILTQLENQDRAF # DRKTVPTMQKAVEAGRVVFCDEAMDLDWDDPIAEIVSKDTKRKKKIGRERREVISSEEDESSDSDNESDDEEEDRPKKKTVRQEVQTKVVARSNLDDI # EELAKKLRGLDVGDVNYAGTYARLVVLSPAVASAILSLPPQPMSPQQAASALPIQPYPQQLPSAKSTME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g763 ### # start gene g764 Scaffold_8 AUGUSTUS gene 1680225 1681595 0.99 - . g764 Scaffold_8 AUGUSTUS transcript 1680225 1681595 0.99 - . g764.t1 Scaffold_8 AUGUSTUS stop_codon 1680225 1680227 . - 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_8 AUGUSTUS CDS 1680225 1681595 0.99 - 0 transcript_id "g764.t1"; gene_id "g764"; Scaffold_8 AUGUSTUS start_codon 1681593 1681595 . - 0 transcript_id "g764.t1"; gene_id "g764"; # protein sequence = [MQEENRVQSAREIVLLQENEELQARLKSNNNAAISKEKEFEHLSLQMLDAQKRIADAERDYAEILASRESFAAKLVDR # DRELEKVKDEFAQVVQSLKTARDIAITEATRLRHELEGLTATTAVKHADFLSTHNALQINLDNTLHELDTERIRFADEIHALTECRDSLRGDVERIRH # EREALSNDSERTISALRIKLQAEARERQAEHDQAISVAARALEEFRVLEYAKDSTQAECQKLKGTISILEATVHDNEKQYIVVQRSLETSRKSFAEEI # SILQKERDTLKLNVALSKQQLEKAQTETLHNTREAEEKIEILRSEKDDLLKSKNREVETWKRVMQARIDTIQTERNELSRRAEASDVKVNTLSSEKAN # LERELEDCRVRHLGLPYLQSRLAVVEKNLLEERKAKGEAQKNLSEKNAELSNLHQRLNLDKPGVNGSPKVTVERSLPARRFRPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g764 ### # start gene g765 Scaffold_8 AUGUSTUS gene 1681627 1682219 0.99 - . g765 Scaffold_8 AUGUSTUS transcript 1681627 1682219 0.99 - . g765.t1 Scaffold_8 AUGUSTUS stop_codon 1681627 1681629 . - 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_8 AUGUSTUS CDS 1681627 1682052 0.99 - 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_8 AUGUSTUS CDS 1682112 1682219 0.99 - 0 transcript_id "g765.t1"; gene_id "g765"; Scaffold_8 AUGUSTUS start_codon 1682217 1682219 . - 0 transcript_id "g765.t1"; gene_id "g765"; # protein sequence = [MAHSPTFHSNIATAEDFADVQDVEIELLDMTNATREGSVDFSDAVSTSSGVESSLEFSDLEETGSEEPQVVEAVSHSW # RPSDLTDSESDEDQIVAETISQSSHLSLSPQSVSLPLPLSSPAEGSYSEVYDSGHDELDEEPTELETSVHVLDAERQRHCAAITELEDRHAKDMIEHC # T] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g765 ### # start gene g766 Scaffold_8 AUGUSTUS gene 1686987 1690837 0.13 + . g766 Scaffold_8 AUGUSTUS transcript 1686987 1690837 0.13 + . g766.t1 Scaffold_8 AUGUSTUS start_codon 1686987 1686989 . + 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_8 AUGUSTUS CDS 1686987 1687441 0.14 + 0 transcript_id "g766.t1"; gene_id "g766"; Scaffold_8 AUGUSTUS CDS 1688438 1688865 0.76 + 1 transcript_id "g766.t1"; gene_id "g766"; Scaffold_8 AUGUSTUS CDS 1688919 1690837 1 + 2 transcript_id "g766.t1"; gene_id "g766"; Scaffold_8 AUGUSTUS stop_codon 1690835 1690837 . + 0 transcript_id "g766.t1"; gene_id "g766"; # protein sequence = [MYGFAHNQVFPQPPVSTSGPPVQPVQNPTLGKKNSSQQPNTVPGHLSAADAGLNTVPSINIVPPTPVLGSVVLPSQQT # AKSTSPSEYQLAGKKNPLLSPNTTPESWDGWLDGNLEADFTWEELAQTGDLRVHWARKDYGSRAGVGNAFAEHCAAEVLLRGCEEHFRASVTRIKKIH # GVVPVHSEKHFEELVLGLISAKDLDDFHARVEVIQRDFPLTNSWLGWWLRESNARMLFETHTRMEPDIWTSIPNTTNAQEAQHWKLYSAVGRDHGLLE # GLEALHAVAETTVKLFTANLEGGLIRYGKAEPWKAMINLIGRSKPSRAPGGRSTKQKSDGRPPDTKKDLLSRTPKKSKELPSTHHTNSAIVGPASYRW # DNMSCWADSAWDLLYRSIVKDWASFSSRFSSDSQTERPIRDFYNLMLLRRNAEHDSFILKVPDYDLSTALSSQRDQFRRRLVEWRIIKSDNAVGNAFV # SYSSYVSQQSYLNLTYCWKDWFPQVLKDKLNDDLDDDNWTQSYFQTMFVTIKHCSGDGNGHHYQVCQKPEIRYLIVLRQAACQEFKGDLLSWLQTFAN # VNHSPQALPTCWRARDGESWCKGSQTDVKFILSLPVVLILEEEECTTSTEFWNFPALLQPYKSGELATVTYDIVGRIFYSRSKNHYISRFLDEDGKTV # WTYDDMAHGGCPYVEPGATAGTHLTGSSSTLKLPSDFIGAFAIYHLRNGTSTQEAIYTSQLAVARRVHHMMVEPDSLRHHVPKIWLSRVKFAQLTPHD # LTWLKNPFRLDTLDYQETTESSGTIRIPPRSTLSYQPNHESSPFLSSPTSKNLLEPNSVSPQEQDQMHSVETLDHGLNVDLIEEYLQEGTSDFQFMCR # CGITTTNETLVVHNSSTGDIIQCDNCDIWSHIACQKEGRAGGLRQTREPFQCDGCAGNSRAIIDSFIPGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g766 ### # start gene g767 Scaffold_8 AUGUSTUS gene 1691245 1692200 0.41 + . g767 Scaffold_8 AUGUSTUS transcript 1691245 1692200 0.41 + . g767.t1 Scaffold_8 AUGUSTUS start_codon 1691245 1691247 . + 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_8 AUGUSTUS CDS 1691245 1691937 0.41 + 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_8 AUGUSTUS CDS 1691988 1692200 0.73 + 0 transcript_id "g767.t1"; gene_id "g767"; Scaffold_8 AUGUSTUS stop_codon 1692198 1692200 . + 0 transcript_id "g767.t1"; gene_id "g767"; # protein sequence = [MLLRSKLVQLGRWDHPPLRLSEEDILMQFEDYPYTEEVNDALKPHLEFLKTLHCSPQDCSVEEVPAKVYVEKSKKPIH # QCTIPFTGGLTIEDQARVANWFEKFVSQTPSISRSKWHSLLAHAHAITLFLDHRLHRTATGMSESERLHNAWNHQTTTRQISSNSSNTIDVDLECLEY # LETRMFERSREAGVAGWYQWGLDVGYHQDNWDPYIGLREGLNHFNFQDEKGDSLEVGSNYSRYIDDKEGEKKKIDTKDEVLQQPAGLTPRPKPRSMRR # TKRNRAEVEEEETGKFERLSKRSSRQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g767 ### # start gene g768 Scaffold_8 AUGUSTUS gene 1696713 1697896 0.44 + . g768 Scaffold_8 AUGUSTUS transcript 1696713 1697896 0.44 + . g768.t1 Scaffold_8 AUGUSTUS start_codon 1696713 1696715 . + 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_8 AUGUSTUS CDS 1696713 1697234 0.45 + 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_8 AUGUSTUS CDS 1697282 1697896 0.65 + 0 transcript_id "g768.t1"; gene_id "g768"; Scaffold_8 AUGUSTUS stop_codon 1697894 1697896 . + 0 transcript_id "g768.t1"; gene_id "g768"; # protein sequence = [MKEPWVKFGTKLKLREFKELLDYLPRTSSVAVISASSLQKELFTDSGAGTLIRRGYKLFKHDSIESLGADRFRQVIHD # RDPEVISGDQSVTEVLNRIQKTPYTIYGDEPMDVIAVVSHPEGEMPVMSKLLSSRSGVLNSVVDNVFNAIKKDHRKLFGPPKLTTRTGRGTLSAQTDV # REVEKVVRDFEAKERIERSYLPVGPGAPPHKAGVAATPAGTRAFSTWIRGRNIPGSSRGYATSAADAPSPVSTEIKRLGLIGARGFTGQALTNILSGH # PYLNLTHVSSRQLAGYPLTGYRTPVTYSNLSPEDVERMEKDGEVDAWVMALPNGACKPFVDAVDRGSKERSSEPSAIVDLSADYRFEKEWVYGLPGER # HASAGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g768 ### # start gene g769 Scaffold_8 AUGUSTUS gene 1701608 1703665 0.37 + . g769 Scaffold_8 AUGUSTUS transcript 1701608 1703665 0.37 + . g769.t1 Scaffold_8 AUGUSTUS start_codon 1701608 1701610 . + 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_8 AUGUSTUS CDS 1701608 1702064 0.38 + 0 transcript_id "g769.t1"; gene_id "g769"; Scaffold_8 AUGUSTUS CDS 1703265 1703665 0.48 + 2 transcript_id "g769.t1"; gene_id "g769"; Scaffold_8 AUGUSTUS stop_codon 1703663 1703665 . + 0 transcript_id "g769.t1"; gene_id "g769"; # protein sequence = [MPLPPFHAFAFLTQFIYPIFASISAALYPPVVTKPDALPITPTPNNILPQVQATKSNCIMVVPAMLQIWAQDEEDVKV # LQGLKAVVSFYLLLALTRSLFNDTCPPDFRRGPLSPSTGDFLVSQGVHLRSLYGGTEFGIVSDIDIDEKEDENWRLVRDPSQNSKDTSHEEAMEEMIM # RYSKGLDELLNGVKPAAREPFGHVVLLTGSTGNLGALILAMLLSNKAVARVYALNRPSSQASTLERHIKRFEDKALDTSVLSSDKLVFLEGETSNPHL # GLTDHVYNEVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g769 ### # start gene g770 Scaffold_8 AUGUSTUS gene 1712995 1714166 0.7 - . g770 Scaffold_8 AUGUSTUS transcript 1712995 1714166 0.7 - . g770.t1 Scaffold_8 AUGUSTUS stop_codon 1712995 1712997 . - 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_8 AUGUSTUS CDS 1712995 1713488 0.76 - 2 transcript_id "g770.t1"; gene_id "g770"; Scaffold_8 AUGUSTUS CDS 1713545 1714166 0.7 - 0 transcript_id "g770.t1"; gene_id "g770"; Scaffold_8 AUGUSTUS start_codon 1714164 1714166 . - 0 transcript_id "g770.t1"; gene_id "g770"; # protein sequence = [MPSFIPSIPLANIDELNELWEADERLPTLSSRREWSIARNLQPTAVNEWWWARRRQARDLGVGLSCENYHLSVSNPPD # TVLIKIEPVDEDLPISPDASRCSSPSNDTLSVSHDPSSEDCDLSSQLLFSEKSEPGSPQTSLAPSSDQNDSKNMDICAHTHNEDLVTEALPSCGLHLP # PELFQIQQPPAASFPEDTSGDDEVMLVDESSILRPIRSWQRKLWSTSTSIPQHCESVSLSCYSFLSLDGKTFTPNGSYSTQAADSEDPNIHIIKTTTQ # PYEFPLLSEWSGSDYLPHLPPTEAEPMESECPSECPLFASTHTWYRRHVDSPQYDTIIDTDLELDTDTLEYHAFSKHLYLQWTGDEGWLMRKELYVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g770 ### # start gene g771 Scaffold_8 AUGUSTUS gene 1721460 1722925 0.17 - . g771 Scaffold_8 AUGUSTUS transcript 1721460 1722925 0.17 - . g771.t1 Scaffold_8 AUGUSTUS stop_codon 1721460 1721462 . - 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_8 AUGUSTUS CDS 1721460 1721917 0.79 - 2 transcript_id "g771.t1"; gene_id "g771"; Scaffold_8 AUGUSTUS CDS 1721992 1722700 0.44 - 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_8 AUGUSTUS CDS 1722794 1722925 0.37 - 0 transcript_id "g771.t1"; gene_id "g771"; Scaffold_8 AUGUSTUS start_codon 1722923 1722925 . - 0 transcript_id "g771.t1"; gene_id "g771"; # protein sequence = [MIRSNSDTTTTTSTGSPTPVSPFSSDYSVPSEPTSDGEWYMQFTPPLRTANSTLAQLANTTSSSSRSLATSSSDLRED # KSTVWSHRPIANYLSLSDPVTTDAESTDRDRPRTVQIEAVDDDFYDHDNTNDDNDHDESDEQLRSQDLGLFDVEEQPSLGYLDEALQFIAAERERWTA # QRETGTTAAMLTGIDPRRKRRRKRNKTPRAQSTTRTPTVSTFSSISTITASTALADDLNDAEDADALGVDADDSSSSVEQQSSPLRASQSVIFSSTPG # TPSRRAQRDEEDESTDSVTEDSPRVQQLKLLGKKLEALFPEDREYLKKVRYRTMSPPRAASGSLQMSGPAGYLDSVDAEGPSKHVVLGGFVDTRGDPL # KRTGKKDERLIHVFVDQFVYSLLRISPSTHYLIKLQHTNWTTELSPAIPSATPSVPWIFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g771 ### # start gene g772 Scaffold_8 AUGUSTUS gene 1727499 1727846 0.69 + . g772 Scaffold_8 AUGUSTUS transcript 1727499 1727846 0.69 + . g772.t1 Scaffold_8 AUGUSTUS start_codon 1727499 1727501 . + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_8 AUGUSTUS CDS 1727499 1727846 0.69 + 0 transcript_id "g772.t1"; gene_id "g772"; Scaffold_8 AUGUSTUS stop_codon 1727844 1727846 . + 0 transcript_id "g772.t1"; gene_id "g772"; # protein sequence = [MLTTEKSYPAVFTPPRNPSELEEAEDVAEEDAAVTLLEVVVDFTDEDAVAELVVVAFTDEDVVTELRAVVDFTDEDAV # TELDKVVEDTAATTEVRLEVDADEAKVELELAVTGKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g772 ### # start gene g773 Scaffold_8 AUGUSTUS gene 1731195 1731835 0.45 - . g773 Scaffold_8 AUGUSTUS transcript 1731195 1731835 0.45 - . g773.t1 Scaffold_8 AUGUSTUS stop_codon 1731195 1731197 . - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_8 AUGUSTUS CDS 1731195 1731461 0.61 - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_8 AUGUSTUS CDS 1731515 1731835 0.46 - 0 transcript_id "g773.t1"; gene_id "g773"; Scaffold_8 AUGUSTUS start_codon 1731833 1731835 . - 0 transcript_id "g773.t1"; gene_id "g773"; # protein sequence = [MHLFSLLVITTLTVTAATALAEQKQQPLLALDRTTITTAKDILTPMIDEFIEKTLADWNSAGGVGIAVVQKNEEGSWN # VETKGYGIAKVDGSKVTENTLFSIGSNSKLFDVIATGLLISNESLSPRISWNTKIASVIPEWELSDPVASTESTIIDLMSHRTGLPRHDIAYHETQSA # QSLVCLTFLVPLLPISIAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g773 ### # start gene g774 Scaffold_8 AUGUSTUS gene 1739677 1739946 0.69 - . g774 Scaffold_8 AUGUSTUS transcript 1739677 1739946 0.69 - . g774.t1 Scaffold_8 AUGUSTUS stop_codon 1739677 1739679 . - 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_8 AUGUSTUS CDS 1739677 1739946 0.69 - 0 transcript_id "g774.t1"; gene_id "g774"; Scaffold_8 AUGUSTUS start_codon 1739944 1739946 . - 0 transcript_id "g774.t1"; gene_id "g774"; # protein sequence = [MDVFSGELLFFAAFSRAATHSDSGTNGNALGSSRFLAAFKAFRMASITDVQDTGNGWTRLTTMGISSSEVKATSRIAS # DIASMGAHETT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g774 ### # start gene g775 Scaffold_8 AUGUSTUS gene 1743345 1745190 0.12 - . g775 Scaffold_8 AUGUSTUS transcript 1743345 1745190 0.12 - . g775.t1 Scaffold_8 AUGUSTUS stop_codon 1743345 1743347 . - 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_8 AUGUSTUS CDS 1743345 1744123 0.49 - 2 transcript_id "g775.t1"; gene_id "g775"; Scaffold_8 AUGUSTUS CDS 1744884 1745190 0.17 - 0 transcript_id "g775.t1"; gene_id "g775"; Scaffold_8 AUGUSTUS start_codon 1745188 1745190 . - 0 transcript_id "g775.t1"; gene_id "g775"; # protein sequence = [MGNFSEWARSIGMLFSNQPAYNLQLDTAASAAIPDTPEIESFGVPTIDEARQLSGGVHLGNRTIFSSETGARVEEANV # IRMVELLQDANAQYAAGVNVVMIHAINFTLTLNPGFEGSPFALDPWSGEVIPVVLYSNLSSGNISIPEISLAPSQTALFAITSGDSLEGVPVVNGHLV # SGDPNVTAVALTNSSPCSQQFELRSPDEGMKQFITEAGETMSANFSLEGETSQVLDGWQLNVTAWTPPQNLSDHRSVLIPQAAINLTQGLVPWSSIEG # LNNISGVGTYSTSFEWSHADDGAVGLLLDFGEIFHTLKARLNDKQVATADPTHPVVDISKLVVNGTNTIIVDVASTLLNAVNAVSLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g775 ### # start gene g776 Scaffold_8 AUGUSTUS gene 1745251 1746243 0.86 - . g776 Scaffold_8 AUGUSTUS transcript 1745251 1746243 0.86 - . g776.t1 Scaffold_8 AUGUSTUS stop_codon 1745251 1745253 . - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_8 AUGUSTUS CDS 1745251 1746243 0.86 - 0 transcript_id "g776.t1"; gene_id "g776"; Scaffold_8 AUGUSTUS start_codon 1746241 1746243 . - 0 transcript_id "g776.t1"; gene_id "g776"; # protein sequence = [MAQSFGLITIDPTDFAFGSDRFVNVAASAVQAAMDNNLTIDFALGPVEGAGVPVLPEDVDMEGMNTELVFGSHFLAAG # ESFNGPIPQPEIYPFLRFDDTIASANISQMQLVSVIGAQVVEGANISSTRVSLDFNTVQDLTSQVQSSGDSMTVSWTPPSNGTNVILSYFSRRNGYPE # ARPGFNGPEPDKPGSWGSWAVDHFSVKGFNISATFIENNLLSNVDIAEMLALPGVGQYMWEDSMEYQAQLFWTDAFPKRFLERHGYEVNITLPVLHTL # PSSKLTRIPLTTDIYTHHIILKDAQTTPNQTFDYGTSFDWEKFTEDYQDTLVRSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g776 ### # start gene g777 Scaffold_8 AUGUSTUS gene 1750050 1750466 0.63 - . g777 Scaffold_8 AUGUSTUS transcript 1750050 1750466 0.63 - . g777.t1 Scaffold_8 AUGUSTUS stop_codon 1750050 1750052 . - 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_8 AUGUSTUS CDS 1750050 1750466 0.63 - 0 transcript_id "g777.t1"; gene_id "g777"; Scaffold_8 AUGUSTUS start_codon 1750464 1750466 . - 0 transcript_id "g777.t1"; gene_id "g777"; # protein sequence = [MQLVGVIGAQVADEANISSTRVSLDFNTVQDLTSQVQFSGDSLTVSWTPPSNGTNVVLAYFSRRNGYPEARPGFNGPD # PNEPGSWGSWVVDHFSVKGVNISTTFIQNNILSNADIAEMLVFLELDSICGKTAWSIRRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g777 ### # start gene g778 Scaffold_8 AUGUSTUS gene 1754152 1755192 0.31 - . g778 Scaffold_8 AUGUSTUS transcript 1754152 1755192 0.31 - . g778.t1 Scaffold_8 AUGUSTUS stop_codon 1754152 1754154 . - 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_8 AUGUSTUS CDS 1754152 1754675 0.48 - 2 transcript_id "g778.t1"; gene_id "g778"; Scaffold_8 AUGUSTUS CDS 1754768 1755087 0.62 - 1 transcript_id "g778.t1"; gene_id "g778"; Scaffold_8 AUGUSTUS CDS 1755176 1755192 0.98 - 0 transcript_id "g778.t1"; gene_id "g778"; Scaffold_8 AUGUSTUS start_codon 1755190 1755192 . - 0 transcript_id "g778.t1"; gene_id "g778"; # protein sequence = [MQQLLKLVELGIKGTGWRLGDKTSTIFQASFDHIAPYTKFPFVLILEQSTTERVLEERLKELGVEVKRPCRVTGMRDG # KEFKGTEILFESGETISAKYVIGADGARSSVSRIPGINFSDPDGKSVEDSVDNRVAQMVLADVSISLPEDQAALQASGISLTASEAGMFLLVPLGKPT # VSEQLYGSSDTVYRIGFNVPRGLGEPPSKPSLEYLQNNTNLHAPFVLSSDPDVNPNPVRITKVHWSTRFRMRSALADVFFKRVYGGIVILLGDAAHIH # SPAGGQMSSSCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g778 ### # start gene g779 Scaffold_8 AUGUSTUS gene 1768659 1769129 0.97 + . g779 Scaffold_8 AUGUSTUS transcript 1768659 1769129 0.97 + . g779.t1 Scaffold_8 AUGUSTUS start_codon 1768659 1768661 . + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_8 AUGUSTUS CDS 1768659 1769129 0.97 + 0 transcript_id "g779.t1"; gene_id "g779"; Scaffold_8 AUGUSTUS stop_codon 1769127 1769129 . + 0 transcript_id "g779.t1"; gene_id "g779"; # protein sequence = [MRFSTLSLLATVASAAFSFAAPLTPASNALEARCLCQDIHSIIVDVTTTITPIVEELSEYFVLSLVTHAYYSLAYITS # ENCTVEILTPIVEELKVVITTAITEVKGLTGFTLTTVLTTVDGVVLTIAEVAELLCELLTVSVDLVLLLGRSSMGIYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g779 ### # start gene g780 Scaffold_8 AUGUSTUS gene 1771853 1772971 0.59 - . g780 Scaffold_8 AUGUSTUS transcript 1771853 1772971 0.59 - . g780.t1 Scaffold_8 AUGUSTUS stop_codon 1771853 1771855 . - 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_8 AUGUSTUS CDS 1771853 1772971 0.59 - 0 transcript_id "g780.t1"; gene_id "g780"; Scaffold_8 AUGUSTUS start_codon 1772969 1772971 . - 0 transcript_id "g780.t1"; gene_id "g780"; # protein sequence = [MLKTSMKVQAFPDGNRDATVSFQLLFHFTNILNKIYTEQNINGDLAYQRLRSRVFGSTRSSASNSLVAENAAEIRRRN # ARADLMEHLFHDDTSRPSNRPLNRDHARNTDSWRSSVIGHRESFPSQRSIPYQRRSPSPSDFPRSIADVLDATDQELEEQERRTREEEADVLPRRSNS # LSWLPPPQFGFDQSLSETLVGFSSDLNTANSSEGGRLPEIDWLRRRSLAMSRFRHSDDTRAQTHSTPTEFERSNRITPFPRSRAPSSSSRVAPSSESS # GFFDSRHSSITDIARTINDRSNLLSSRTQLLNDSDLETSPRTVPNDANLRRPLRTYPPRIDAERRNNSAPFIPPPDLGSLFSPNDLSQALSNPQSQWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g780 ### # start gene g781 Scaffold_8 AUGUSTUS gene 1773234 1774738 0.24 - . g781 Scaffold_8 AUGUSTUS transcript 1773234 1774738 0.24 - . g781.t1 Scaffold_8 AUGUSTUS stop_codon 1773234 1773236 . - 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_8 AUGUSTUS CDS 1773234 1773744 0.26 - 1 transcript_id "g781.t1"; gene_id "g781"; Scaffold_8 AUGUSTUS CDS 1773819 1774738 0.35 - 0 transcript_id "g781.t1"; gene_id "g781"; Scaffold_8 AUGUSTUS start_codon 1774736 1774738 . - 0 transcript_id "g781.t1"; gene_id "g781"; # protein sequence = [MPYIDAPPRLPSPVYDSSLTLSTVIPVSDIPLNIDNADNANDVNETPMGQGRYVSFRERLNTAVGLLEADDVSSFRER # LTSALDAVRTDERETDIESSNLPGSSRHTQQYNDRAPSGASSSRPWRTLVLNNMRNGADETANLSPRTRDIFNSPSPSPDPTSLSNSESRIRPLYLAS # HSVLSRPRDSFSRSVSPSGLGDTTTGPLTSERQNRYNSTERSSRALEPIPTTRSHRHPSPQQSTGLTVPRRPPSQSIEQLSSVPVSVPFNRELARWFE # VSADTTVPEHPPSSSVAAAARSITPFFSDTDDEYLDRGEDDDQDQEDEDIIAGLLSSTHERSNYESTTSATRTNTSSRSTRVPPSLASLMARDHLFSD # QDNDRDDDNVTVRASDSIEVNRTERYRDSSAPRRYTDVLSIADYRSQLLADAQRRRYIEQGSVDPRESLESWTSSNQEHRRSTTNNASNFDQDERSSA # GYRLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g781 ### # command line: # augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000003