# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_1/input_1.fa_chunk_0000002 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 1231013, name = Scaffold_14) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 Scaffold_14 AUGUSTUS gene 2403 3641 0.72 - . g1 Scaffold_14 AUGUSTUS transcript 2403 3641 0.72 - . g1.t1 Scaffold_14 AUGUSTUS stop_codon 2403 2405 . - 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_14 AUGUSTUS CDS 2403 3641 0.72 - 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_14 AUGUSTUS start_codon 3639 3641 . - 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MDTTTSTSSSLSVSISSVDVPLKSTSSFDPLSPSTFETSLPFNTEDIEMEEGGTYQGTGEPMKQVVVETGAEGADDQR # FGGVGDVSEGTSAIVLCYPMCSSTLVFAAGPDSDEGSEYQDEFPEAADEENQMDENDLAPTSTPVLAIQAHSLLAKFNVVVEPVFRLTICTECNKPVP # FNHMRQHQSQTHYKGLNLPSELRLPSSTIILSLLAVLGADRPGEVPYEAIPRIQGIETVHGYRCLNAGCCGAVFGKSRSLRRHHAEAHPDIPVAERRS # IRVPCQPLSVFRQHLRYVEIILEPQIKSLALLSIEESASSCNLLEHSDIFTVTTNEREKNAVFAQTRWDQLLEGVNIPKLRLSISTPNNAVFSSFQRL # RSVARDYYEEVSSSLPKLPVLVRRYIASSNPKYVAIFSSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # start gene g2 Scaffold_14 AUGUSTUS gene 6764 7501 0.79 - . g2 Scaffold_14 AUGUSTUS transcript 6764 7501 0.79 - . g2.t1 Scaffold_14 AUGUSTUS stop_codon 6764 6766 . - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_14 AUGUSTUS CDS 6764 7501 0.79 - 0 transcript_id "g2.t1"; gene_id "g2"; Scaffold_14 AUGUSTUS start_codon 7499 7501 . - 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [MNPDTFRDLNLSTYLTSYQFTTSAPDWARNKEILFPGVHSDIINLLDTTVQGWRMVPLYEEYLKLRASDPQFEVLRTF # CWEMYDTLKWFPKVSRDRLIDNKKRTTWKQVFAGGLKTGTPITINPLHSKEPITALPNVPPVLSLRTPGDQDEESEMTGDQLSELRESHQETLLPIAQ # AVFGDVPQDEPPEPGPSQPSGMAVEFARRRYGKKRGRRVVAEDSESENEGRRNGPVVHFLDTAGDEMEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 Scaffold_14 AUGUSTUS gene 8296 9762 0.94 - . g3 Scaffold_14 AUGUSTUS transcript 8296 9762 0.94 - . g3.t1 Scaffold_14 AUGUSTUS stop_codon 8296 8298 . - 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_14 AUGUSTUS CDS 8296 9762 0.94 - 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_14 AUGUSTUS start_codon 9760 9762 . - 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MSTASLFTDAEASDDELTNKINIMSLIAKFDTARTTLLGRRPANTPFAQLDRQAVQKYIDLVLSGSGEDGQYTLHIPT # AFHHMLDDPEVSIMRDVDSALIFRERFPWTTSYDIFTTYENKKSVHGHLHAQVRFTVRAICTMYLFHKLTHRINQDNAGTGDHEYRDPGNDPNVLWGV # CGRNGGRNRIYLMLPGATEEDMTDLHPLIYEATLNAAKLLIEEVTTTWSPTYAAEMDRTARFSRTRFRTESRKSISDEIGQAFADEVMDSIRMYPWGD # NSYWFIQIRGAKDLTRDYSELTQHQMDIILEHVDQRRSVIFVDVGLEIHLPHGWAAMPDRTEDGHANLAETLWGIDSETEWDYYKYEPDPWAGVADIA # GFRCNFASEPRTTNRISYIQVYTSDKFQTYNTSGEHGAALQVFGPSVLKMSHPDDIPLSITKVYGASDSNLRENTPTVTRCEARVPLHLAFQLDSIQV # QIEDLAPFLHVIPSKGIW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 Scaffold_14 AUGUSTUS gene 10529 11800 1 - . g4 Scaffold_14 AUGUSTUS transcript 10529 11800 1 - . g4.t1 Scaffold_14 AUGUSTUS stop_codon 10529 10531 . - 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_14 AUGUSTUS CDS 10529 11800 1 - 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_14 AUGUSTUS start_codon 11798 11800 . - 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MLAGHAGEEYDALTKGVDAGEDVAGEVHQNLKSAESRLGIALQGRFKDDEEQSTKKGKKPAASSKKRARKAESTTEAV # NERPPKKTKTSKVKSAQFVHDETPPRSMRLAAGPFAYGPPSSEAGPSRLPERPEPQEDEEDYEKQGQELRDRLGAQWQRILQESWRRREQDEQGELPQ # SGGMQGPKMPMIPPGETLYHLPSPPVIPQPLPTPVGPPAHEPPPMDAPKPFEEMEPEGMETPTAPPSPKLPPVKGTGMSSELSDLPTPTPSPPPVKST # LDAPAMGSDGKLKDAMEMEFSYSETEDVPMVESEDEIRAEPSTSSRKGKERAAPQTLVSRMRSVDLQGPEDPYRPPHTGKSKQPAKSRRKRETTPVSN # SALLGFLNSFLYSRTWMMLLPWTPTFNVRRKWSGKGDGDEDAGVPVASSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 Scaffold_14 AUGUSTUS gene 42427 44362 0.21 + . g5 Scaffold_14 AUGUSTUS transcript 42427 44362 0.21 + . g5.t1 Scaffold_14 AUGUSTUS start_codon 42427 42429 . + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_14 AUGUSTUS CDS 42427 42744 0.53 + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_14 AUGUSTUS CDS 42839 43441 0.42 + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_14 AUGUSTUS CDS 43712 44362 0.72 + 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_14 AUGUSTUS stop_codon 44360 44362 . + 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MSRTLYFVAASRNQESLVFSQSEIDVDPELSITKLQKALVNQYYPDSTAFTAVIYQVSLHVFWFWVVLLKPFQQKHPV # ELDPDVAETLFPTFPALLENAKSNPAPQALDIVSELKNGVCCRYSILTPKAEIFSIDFTKYVRNVVDGKPPSVLAQSKEYNDNQGAPATAVLDGRYAQ # DGPSTVAPPIELYHPVFGAFMQRCRTSDIEIPEGILRDTASLLRSVSRIAVKEAPRDAQTRKILADILGVGLERITNSDKTSPDFMSVTPTPLNVNGA # CIISEIKSELGSGGSDPSRQSALSYARFYCRPELNEYYARLSSPVVEPGHIPPRFCPSISSFSIRETKIPFIYAYPLQHNPASVTFKATRTDTKESVV # IKFVRQYGHDVHQLMAAHGLAPKLLSFSPLGELYGNLNLVAMEFIEGKTLHDAYDISQPLPDSVKNSVRKGLDLLNKEGFVFGDLRRPNVMLADGDEP # AEKRIRFVDFDWAEKDGEMRYPFHISSVVSDPSGASEYDCITHQHQENMFIHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 Scaffold_14 AUGUSTUS gene 49262 50173 0.59 + . g6 Scaffold_14 AUGUSTUS transcript 49262 50173 0.59 + . g6.t1 Scaffold_14 AUGUSTUS start_codon 49262 49264 . + 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_14 AUGUSTUS CDS 49262 50173 0.59 + 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_14 AUGUSTUS stop_codon 50171 50173 . + 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MSAVGTLRAAEVLRKEIRVAASTGKSGEMMRGVRVVVVDVDIEESMGSDTSSSSSSGSGSIPPDAYKAMEHWTASEKL # TYGPGFISSMTESSSSSSTRTPPHIGTFVSTILGVVSNARYGFGSYSYSAFGMQLGAGRFLSWMRGDRLFVGSSGMFPALSLRGPISEFSYPVYSSTF # RLPLRILTMIPSVLHSLLNSLSQPFTRRRSHFLLPALPPQPVSSVPSADPVVASQLDHLGANQLSNPELSSVSTSTASASAFTSSFDSSASFASEADA # DIESNVGETMGDSMVEHSWIALPVQGEGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 Scaffold_14 AUGUSTUS gene 57667 58242 0.35 + . g7 Scaffold_14 AUGUSTUS transcript 57667 58242 0.35 + . g7.t1 Scaffold_14 AUGUSTUS start_codon 57667 57669 . + 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_14 AUGUSTUS CDS 57667 58242 0.35 + 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_14 AUGUSTUS stop_codon 58240 58242 . + 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MQQNEGTSGISVSNQAAGGNRVLADGLGPNALGRIDRDVLAQSGVKYAMIFEGVNDIGVADPSEESQTLIGDQLISAY # KQIVTRIHTFGIPVFAATITPFGSPPNTTIQPYSNPVREATRQRVNAYIRTPGSFDHFIDFDKVVADPNNPSQLNPAFNSGDFLHPNVSGYEAMANSF # PLDIFEEFADGVSMY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # start gene g8 Scaffold_14 AUGUSTUS gene 61648 62656 0.98 + . g8 Scaffold_14 AUGUSTUS transcript 61648 62656 0.98 + . g8.t1 Scaffold_14 AUGUSTUS start_codon 61648 61650 . + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_14 AUGUSTUS CDS 61648 61931 0.98 + 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_14 AUGUSTUS CDS 62020 62656 0.99 + 1 transcript_id "g8.t1"; gene_id "g8"; Scaffold_14 AUGUSTUS stop_codon 62654 62656 . + 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MSTWPNSEIQKATPERTAEIQESLTEIRGRVSRTVEALRLVSNIPKLIAVSKYKPSADILVCYELGQRDFGENYVQEL # VDKAKEVRLITAISFLFLCVPFSSATYDHVHISSLGSIAIPNLHTVQTISSEKTVNALHKALPSDRIAPLNVLIQINTSGEDAKSGIQPLASSSSSSL # GQLSDLQRLAKHIVMSCPKLRLQGLMTIGALDLSLSANETEKNADFERLTETRDILERWLQAELVPEEADKNQVWRWGDESTGKLLLSMGMSSDFEAA # LKAGSDIVRVGTGIFGSRKTRDKLKEPGAPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 Scaffold_14 AUGUSTUS gene 69923 70960 0.95 + . g9 Scaffold_14 AUGUSTUS transcript 69923 70960 0.95 + . g9.t1 Scaffold_14 AUGUSTUS start_codon 69923 69925 . + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_14 AUGUSTUS CDS 69923 70960 0.95 + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_14 AUGUSTUS stop_codon 70958 70960 . + 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLK # EFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPT # MTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQP # RRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 Scaffold_14 AUGUSTUS gene 71011 73428 0.95 + . g10 Scaffold_14 AUGUSTUS transcript 71011 73428 0.95 + . g10.t1 Scaffold_14 AUGUSTUS start_codon 71011 71013 . + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_14 AUGUSTUS CDS 71011 73428 0.95 + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_14 AUGUSTUS stop_codon 73426 73428 . + 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRRTSVRASRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 Scaffold_14 AUGUSTUS gene 76112 77638 0.9 - . g11 Scaffold_14 AUGUSTUS transcript 76112 77638 0.9 - . g11.t1 Scaffold_14 AUGUSTUS stop_codon 76112 76114 . - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_14 AUGUSTUS CDS 76112 77638 0.9 - 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_14 AUGUSTUS start_codon 77636 77638 . - 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPKNANLNNNRLNTSDSSSQKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 Scaffold_14 AUGUSTUS gene 78149 78856 0.9 - . g12 Scaffold_14 AUGUSTUS transcript 78149 78856 0.9 - . g12.t1 Scaffold_14 AUGUSTUS stop_codon 78149 78151 . - 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_14 AUGUSTUS CDS 78149 78856 0.9 - 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_14 AUGUSTUS start_codon 78854 78856 . - 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTWPELWIPSHAYRSYYPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 Scaffold_14 AUGUSTUS gene 83231 83557 0.84 - . g13 Scaffold_14 AUGUSTUS transcript 83231 83557 0.84 - . g13.t1 Scaffold_14 AUGUSTUS stop_codon 83231 83233 . - 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_14 AUGUSTUS CDS 83231 83557 0.84 - 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_14 AUGUSTUS start_codon 83555 83557 . - 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MVRLRIKKKIEHDVGGSIPIVFEETGAPDFVGNTIGFDVTWVENGRQVSITEGKVVEVQTSSGKTTSYWKVELGVVPQ # AVHVVEPEAGHAGMPGISINGSPVVSPKEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 Scaffold_14 AUGUSTUS gene 88828 90615 0.56 - . g14 Scaffold_14 AUGUSTUS transcript 88828 90615 0.56 - . g14.t1 Scaffold_14 AUGUSTUS stop_codon 88828 88830 . - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_14 AUGUSTUS CDS 88828 90523 0.85 - 1 transcript_id "g14.t1"; gene_id "g14"; Scaffold_14 AUGUSTUS CDS 90593 90615 0.56 - 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_14 AUGUSTUS start_codon 90613 90615 . - 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MDKDQYVQILAEFREIDSYLTDDESSSDEEEEDYRPSLAQKEFDNSVLRMGRSLVAAAKMNPVHLPVSHPSFERIIPQ # ITLCLTRLNPNTEPTDPRIAQTIQDLIDMGINVHLGERTLDEIPEVQPSTVPHPSSFIIEPTTRINLDLSVLIALVSDLTHAPLPTTIDEANSRFIPP # ERYLEWKRKVNATKAKAKKALDPDFHDEDFELSLPAQEDMAKTSRALTNQVLQEMEKGLLQEIADRLDVLQPNVPSDEKKPIEFWTTPEARDRCFRIV # SKVGGLKEKRRVQGLLFDSSASTGEQLSEAIGSDVDSDYALPFPDTLDKAQEAYWSDSRYPQNFLSLIPLRFYPVSSAPTSSSHPLLATTSISDAPLS # AVDGNPPFFRSLHTTCSDILEYEKHNRSNGGPRTLKGNFAFGPNAPHSGLNFNHDPASMDGDEPDNVPMSISGFARATITKASPRLTAHTVQSLAWGS # ALGWTTLTANRTSVKAIVKEINARARVEMFEMFMGASTTPNAAVMSAENGGVLSVNTGPSPSSSSTCHGAELVPGPNQLKAAIWIVDPRSLAEGMRAD # SVDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 Scaffold_14 AUGUSTUS gene 102826 103425 0.57 + . g15 Scaffold_14 AUGUSTUS transcript 102826 103425 0.57 + . g15.t1 Scaffold_14 AUGUSTUS start_codon 102826 102828 . + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_14 AUGUSTUS CDS 102826 103425 0.57 + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_14 AUGUSTUS stop_codon 103423 103425 . + 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MTPAQHEIINNRNLAIQKQQQARSYSKPQEVGPSSYVTKGKFVDHNNEVCDAELNIEVQKAELNHWNTAHGSIGAKNI # SSDVESEISDKSRRRLRKNYHQKMDPSGASPGIVRVNTQTRELMIVPMSIKKTKTSSRSIFKDVESLKPISSRFAKKIKDIAKGHQTTSKSTTHHGRH # LSTQPVDQLPQDRSTSHVVPLLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 Scaffold_14 AUGUSTUS gene 103614 106792 0.28 + . g16 Scaffold_14 AUGUSTUS transcript 103614 106792 0.28 + . g16.t1 Scaffold_14 AUGUSTUS start_codon 103614 103616 . + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_14 AUGUSTUS CDS 103614 106094 0.28 + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_14 AUGUSTUS CDS 106406 106792 0.92 + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_14 AUGUSTUS stop_codon 106790 106792 . + 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MRKKLNFLPRELKILGQIVDDTGIRMDPDKVDSILKWKVPTSKEMLSGFLGAVGYLTDNLPGIRGPMGILHARTGAAV # PFQWTFTEQRAFEDIQRITHQWQNHSRVPLDYSAGHKPIWIVTDASSASIAGFVCQGANWRGSKIAAFFSAKLNSAQQNYAVHELEMLAGVETMLRHR # DILQGTTFTWITDHKGLVHLLKQKNLSGRQARWMEKLGEFNFTIEYVPGEENILSDALSRIYLNDAPGTVRAASEYTSFDDNSDNSHLGLHSVSMPVF # TGQEARNKRVRKPVETADTGRPETSKEFAARMKGRVRFLAPRKRGQEGADTTIISLTTKSDKKSDLNMDYIDNNVSVDVESQPRASSSNGKLTIKLPA # RPKVPAHRSQREKADGHTQVHVSKANSTSGTNPGLPAGKAPDSVNSITKLDSGLSDATLISILSKSNESFNLHSALKGRYKEDPLFKKILESPKDYHN # FEVIKDLIYLKQKEAQVLCIPRIIIDSRSVQEIIISEAHSLLAHLGASKTIDYLRDHVWWKDMVADTKSFCESCHVCKLSKPDNTKSYGKLHPLEVPL # YPWEAIGVDFVGPLPQSKNRDSSFDSICVIIDLLTSMVHLVPCKTTYTARQVAELMFEHVYKLHGLPKRIISDRDSLFTSIFWKRLHKLIGVNLHMSS # AYHPQSDGATERANRTVTQMLRQCVSATQKDWVSKLPAIEFAINCARSESTGYAPFILNNGRMPRSMVWSSDLSNEYPSVRTFARLRRLAIMAAHDSI # LEARVKQTRAANRKRRFDPFKEEDLVYVSTKNLTFEKGLARKLIPKYIGPFKITKDFGNHSFRLPKGAGTVPEEVSIEMGIASIRFQVFDLCDGFENM # KFSPSSSSYNSDSFSIPFPPSVCPHSLPASPHISHSSLPILPHPIMAPLEFQHIERQSHSKFALVAKNDDGDKIVSLLNRFDSMSTSIKISVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 Scaffold_14 AUGUSTUS gene 108324 109088 0.76 + . g17 Scaffold_14 AUGUSTUS transcript 108324 109088 0.76 + . g17.t1 Scaffold_14 AUGUSTUS start_codon 108324 108326 . + 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_14 AUGUSTUS CDS 108324 109088 0.76 + 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_14 AUGUSTUS stop_codon 109086 109088 . + 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MNITGNLVVNYGESLLAGEFAQNSAEDCLTLAIWTPANATADSNLPVIHFFTGGGDVTGGINIPTQLPANWVHRSQSH # IIVTTNYRVNIFSHPHALGLDGNGNFAMQDQRVAIEWVAENIAAFGGDPSRITIWGQSAGSGMVDAYLATWYDDPIASGAIMSSAFAIGYPALTEDYD # GLNFTFVAKSLGCDFSDPKVELECMRHVPVARIENFVGQYQDNSTLVNTSQSAITFTRQGESSFRFKLYSLMLTHNDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 Scaffold_14 AUGUSTUS gene 110999 111733 0.96 - . g18 Scaffold_14 AUGUSTUS transcript 110999 111733 0.96 - . g18.t1 Scaffold_14 AUGUSTUS stop_codon 110999 111001 . - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_14 AUGUSTUS CDS 110999 111733 0.96 - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_14 AUGUSTUS start_codon 111731 111733 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MGDTVVAWVQKGTMWLGQRTILPERSLRSDTDTRSNPTDSRRTRIRTRLRQKGFWPLKSPENVEKAVHSEEAREVDEG # AVPDPSRTQANGEGENKEIRGDIEKLGDAVETVEAERGQGGGIAARLAREIKLVSKDLGKQPPKEYEWEDWKRWMRLLSVSSSDDNDGSNGRRGLGGL # KSLKSPTRSMGARSPTHSDASRSSGWIWLGDDGPLFSQESEANWILGKLCDRLEQVLMKEVLNARTAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 Scaffold_14 AUGUSTUS gene 114966 116519 0.86 + . g19 Scaffold_14 AUGUSTUS transcript 114966 116519 0.86 + . g19.t1 Scaffold_14 AUGUSTUS start_codon 114966 114968 . + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_14 AUGUSTUS CDS 114966 115480 0.86 + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_14 AUGUSTUS CDS 115646 116519 0.91 + 1 transcript_id "g19.t1"; gene_id "g19"; Scaffold_14 AUGUSTUS stop_codon 116517 116519 . + 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MQRAKSLGIDAFALNIGTDSYTDTQLGYAYESAANNDMSVFISFDFNWWDAASDAAAVGAKIAQYAGLPAQLHVDVDG # TSYVFASSFAGDGLDITTLRSTASGDGFPDVYFAPNFHPGVGDLSVIDGALNWLAWENDGDNKAPQGGVVVTVTEGDQEYESALSTSQGYIARDKNWV # FPSDLLWYMRWLEILELQPPYVEIITWNDYGESHYIGPLSSPHTDDGSSKWVNDMYVKKFAFVYSNTSLSLSSHRPHDGWLDMAKPFISAYKAGASSP # NSYITSDEIIYWYRITPKDLDCDSTDTTMVAANNDTGNYFEGRPDGYDTLADDVFVVPLLTTAGTITVNTGAMEYTFDAPAGASAFSVPFEVGAQSFT # LARNGAEVMSATSLKVIQDTCPCGIYNFNAYVGTVPEGTRDVLGADGLTLLTNGLKVACDPTPSLPATPPASTAATATSSATAGPTSPAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 Scaffold_14 AUGUSTUS gene 116905 118080 0.96 - . g20 Scaffold_14 AUGUSTUS transcript 116905 118080 0.96 - . g20.t1 Scaffold_14 AUGUSTUS stop_codon 116905 116907 . - 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_14 AUGUSTUS CDS 116905 118080 0.96 - 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_14 AUGUSTUS start_codon 118078 118080 . - 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MTSPPNFTNTISILLKSSMRASILIFFILAVITQAVTVTSIFIPGALTVTQSSPVTTSLEIPNVDFNAVNPMTSSFVT # VESDTPPTLSFLDSSQRWRQLIIRAASANVAPTWDAPVGCGSSCTYNFTYSAPALNCTELSKQDIWPSGTNTSDSRLAFPLNTTDPNESLNEYFFYNS # SFAFTSEPNTPNVSSSTLDVYYMENFNTTYDQALLLASQYPDPTQYNPRGAHCEYQNATYEATTTFLNNTQSSSVHVKELNGYLPIGHDADGPYPGTN # TTNMTLAFRSIAQSFNEILSGNAFYQTNSSGLVTDRTQALNTPLFSLTGVIQNVTATDSFQYNEYLFLLSPTFKGNLSDGIEELLGNITLAFVNEGLA # STIASVTVTPVARSISTTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 Scaffold_14 AUGUSTUS gene 129349 130185 0.91 + . g21 Scaffold_14 AUGUSTUS transcript 129349 130185 0.91 + . g21.t1 Scaffold_14 AUGUSTUS start_codon 129349 129351 . + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_14 AUGUSTUS CDS 129349 130185 0.91 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_14 AUGUSTUS stop_codon 130183 130185 . + 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MTKSEDLRAYFLEQNTFLLGTMGCCRSRRKQQKQMGGSFKIYWTTMLVSLAKPHVKSLVKAKHGNFQLFFVDDEVEHN # SDRSDFEDQEPSGSGSGSQSENEEGFEKLSTPKKPHPHPKSLQSNRRAPAWTDDSDPTRVSLSSKRLRKLRNAPDEETLPGREYESRLRRQFERINPE # PDWATQARKKTSQTDDGNGDAEMDFNTLLSSTSGIHHSRSLRSQVLAPGTIDISRLRDANQSAQNSGCGDIKSLAFHPSERVPVLCVGSSDRRVRMYN # VSFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 Scaffold_14 AUGUSTUS gene 138582 139838 0.49 - . g22 Scaffold_14 AUGUSTUS transcript 138582 139838 0.49 - . g22.t1 Scaffold_14 AUGUSTUS stop_codon 138582 138584 . - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_14 AUGUSTUS CDS 138582 139838 0.49 - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_14 AUGUSTUS start_codon 139836 139838 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MEREFLMGVDCNLYVDKATYESWLNLLKGLVLAKERDSRHYHKSRASTRAPRHPGSSLTNTPHRYANRGRGSSHRARS # TSPEQSHRILSYPSVSVSPQYISQVPATRSAQSDSPFLRSGAKRSAGAAFSPTSATFSHVPFKRPVSISLLIPESGSHSGPNSNSPLESLQSFARMSI # DSPNVPGSRSSHATTGTVPSTPWSSSNKTVVPETLSTAYALDERRRSSVPQVCDIIYIYSFLETNRLRYGQNLYFYTLACSPTDDEENRSRKARLRYH # QPPPPSSSVPYYQPRSSFPMNVQSASTSPVHITVVPPTLPHFRDTVWSRQSAYTTPHEQQAQPPLPPHLLAVPNVEPPRYQAYHQSQHQGYGGDYDDS # SPIQSAPFANAGPPGFQFCPTPEQGSSPVYERPHRSHAWSRRSICE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 Scaffold_14 AUGUSTUS gene 158543 159043 0.76 + . g23 Scaffold_14 AUGUSTUS transcript 158543 159043 0.76 + . g23.t1 Scaffold_14 AUGUSTUS start_codon 158543 158545 . + 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_14 AUGUSTUS CDS 158543 159043 0.76 + 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_14 AUGUSTUS stop_codon 159041 159043 . + 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MIFKSKNQRKSLHEPLDEYHIEPVSLGQTYAPNQHTDYSHTSLYPLVHAETVPSTQSPSTEGDTIPYGITYPPIPNPS # TNQSRAPLRLRTDNGGDDNASRSEAAPLPRKTTLTADTTRTGSKPASGPSEAGSSDVTSDLRGELENLRREMEEMRSRTGYEPPPQYH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 Scaffold_14 AUGUSTUS gene 160784 161026 0.54 + . g24 Scaffold_14 AUGUSTUS transcript 160784 161026 0.54 + . g24.t1 Scaffold_14 AUGUSTUS start_codon 160784 160786 . + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_14 AUGUSTUS CDS 160784 161026 0.54 + 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_14 AUGUSTUS stop_codon 161024 161026 . + 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MRLLNNITDKNERIPSPVFDLAIRVELIGEAFDGTATSARPDTKVKAKANFVIGLNIVVIEFVVKSLSQALDIDDSRE # VV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 Scaffold_14 AUGUSTUS gene 162033 162383 0.56 - . g25 Scaffold_14 AUGUSTUS transcript 162033 162383 0.56 - . g25.t1 Scaffold_14 AUGUSTUS stop_codon 162033 162035 . - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_14 AUGUSTUS CDS 162033 162383 0.56 - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_14 AUGUSTUS start_codon 162381 162383 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MGKKRPATRVAAEEESLENKRRRLAEEDVRKGVQEHTRKMRGAALIESHIEKESDERRAKGEKFGVEDEKDLGIWDHG # RDMAVSGRIMDDSKRNKMIRDAKSLGDRFGSGNSGGFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 Scaffold_14 AUGUSTUS gene 163235 163804 0.99 - . g26 Scaffold_14 AUGUSTUS transcript 163235 163804 0.99 - . g26.t1 Scaffold_14 AUGUSTUS stop_codon 163235 163237 . - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_14 AUGUSTUS CDS 163235 163804 0.99 - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_14 AUGUSTUS start_codon 163802 163804 . - 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MTHPKIKFDGGLEWKVRLCLLVAVAKENSDSGTEGVRFKSLVRDGPRGEWGSAWKAPIGAAPCEKPMSVGSSTAQLSP # RQQQPGVVKSWTSFITASFLGAAEGGYHDGDELSDYSSDPNDDEVGYEGNYNSYDGIKPNRAGGVGTGVNFGGGREVSWQEIKLETVECEVPVSVWPG # NTAFKPVDVVFDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 Scaffold_14 AUGUSTUS gene 165190 166689 1 - . g27 Scaffold_14 AUGUSTUS transcript 165190 166689 1 - . g27.t1 Scaffold_14 AUGUSTUS stop_codon 165190 165192 . - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_14 AUGUSTUS CDS 165190 166689 1 - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_14 AUGUSTUS start_codon 166687 166689 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MDGTQLPYSPPSIYGSDTSTSPTSLISATSTANTLVSAPASTGPSTPSASTSSFSLALDPISETSPVVPAHPYLSPSV # PATASTSGLGPALSSPSISVEAPSPPSASTRQHSYPPFPSSKPTSTRQLHRPPNLGIGKPSSRMFLNLNETNAELILYSYAQLKGTVTLTPIPSNTVP # VSSSNRAFPQSPLSPSHSTPHLSPVLPAPLSAAQIEQQKAQTLAALRQALLKGSATAVGGGSMDITSRTHSRTPSVSGTASLGGGLGSGSWGSFGGNA # SAGLVSAYGPPSAKPSLGTINSGSTEGPSSPASASVRRSHSRASSFSSGLLSIFGSPFGLGGGSGPVSAPPVTRPSNLAASASVPNVANSYSEQHQQQ # VQRPPRNRTASASVVPSVSSGWPSVASPSNQQVPVSAGLDQPASFTSFSALSSPGLGPGSGSRLGLGLGWSLGGQSTEEVDPELPLPTFEAQSTMLAV # DMRLEPGESKSCASSPFFGRGAKFRFVLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 Scaffold_14 AUGUSTUS gene 166821 167420 0.87 - . g28 Scaffold_14 AUGUSTUS transcript 166821 167420 0.87 - . g28.t1 Scaffold_14 AUGUSTUS stop_codon 166821 166823 . - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_14 AUGUSTUS CDS 166821 167420 0.87 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_14 AUGUSTUS start_codon 167418 167420 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MSFPLISDAAGDPDSPIRAVVTPSQSAYFAGETLSVTITFTNTRTYSPEGEAGPSSRAGAVPRSSRTHKRASHSVSSA # PIARPPTSSAGLYRPRTPTTAAVLGSPAPSRQTSLGPETGTRIKRRGFIGKRQGTEGKDKTVPDLVEQRRMKMSSKSLSLSLGFCQDETEIATSLNDN # EELAKPTSQMQRSLTADAHLFSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 Scaffold_14 AUGUSTUS gene 175299 175826 0.83 + . g29 Scaffold_14 AUGUSTUS transcript 175299 175826 0.83 + . g29.t1 Scaffold_14 AUGUSTUS start_codon 175299 175301 . + 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_14 AUGUSTUS CDS 175299 175826 0.83 + 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_14 AUGUSTUS stop_codon 175824 175826 . + 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MPIRIAVKNKSNSYKILQGHDRPPRTFQSDDDLIFVFGTLVAFQVSPDDETSGQPPKLSVKEVDIPRSGALNTIDRNY # LIRLGQPDLVATFNEAPIKEVVVERFINIDRLLLETKKAFEHLGESGAASQLIIEDELDYFSLMMISMQLEYGKEGNPVLPGLWGKIMCNGLLFIRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 Scaffold_14 AUGUSTUS gene 193872 194356 0.39 + . g30 Scaffold_14 AUGUSTUS transcript 193872 194356 0.39 + . g30.t1 Scaffold_14 AUGUSTUS start_codon 193872 193874 . + 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_14 AUGUSTUS CDS 193872 194038 0.4 + 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_14 AUGUSTUS CDS 194104 194356 0.69 + 1 transcript_id "g30.t1"; gene_id "g30"; Scaffold_14 AUGUSTUS stop_codon 194354 194356 . + 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MSTIRDLEDLIIDAIYLDILRGKLDQKESQLEVEYTMGRDLEPGKVEAMLNALRDWASTTSAVLATLDSQISTISAQT # DFDQKQKEDYEAHVQQIIKEVNDKKESNSSYPLSSGTRRLQGQNTTGSGDRMDVDEPEVQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 Scaffold_14 AUGUSTUS gene 199385 199738 0.63 + . g31 Scaffold_14 AUGUSTUS transcript 199385 199738 0.63 + . g31.t1 Scaffold_14 AUGUSTUS start_codon 199385 199387 . + 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_14 AUGUSTUS CDS 199385 199738 0.63 + 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_14 AUGUSTUS stop_codon 199736 199738 . + 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MDGTFRLPMLSTAGGDELVEEVEVDVPVGEPGAEVQVFIADVQVSVDAVDTAVPAAVSTSVGVAVELEELQPLLESVG # EESVALDDELEEDDPESDPEPEESESAQTQVIPVIRPTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 Scaffold_14 AUGUSTUS gene 202989 205945 0.1 + . g32 Scaffold_14 AUGUSTUS transcript 202989 205945 0.1 + . g32.t1 Scaffold_14 AUGUSTUS start_codon 202989 202991 . + 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_14 AUGUSTUS CDS 202989 203677 0.89 + 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_14 AUGUSTUS CDS 204334 204767 0.85 + 1 transcript_id "g32.t1"; gene_id "g32"; Scaffold_14 AUGUSTUS CDS 204814 205122 0.12 + 2 transcript_id "g32.t1"; gene_id "g32"; Scaffold_14 AUGUSTUS CDS 205197 205945 0.24 + 2 transcript_id "g32.t1"; gene_id "g32"; Scaffold_14 AUGUSTUS stop_codon 205943 205945 . + 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MSLQHSSPSPTSEERQNRFAAPSLNQPTTNLTAGEAGNHPSARAASQPPRSSSTASNTVLLSPTTVPRSPWSQSQSSS # VKHPRDRYLSPTRTSGIPMPSQTRSSSFSGAGLGAQSHSFSGLGSSGGAGPGYFSRFDSTFEDDESLLDNPQYGVEDDGVDDDDVDAMIGRIRPSADP # YDEYSDSPVYSRRGVGIAGGGGAGRYSIGGGRLPPSLSSSLSPSQLPGKHQSKSDYGDKLHDNSNQSPFLRDVSQIMRDDGPLRELWDHGAGGAHAPR # GLGLRNSLSRAYSGGGGFNSGARSGVYPGGRGTTELEDIPGSGATSRRHSVSVVQPVRRGSGLQGELAGSAVDDEYEYEYGQPQGGLGSERNGSSGFG # ALVHPHVGSSSGRAGVGRGSLMISDEDLLDAGVPMPDLRMGMHGGTHPVDALNSNFGMMNLNDINQSLYQHQQQQQSALEIPHQRRGSVSPGTGAGGL # SHDGLGSTSSTRKPTTPGTNGIGAGTSYASRARSTSQSQQQGGSSPTMGRGMGIPPQGFYSQHPSAQPQQGPTYPQAHAVGMPRRISNASGSGPVLDM # SYGVGPHGHHPGSVHQQHPHQTHPHGQHALPQHQQSQPQPEHALGRGVPLSAVPHTWKLFIVEFKAGRTDLFYLTDAIKSEIMRNEAGYAAAQTNGHG # TARAPSEGAEADSYPIKVGDLVIVEADRGRDLGRVVNDNISVDEVEAWLDAGRSSSGPNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # start gene g33 Scaffold_14 AUGUSTUS gene 211092 212602 0.85 - . g33 Scaffold_14 AUGUSTUS transcript 211092 212602 0.85 - . g33.t1 Scaffold_14 AUGUSTUS stop_codon 211092 211094 . - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_14 AUGUSTUS CDS 211092 212460 0.9 - 1 transcript_id "g33.t1"; gene_id "g33"; Scaffold_14 AUGUSTUS CDS 212595 212602 0.85 - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_14 AUGUSTUS start_codon 212600 212602 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MYGYDEGTALMPVVEKSRLLPRSDKYSFMALDADGYDLPADWYSHLSACSYPKKVLSELLLLFRYMRICGFAAEGLRS # ERMIHETFPSKELQDYWSTRPRFEEINIKSGDFVSGSAGELDGGQSYQSWLAAQKDSKDEVPPPPYSLEAEHSTTTSSQAQASSQSQPADASASSSHH # AQNESIVASGLSQPSLANDTTASSVTRPPLHPSHPSRSSSSSNASISPPTHPSRSRPPEPNRLSRPQSISASRPQTQSQPQSQPLSSTQNSDQAAHPA # ASPHWPPAEWNADTNRPPTSMSYQPYRPNRTPSQASLTIPQTSSSRPTSPYDSQSGILHPSCELSNRPISPQPPVASVGSPLSFPQARVSGPTSASDH # RVSGTASYTPSGSPSFPPGPYGPAAVQEGSSHSTHTPHPSSPSFRAEFYGPTSSQPHSSVHFSSFSSFLFYPVYFRKSLSGHESPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 Scaffold_14 AUGUSTUS gene 219587 220066 0.69 + . g34 Scaffold_14 AUGUSTUS transcript 219587 220066 0.69 + . g34.t1 Scaffold_14 AUGUSTUS start_codon 219587 219589 . + 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_14 AUGUSTUS CDS 219587 220066 0.69 + 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_14 AUGUSTUS stop_codon 220064 220066 . + 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MLVDQVFREQFLIVPPDSEDGDKNENENKNQNESENQNESENKSEIFNKARKRTGLPSFIRPPATPSVSLAYPNPTLS # PSTQQLLSSIFRSRFCPCCGLPHALADCPVRDEYPQYSSIKKSSEKKAALREQIKEEGEKGKRGKEGEKGKEEKEEQGYKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 Scaffold_14 AUGUSTUS gene 228935 229549 0.96 + . g35 Scaffold_14 AUGUSTUS transcript 228935 229549 0.96 + . g35.t1 Scaffold_14 AUGUSTUS start_codon 228935 228937 . + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_14 AUGUSTUS CDS 228935 229549 0.96 + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_14 AUGUSTUS stop_codon 229547 229549 . + 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MAGGNSRSPSSGPPPAQQRSRRRASRSPSVASDPGSRPPRNRRRGGGQQKQGGGGGPVGGLPGVSEVADTATGAVGSV # GDAVGGLVGGVAGGGGGGGGDKPLKLRLDLNLDVAVEIKARVHGDLTISLLYVYFAFLVIDLTLNFLPQAIACLDHLLIARSFSNTLARGCWLINAIA # AMNEYSWMLMTLQDLWTPEVVYARTLKF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 Scaffold_14 AUGUSTUS gene 243905 244540 0.6 + . g36 Scaffold_14 AUGUSTUS transcript 243905 244540 0.6 + . g36.t1 Scaffold_14 AUGUSTUS start_codon 243905 243907 . + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_14 AUGUSTUS CDS 243905 244540 0.6 + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_14 AUGUSTUS stop_codon 244538 244540 . + 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MVNLLELELKFHAYDVLPTLGEFTNILISCPELERLSIVGWGPRLDATFTDTRRVISMAKLTRLIFGFVDVEYAVMLL # SLFHLPSLYELDLEDVAAIVDPIGSSDASTLLTLLEVSSTELDAETCFFPLQQVDYLGLRSIRSSEAVFTQFLRRFSSLEKINLSDADSALLTALGPQ # QFSPEPKAGISSKLRDRRPSFASSLSTSLAPCRSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 Scaffold_14 AUGUSTUS gene 246535 248559 0.99 + . g37 Scaffold_14 AUGUSTUS transcript 246535 248559 0.99 + . g37.t1 Scaffold_14 AUGUSTUS start_codon 246535 246537 . + 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_14 AUGUSTUS CDS 246535 248559 0.99 + 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_14 AUGUSTUS stop_codon 248557 248559 . + 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MATPTSNPNSSRLSRLISLLLEIHPNTLSLAYANSSNKSPSESFSDPQYPFDLEGIAELDQEFCLGLGFSEKKKSTAV # HELQSEIFGENGVGGQSDKVVELENFEWEDVLQAYVGSSTTFLVTSTTTTPATSTFTQSSPSSDPPLLPPAIYQLLAHVHAHSLLRAPIDLPFYDHNK # RMVGMSLKKSHEVTRMAAYVASIVQNLRVPNGVYIVDVGAGQGHLARELLDVVPSVRGVLALDGDAVLVERQGNARPARGKGKNHAVDSGTDGGGATT # KVTHKFCHVTSPEELIQAVDEWFVEMETSEVLRSDVLKPVILISLHGCGSLSIDVLRAFVGNSHGIEEFQREKRKWGFIACVTVPCCYNLLREGEYPL # CAVPCSSLSSHPDSCGEAFNQPTPPFRAATSPITKYLLPHPLTPNAYHLAAQVPDTWVCSEPMKTSTIEDVTSNFTEKIVVSAALAVRKVVWRALLEC # VFVRKGIKIKLGDDSEDTDKSSGQGFIPPMEANAYIHGGLNNKHSKRLNINDNNSSPKSSSASTTSYAGKLGSNLEQGHLGKIGRFPSCAYDSWSTFL # GMAGSRLGVELYHEKSWTTNPTSPSSPLSMSAVSSAVQRMPSSQSGTNQRSTSGTAQNHSISAALPPSLAPLARALSIFYVLRCIFRPTCRKCITRGS # GAMGTGSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 Scaffold_14 AUGUSTUS gene 259140 260108 0.77 + . g38 Scaffold_14 AUGUSTUS transcript 259140 260108 0.77 + . g38.t1 Scaffold_14 AUGUSTUS start_codon 259140 259142 . + 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_14 AUGUSTUS CDS 259140 260108 0.77 + 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_14 AUGUSTUS stop_codon 260106 260108 . + 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MKHVQRNPTRKPELANHMVMTSNGRETQSDAEADISDMDSDMDVEPPANQIIKLIELLSYKIQEAIQSCVLPSNFAEQ # VSDQGHMLTEMLRGVGVGLTGSEGSGVERILMSQLSAIHESIAADKEANEKCLERIEKALSNLSSRKTAQASSAPNWADDSYAAQAARPAPKPPSKTK # TTSSPAPISKRDVECETRFVAYFNGSVEPKDRKEPHEIVRRVNDDIKELFPKCSNTKVVTAKWNPSGNLVLSVLPGQKAKSLEEIFDLLHTAYTKTDA # IPQDTRLDIEWNKIIVDGVPTGSTWSNQGGLGRRPHKSEELATKSQDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 Scaffold_14 AUGUSTUS gene 270791 273352 0.36 + . g39 Scaffold_14 AUGUSTUS transcript 270791 273352 0.36 + . g39.t1 Scaffold_14 AUGUSTUS start_codon 270791 270793 . + 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_14 AUGUSTUS CDS 270791 273352 0.36 + 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_14 AUGUSTUS stop_codon 273350 273352 . + 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP # RVNLQTKPLTPVSTDAYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA # PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSW # QATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLS # QGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNE # GRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFK # REFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAES # LRNLHGEKALQGWLSRFPGLELAPEAPYKSPLRREEIQLMSGPPIRNQLRQGGSQSRSNWKEGRQRASAAWGEGESYDSENREEDEDCCHCRDGGEWT # EAVLRAGVTDTGRKWTPEERAEKWRRRRQELCMRCGRKEHWAKDCPNPESLERPAEDQGSSERASKADSTRGRGRPTKGEVVRTIQLVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 Scaffold_14 AUGUSTUS gene 273705 274178 0.52 + . g40 Scaffold_14 AUGUSTUS transcript 273705 274178 0.52 + . g40.t1 Scaffold_14 AUGUSTUS start_codon 273705 273707 . + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_14 AUGUSTUS CDS 273705 273725 0.54 + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_14 AUGUSTUS CDS 273813 274178 0.52 + 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_14 AUGUSTUS stop_codon 274176 274178 . + 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MRHPENLISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGT # EELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPGSQQPPEAPLRAPRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 Scaffold_14 AUGUSTUS gene 275410 276645 0.64 + . g41 Scaffold_14 AUGUSTUS transcript 275410 276645 0.64 + . g41.t1 Scaffold_14 AUGUSTUS start_codon 275410 275412 . + 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_14 AUGUSTUS CDS 275410 276645 0.64 + 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_14 AUGUSTUS stop_codon 276643 276645 . + 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEESHVEHVKKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVLDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVI # LECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELL # SGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTSMIEALKRIARNEEESLVWEDGLI # KRGGRIYVPDVGTLRREVLQSYHDHKLRGHPGRNAPGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 Scaffold_14 AUGUSTUS gene 278545 279498 0.97 - . g42 Scaffold_14 AUGUSTUS transcript 278545 279498 0.97 - . g42.t1 Scaffold_14 AUGUSTUS stop_codon 278545 278547 . - 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_14 AUGUSTUS CDS 278545 279498 0.97 - 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_14 AUGUSTUS start_codon 279496 279498 . - 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MEDSRVLDQFPALDEALSGAPGQVSTSFSPRFPPLFDPSSQSISERFRKVQEDLHNATRERRVAVEKLITSTRKNSQL # RTTLLHQQGLVDESNALATRQRRRVEELQEEVHRVRGRAVFVEQMLKEYPDEGYYEVVLPPLSQLEGDLNKAHEDLRRVATFAHRLYRCDPATVLHHH # HRYLGRLLRPWLLSFVVVSILDDLDVTVHNFRLALDYVQAARGVHGDMYMRSISSIQWFFNNAVDEDEGLYRMILEHSRFDSDSPFLTAAHHAGFVPP # PDDSVEPPLHRRMLALSTALPHSDGVGRWEDIVPAPQYRPADC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 Scaffold_14 AUGUSTUS gene 284133 287069 0.91 + . g43 Scaffold_14 AUGUSTUS transcript 284133 287069 0.91 + . g43.t1 Scaffold_14 AUGUSTUS start_codon 284133 284135 . + 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_14 AUGUSTUS CDS 284133 287069 0.91 + 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_14 AUGUSTUS stop_codon 287067 287069 . + 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFRTILEEHRRMVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ # PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDN # RQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPG # LHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQSYDAVLVCTDLYGKQIHAIPCTSSITAEG # VADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSAL # GMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYR # ILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSR # APKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 Scaffold_14 AUGUSTUS gene 291740 292466 0.68 + . g44 Scaffold_14 AUGUSTUS transcript 291740 292466 0.68 + . g44.t1 Scaffold_14 AUGUSTUS start_codon 291740 291742 . + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_14 AUGUSTUS CDS 291740 291797 0.9 + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_14 AUGUSTUS CDS 291895 292466 0.69 + 2 transcript_id "g44.t1"; gene_id "g44"; Scaffold_14 AUGUSTUS stop_codon 292464 292466 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MCSAALRTLRLDLQSLGTPAPGVLQLTMRIGDKLLRRDERPLQRLMDHESFHFQNLRALNIEDRSGEVNMHHFIERHG # TANELGYKTNKKSVTNTLEFKTLPLLVKFAGSTNDSKLLLQSGNVGINDIKLIGEQCSRTEWDDFVCALSSVRSITSIQLRTQGGIVYSQLLQLVNAA # PQLQRLTFPLRGIWYDENEVRSKRFQMAISNQA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 Scaffold_14 AUGUSTUS gene 301373 302365 0.36 + . g45 Scaffold_14 AUGUSTUS transcript 301373 302365 0.36 + . g45.t1 Scaffold_14 AUGUSTUS start_codon 301373 301375 . + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_14 AUGUSTUS CDS 301373 302365 0.36 + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_14 AUGUSTUS stop_codon 302363 302365 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MTAAFITIMLVDGFRSPHYLLNRYIQMFTDFWPSDGGEFIRAESPRSCSELDGIPMGQLERSTFSILYAAENTLISTE # VNPLRVNMQHLLLKHLIADYRFTPPLFHEIGWVTTAFGRFSDDAMTCVAVDESLVLIAVAQWLLEESYLAPDLDHFISSRSFADEPLSYDLDYVAFAV # ALCFKRPRVVSEVLSFSTITPPNWASQRAHLVALRREGENVTEDTIEYSPEKPSQLVFYTSISSAVLDWLKDSHGVPFCMHTRHGVPFCMHTREATAT # LYFILELEDSARICLSLRGISNSEDEDHEESAAIRTAVNEMTPLGLLKEVRRGEII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 Scaffold_14 AUGUSTUS gene 303251 303457 0.75 + . g46 Scaffold_14 AUGUSTUS transcript 303251 303457 0.75 + . g46.t1 Scaffold_14 AUGUSTUS start_codon 303251 303253 . + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_14 AUGUSTUS CDS 303251 303457 0.75 + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_14 AUGUSTUS stop_codon 303455 303457 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MSSSEDGQARFLSEYLNDVWSELKTDPQLVSRQCCAVLLKRDPDLRKLVQKAYVEENPDILKGYGEFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 Scaffold_14 AUGUSTUS gene 309613 309984 0.98 - . g47 Scaffold_14 AUGUSTUS transcript 309613 309984 0.98 - . g47.t1 Scaffold_14 AUGUSTUS stop_codon 309613 309615 . - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_14 AUGUSTUS CDS 309613 309984 0.98 - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_14 AUGUSTUS start_codon 309982 309984 . - 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MAGPSTKDSSASYFASDAAIVQLTSSGAVNYIPYTNSSSDSSASWSTVKNLVSVAPTSSASSGSGSASATKSATGSAA # SGTSTTSTSSSSSSNGCMGVAAKSGTVVVGMMSALLLGTIALFIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 Scaffold_14 AUGUSTUS gene 312844 314397 0.74 + . g48 Scaffold_14 AUGUSTUS transcript 312844 314397 0.74 + . g48.t1 Scaffold_14 AUGUSTUS start_codon 312844 312846 . + 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_14 AUGUSTUS CDS 312844 314397 0.74 + 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_14 AUGUSTUS stop_codon 314395 314397 . + 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MLSNVRDNHEDAEHSCSSGTKRKSLSLLPSSPTKLKRVDRSHSRGSSLSLLTASSLTTSAISRLSSLRYSKRSGQPPS # PNSRKSPPICTISLESVTVNICDEDRNLSKSYTVPSPLEVVDVNVIPFPKASSDESEPQPSSNLPTGRRRRSNHLLLGHRRSSSVHSISSQHKKENLD # SFAFPSPRASPAPKRTKSSARTPASNNSFSAPKASSYSFKDIRFIALIRRSIMHGITWREEMKACGRMDIDGGFSSGSVTFDILSDSESDEEGDETAD # PRRIQSHDYIMHNQDVLLVDRLGKHLSDWGYREREPFVPLSPPPSPLRMPLASVALSTATVTIDSVPLLQPSLMAPLATGIIHLPDLEGHATRVSFLD # KAHYQEENAMDMDVDRPERPTSPVARFLEPAANILPITEGPGEHPSPPLFEPSSSSLNDTIGPAHSQQHPVIVVPKPIPSPPPVSPFALGSPSSHQRV # LNPSQLVATLVLRHREKTAVRSRGCSQVGNDTFGKGMMRPSPLACEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 Scaffold_14 AUGUSTUS gene 319260 319736 0.6 + . g49 Scaffold_14 AUGUSTUS transcript 319260 319736 0.6 + . g49.t1 Scaffold_14 AUGUSTUS start_codon 319260 319262 . + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_14 AUGUSTUS CDS 319260 319736 0.6 + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_14 AUGUSTUS stop_codon 319734 319736 . + 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MQARSSFVLKEIAICNAFNASNLCTFLEMQNSLRRLTLSALHSCKLQNVVSWLSNKPSALPCLQELHLLGGQMKMGSE # DPWEGLVDIIHGRAQLPGELMGVCGNLQLLDIRMSKTAFGRMDQDELNSLQQYRDLGLDIRFHIWLSNGKLVDAVDHLAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # start gene g50 Scaffold_14 AUGUSTUS gene 324094 326625 0.2 + . g50 Scaffold_14 AUGUSTUS transcript 324094 326625 0.2 + . g50.t1 Scaffold_14 AUGUSTUS start_codon 324094 324096 . + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_14 AUGUSTUS CDS 324094 324486 0.2 + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_14 AUGUSTUS CDS 324556 326625 0.99 + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_14 AUGUSTUS stop_codon 326623 326625 . + 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MQVDAVERRRKELESRIAKRDGTWKHEIHNQKAESEQTLGRSKRLSTDSGKFADGGVGSKIQSWITRAPKTERTVPVR # ETIIPQTAKAPKDPHRKRSTHTSSPHIPLKPKIATNSSGLPQLKEFYRPPPSLTQRKGKLSTVPLTSSSTQESTSFSSPPLLPGLVSCLNDILGPQAS # PTEIQRLSIARVVDAVNSPDSSTLPSLALEPVSEPSAYKEFLLASETGSGKSIAYLLPLLQSLKVSELAQNAQKTSSTYGPASKYAYNPRSLVLAPTH # ELARQLSGFAKTLSHEIKLRVVCTSRANGNNREKDKDRAPDKESMVLREMRVTEKEGEQIADGVTELDVRPLSRDSSAHILTGSVGSSTSGSTRPVDV # MVGTPMKFLEMIFGRGWDRADATDANNGHANTRRSIGKPEMGLSNIEWVIIDEADVLFDPDFNSFTRLILAEISKARGKEVIFVKEDKVLSAECYPEA # PDVAEEPKEENDRSDSASESLQSTSVTSAASVIPTKYPFNLILTTATIPPALLLYLQQHHPAIFARRPRRSLRPNAGIIRSSGLHRLPTSLKIEQVDW # SGGNKLADIEKRLRAVWMEDERRWMGNMGKGPTELSKIIVFCNKSAKVDDLGAYLEEKGIKTVTLTSRIGSLSTVVEAGEDNPNPGVPVEEGKSDKAE # RKGSERRRGSNKHLEGFLRVRSKSRDSSDSNPTTEGQSSTSSAPRRLQPLVISSSASPSSRTSKPPSTPATPTLSNTPHVLLTTSLLSRGLDFAPSVR # HVFIVDEPRNVVDFLHRAGRTGRAGTEGVVVVFGKGGRSTSQGKKGLPMEWRGGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 Scaffold_14 AUGUSTUS gene 327151 327979 0.83 - . g51 Scaffold_14 AUGUSTUS transcript 327151 327979 0.83 - . g51.t1 Scaffold_14 AUGUSTUS stop_codon 327151 327153 . - 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_14 AUGUSTUS CDS 327151 327404 0.83 - 2 transcript_id "g51.t1"; gene_id "g51"; Scaffold_14 AUGUSTUS CDS 327499 327979 0.84 - 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_14 AUGUSTUS start_codon 327977 327979 . - 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MASSGWSLFKPTDLIRLTAFLLLTCYFWSVAALDKSVAPGGNFDFSNWELQLCTGSKGSPDTESSSSLKGDGGYEDDK # YFYTSSTDGALVMKVPGSPSSSGCVTTTNSLHCRTELRELGSWDPQDTNKLTVSLAVIQADDSEHGTVIGQIHIDDSVSTKVTGVEQTRSGGDEKFTT # FETTVPLGTEFTYEIDYSGGTLKVTVNGEEMTLDTYDLDSPKSYFKAGNYNQGSSPSEVHFYSISIEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 Scaffold_14 AUGUSTUS gene 329399 330443 0.95 - . g52 Scaffold_14 AUGUSTUS transcript 329399 330443 0.95 - . g52.t1 Scaffold_14 AUGUSTUS stop_codon 329399 329401 . - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_14 AUGUSTUS CDS 329399 329636 0.99 - 1 transcript_id "g52.t1"; gene_id "g52"; Scaffold_14 AUGUSTUS CDS 329704 330443 0.95 - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_14 AUGUSTUS start_codon 330441 330443 . - 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MQIDQLFLFVAGSSDLWIPSSLCNSTACSSKHKYNASSSSTSQNETGTFSIQYGDGSTVSGSIYSDTVTFAGVKVQRQ # RFSPVTNLSSSFASDPVDGVLGLGFPSISILKADPVFVSAAQQNAITTKAFSFYLAKNNSELYLGGTNPKLYNDPIEYHPVDKSNGFWQVKNASITVG # GQTVFSDFDTIIDSGTTIMYGPPDMVKDIYSKVEGAEVFDSSEGFYSFPCDKVPEISFSWGGENFAISSENFNLGTTAPNASTCAGALAAKDLGLGNT # TLLLGDRFVQSIAPLKCELLSSEPVNSYSWMKNAYHVFSLEETAVGFAKLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 Scaffold_14 AUGUSTUS gene 332984 334281 0.27 - . g53 Scaffold_14 AUGUSTUS transcript 332984 334281 0.27 - . g53.t1 Scaffold_14 AUGUSTUS stop_codon 332984 332986 . - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_14 AUGUSTUS CDS 332984 333708 0.71 - 2 transcript_id "g53.t1"; gene_id "g53"; Scaffold_14 AUGUSTUS CDS 333844 334000 0.3 - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_14 AUGUSTUS CDS 334063 334281 0.71 - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_14 AUGUSTUS start_codon 334279 334281 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MEIPDPASASQDPVHVRRTEEQGGDTVNLPPHDPPTTSNGVFDSSKARELNHNALAKYTQINSNSQNSDGTPQGTESS # VKTGGTAGDQSSVKIRRGDKSDKKDEEGLTDEEGDVEWAGKPNDPICSGSSDLWVVDKSCTEGPCSNKKQKYDAGKSKTSKQESGTFSILYGDNSTVS # GPIHSDTVTVKGVTAKDQKFSSVTTLSKSFADDPTAGILGLAWPKISNLKATPWFLNAAEQGAVKTKEFGFHLSSGKGSELYLGGTNPELYEGSLEYH # KVDPSDGFWKVLDASIYVGGKEAGKDFSTIIDSGTTLMYGPPDAVKELFSKVDGAKLYDETEGFYSFPCDKVPEVSFSWGKKGKKFVIPSEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 Scaffold_14 AUGUSTUS gene 376687 377721 0.44 + . g54 Scaffold_14 AUGUSTUS transcript 376687 377721 0.44 + . g54.t1 Scaffold_14 AUGUSTUS start_codon 376687 376689 . + 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_14 AUGUSTUS CDS 376687 376813 0.77 + 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_14 AUGUSTUS CDS 376929 377320 0.58 + 2 transcript_id "g54.t1"; gene_id "g54"; Scaffold_14 AUGUSTUS CDS 377392 377721 1 + 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_14 AUGUSTUS stop_codon 377719 377721 . + 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MLELLSGFKGSIETLGTILATLGRPSDSSESKSKVKEPEVFDGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDN # FSVYDAQGQAEDSLGNLKMKETENIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPAMLADYRQEVLRIDNRYWKREETRKREAGKPFPSG # SSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPVFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIANCNKRKARESKGRAAEVEETPEATIE # VVEEESDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # start gene g55 Scaffold_14 AUGUSTUS gene 378055 379317 1 + . g55 Scaffold_14 AUGUSTUS transcript 378055 379317 1 + . g55.t1 Scaffold_14 AUGUSTUS start_codon 378055 378057 . + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_14 AUGUSTUS CDS 378055 379317 1 + 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_14 AUGUSTUS stop_codon 379315 379317 . + 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MANIAIQFPSGELLLLPFYVTHLDSSCKAVLGYSSLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSATNTVDAKVAV # LLLKLSPSVSLTILETCSCSRSQTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEIDIALVSAAVFKRACKDAGMEPILLRAIHSEVAARAADRSST # TPTVPPLPPSIPAEYAEFADVFDEIAADSLPEHRPYGLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKL # RLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVC # VIVYLDDILIYSDTPEEHQEHVKEVLRRLRKHRLYANPEKVRIQYGYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 Scaffold_14 AUGUSTUS gene 380879 381142 0.75 + . g56 Scaffold_14 AUGUSTUS transcript 380879 381142 0.75 + . g56.t1 Scaffold_14 AUGUSTUS start_codon 380879 380881 . + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_14 AUGUSTUS CDS 380879 381142 0.75 + 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_14 AUGUSTUS stop_codon 381140 381142 . + 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MKLRSINLNRSKDSIYSFDQGRFSTLCALVCIDLGISRIGVLNQSKLKPKHTDPYGGLELCAGTTTQRDLPLRPTTDP # KFEEYPTTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 Scaffold_14 AUGUSTUS gene 383542 384246 0.33 + . g57 Scaffold_14 AUGUSTUS transcript 383542 384246 0.33 + . g57.t1 Scaffold_14 AUGUSTUS start_codon 383542 383544 . + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_14 AUGUSTUS CDS 383542 383717 0.59 + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_14 AUGUSTUS CDS 383769 384246 0.46 + 1 transcript_id "g57.t1"; gene_id "g57"; Scaffold_14 AUGUSTUS stop_codon 384244 384246 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MMRLAPSKDLDVFASLRGKVSPAVASKISTPSPPLEIKPSTPAPKAPVAPPRLIRRNRDSLISYFYSFNLIAVSSPRS # THSRDSDNELLSGFPSAVSAARASSSTKVSVDRKVPKPKTTVKVVEDSKASQPTPTAMVYKRVRLPPRSRKVAPTPAKGKSRQVVVSEDDSASNEVES # EDEEEDEDEDEDIAPPPKRLKTTSSISGKIFFFIFRLILLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 Scaffold_14 AUGUSTUS gene 390804 391667 0.73 + . g58 Scaffold_14 AUGUSTUS transcript 390804 391667 0.73 + . g58.t1 Scaffold_14 AUGUSTUS start_codon 390804 390806 . + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_14 AUGUSTUS CDS 390804 391667 0.73 + 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_14 AUGUSTUS stop_codon 391665 391667 . + 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 Scaffold_14 AUGUSTUS gene 392054 394615 0.07 + . g59 Scaffold_14 AUGUSTUS transcript 392054 394615 0.07 + . g59.t1 Scaffold_14 AUGUSTUS start_codon 392054 392056 . + 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_14 AUGUSTUS CDS 392054 392289 0.49 + 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_14 AUGUSTUS CDS 392443 392870 0.34 + 1 transcript_id "g59.t1"; gene_id "g59"; Scaffold_14 AUGUSTUS CDS 392990 393495 0.23 + 2 transcript_id "g59.t1"; gene_id "g59"; Scaffold_14 AUGUSTUS CDS 393846 394138 0.41 + 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_14 AUGUSTUS CDS 394195 394615 1 + 1 transcript_id "g59.t1"; gene_id "g59"; Scaffold_14 AUGUSTUS stop_codon 394613 394615 . + 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPT # KVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLNGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDI # VESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKL # NQTLGLARNIPFKFGEVTQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFN # LNPIKSFFLQNGGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKA # QDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 Scaffold_14 AUGUSTUS gene 395294 396736 0.67 + . g60 Scaffold_14 AUGUSTUS transcript 395294 396736 0.67 + . g60.t1 Scaffold_14 AUGUSTUS start_codon 395294 395296 . + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_14 AUGUSTUS CDS 395294 396736 0.67 + 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_14 AUGUSTUS stop_codon 396734 396736 . + 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN # VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV # YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP # YQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGK # YLSNPSDESW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 Scaffold_14 AUGUSTUS gene 396890 397937 0.89 + . g61 Scaffold_14 AUGUSTUS transcript 396890 397937 0.89 + . g61.t1 Scaffold_14 AUGUSTUS start_codon 396890 396892 . + 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_14 AUGUSTUS CDS 396890 396895 0.91 + 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_14 AUGUSTUS CDS 397014 397937 0.89 + 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_14 AUGUSTUS stop_codon 397935 397937 . + 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MITDEAVESTSYLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLP # FDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMV # VIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 Scaffold_14 AUGUSTUS gene 398388 399840 0.35 - . g62 Scaffold_14 AUGUSTUS transcript 398388 399840 0.35 - . g62.t1 Scaffold_14 AUGUSTUS stop_codon 398388 398390 . - 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_14 AUGUSTUS CDS 398388 398603 0.98 - 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_14 AUGUSTUS CDS 398663 398814 0.98 - 2 transcript_id "g62.t1"; gene_id "g62"; Scaffold_14 AUGUSTUS CDS 398896 399031 0.86 - 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_14 AUGUSTUS CDS 399673 399840 0.48 - 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_14 AUGUSTUS start_codon 399838 399840 . - 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLHLKSRQDSGSDSSVSDASFATAQS # ITTIGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 Scaffold_14 AUGUSTUS gene 400920 402894 0.16 - . g63 Scaffold_14 AUGUSTUS transcript 400920 402894 0.16 - . g63.t1 Scaffold_14 AUGUSTUS stop_codon 400920 400922 . - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_14 AUGUSTUS CDS 400920 401467 0.93 - 2 transcript_id "g63.t1"; gene_id "g63"; Scaffold_14 AUGUSTUS CDS 401789 401921 0.74 - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_14 AUGUSTUS CDS 402068 402174 0.31 - 2 transcript_id "g63.t1"; gene_id "g63"; Scaffold_14 AUGUSTUS CDS 402228 402620 0.85 - 2 transcript_id "g63.t1"; gene_id "g63"; Scaffold_14 AUGUSTUS CDS 402684 402894 0.46 - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_14 AUGUSTUS start_codon 402892 402894 . - 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFFSSPRSTR # SRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKIAPTTAKGKSRQVVVSDDDSASNEVESED # EEEDEDEEEDSAPPPKRLKTTSSLPASLPRRSVKRVTVPKRVSKAAAKSAPERPSDSTFRPNSAALNRENPLLAINPDFVELGSILETQNARFTMQDL # MQVNRVIHLAISLRRAIDLNDQLKQLESLFDSTRDLFLRSILDLQNAGEDPIVVLEALKAAEPNRRAISLNEWTLMATLFRWPSPFNLSGLDFDNRTP # GEWIDLLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 Scaffold_14 AUGUSTUS gene 409271 409714 0.73 + . g64 Scaffold_14 AUGUSTUS transcript 409271 409714 0.73 + . g64.t1 Scaffold_14 AUGUSTUS start_codon 409271 409273 . + 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_14 AUGUSTUS CDS 409271 409714 0.73 + 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_14 AUGUSTUS stop_codon 409712 409714 . + 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MAAEDAGEPLDDGEMEFEDEEADEEVHAEPSPPINLSNNAPSASRNRKKYAKLTKRSRAKRAAEAVERVVTRGVKPFV # VELAKGALPLELEDFDSSSLPVSSSGWNANPRKRLSPGLQRVWKNLEALSSLSGLKLLRWDGECVQHIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 Scaffold_14 AUGUSTUS gene 417558 417839 0.54 + . g65 Scaffold_14 AUGUSTUS transcript 417558 417839 0.54 + . g65.t1 Scaffold_14 AUGUSTUS start_codon 417558 417560 . + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_14 AUGUSTUS CDS 417558 417839 0.54 + 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_14 AUGUSTUS stop_codon 417837 417839 . + 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [METGQIVEQSNTPIVSASGISVDPSCNTTVTVTCLKQLYNATDITPSANINNSFGITGYLDQFANFQDLQSFFAVQVP # EAVNSSFTVLSVAGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 Scaffold_14 AUGUSTUS gene 426036 427079 0.28 + . g66 Scaffold_14 AUGUSTUS transcript 426036 427079 0.28 + . g66.t1 Scaffold_14 AUGUSTUS start_codon 426036 426038 . + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_14 AUGUSTUS CDS 426036 427079 0.28 + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_14 AUGUSTUS stop_codon 427077 427079 . + 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MAGTKGMLAARQPLVVPMLLRLSHFKLRSIIVLVVSKQKGITLVFKTDPLQNVDINSTFDSIAVIQKFIQREIEGQLR # QMFREDLPGIIHRLSQQWIKAKVEAPYISKRPSAPPAPPAPSPILNSSPIPAPLSFDNVAGLSSHHTMPYTRVPHSTRASSVHRSRSTYSGVTGTTRR # PVTRKNTTPPSPPDDMQSTFPDLENYDPTYGLRPEGLPTKSVFKGFRNLFTPNRGLADLNEDPSEPDTDSEPSYDHEHEDSTTYDMVDWDGVPGLASP # GSQSDFTYTPEDHGMEYETIPAVGGGSVISPTGGAFAIHDSGCCSFRVHHLCQDVWVGVQRILLFLHYVPGWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 Scaffold_14 AUGUSTUS gene 428268 429305 0.74 - . g67 Scaffold_14 AUGUSTUS transcript 428268 429305 0.74 - . g67.t1 Scaffold_14 AUGUSTUS stop_codon 428268 428270 . - 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_14 AUGUSTUS CDS 428268 429305 0.74 - 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_14 AUGUSTUS start_codon 429303 429305 . - 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MKFFERCTKTLLASIELETQRDTDIQTVVLLYQIGLHVRLLGNMLQTGSDMLDWCLGALGTVQEAFSSLTTSLANLAI # ARVVSSHLDTVVKTLLVHCDRGFEDNKFRFTLVVLFLRTARLGDKSAVEFNSLLPKAVAVLTTLPLESMDLDMLRLDIGQTLATFKTPLSNSNLSTEI # SSAILSLMTWLSAQPSEEGLTVFCGIKSDNLVSLYDSLEASLPEEQLDTLNKLRTILTVDEDVKILPENMNIPDTLQLSMQELQDILSPLSSFLPIAP # STPTRNNIPDVLGLVISPPAALLRSPAATGLTKTYLNNDFRELRQAAVARQNTSRLPSMHGTSPTITIYFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 Scaffold_14 AUGUSTUS gene 435056 436519 0.88 - . g68 Scaffold_14 AUGUSTUS transcript 435056 436519 0.88 - . g68.t1 Scaffold_14 AUGUSTUS stop_codon 435056 435058 . - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_14 AUGUSTUS CDS 435056 436519 0.88 - 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_14 AUGUSTUS start_codon 436517 436519 . - 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MSSGGVLSSSPVSTRGGSPVRRKGSSSISVNDSENRPRLSPTLARSFDPNDPQVRERQQTLDMDMAMQLSKARRDTIT # TSPTTTHQEIQAESQDVVAQAGLSPREQRDIDIAQGPSMEEIDDLESIITKRQPSPVDLRDLLPQSHDPSLLVSLNGAVHPSADRDDPSTSAYGVLPT # YQANMSQSAFNFAPMEVFAASERLKLGITSPSNNTTKFNLPPPRNRQNTDDVFFPRQAPPLPSFADVAGPASTDVPITSGETIDSALSDSAAASSSTP # IRQRKLSQSNPHPRSHRKGIGGKLALFENTHGGSSGPNRIPFSLGPGGNASAIGVPIANDLPSFDNGSPSLFRPATIPATQYPSVPGLNAGHDRPYRF # SFYSNALPSTIHARSLSEIPAEGQTFEDLFAGINRDRNDPNAKDKDKRPTSAGPKGYFPGNVKPTYRSRPGFGGGLGFSSYEGADPESCTWWLDVLSP # TDEEMTMLSKVSSVCDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 Scaffold_14 AUGUSTUS gene 436859 437434 0.88 + . g69 Scaffold_14 AUGUSTUS transcript 436859 437434 0.88 + . g69.t1 Scaffold_14 AUGUSTUS start_codon 436859 436861 . + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_14 AUGUSTUS CDS 436859 437434 0.88 + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_14 AUGUSTUS stop_codon 437432 437434 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MNGVRRFLGGGFNDTQSPGPPASLELGSPPSSALPLASASTASAYSNYSDSPSPSIQPKSPTTITAALFLKKKDKSRP # SLGGSQASLDEIRASTSTRARSNTTSSSSSSVNGLARKSLSSTRPIQRNTRDDLLLSLLASEAVVESRDFAILSSEEIDELKKVSFHRIIYSDSFGSS # SVLDAYRRKFVFHHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 Scaffold_14 AUGUSTUS gene 437968 439849 0.97 + . g70 Scaffold_14 AUGUSTUS transcript 437968 439849 0.97 + . g70.t1 Scaffold_14 AUGUSTUS start_codon 437968 437970 . + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_14 AUGUSTUS CDS 437968 438618 0.98 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_14 AUGUSTUS CDS 438749 439849 0.99 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_14 AUGUSTUS stop_codon 439847 439849 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MEVQAAQDKTISLENEVLPKLETELENFKREKDYWDEERDAYQAEKMRWENERAMLQQMQQAKGGADAMLAEVRQNLL # DMQQQLDAKEGELRQLQTQLSQSQSQLSQTQLQLSQLEQSHAEVTEDLDSGRAFVQTLVQTHAIVLFSRDPSLKGLLSAIGTHLEGLSNKLLSTEQTS # AQRDAELRQRESEWEAQKRRLEEDVRMGLDKREELSRELDIDSVTLRSPTSPSRQLFSPATSFTSIAPSPPTLSISTLPGDNIEYASPEALSVLSALK # PLWAVLPSPEARAAKFASSRERAFRTGSGPSSPTMTNRPSSPAGNTPKSISDLDVRSLKSLYDSTKNPSSISSPQSEFTLSSFISRVQSLLTDDRLLI # ERLLRFAQAHDLLKKNADRAQKLASEANSGLETYSRQVRILEGRNADLVRRCGELQGELTELQGLQEVVDRISAAKSDIEIQAAEQAETCRQLTEANN # MLSARALALAEEAAQAPEMVRRQMQKELDDVKAAAARATTLSGVATSFGEHEALQAELVKVKKELKEALEEMEAMQTSSQAQNVMLMDELMVTQSENA # DLKNQLRGLKKVGRA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 Scaffold_14 AUGUSTUS gene 447556 448098 0.56 + . g71 Scaffold_14 AUGUSTUS transcript 447556 448098 0.56 + . g71.t1 Scaffold_14 AUGUSTUS start_codon 447556 447558 . + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_14 AUGUSTUS CDS 447556 448098 0.56 + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_14 AUGUSTUS stop_codon 448096 448098 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MDTVEDDDGDEDWEPIASAQPSGAQPAMGSTVGEWFVDRSRFIPLRLTLGERKFLRLLEAALSVSEYTDKIDTLSFGQ # SKAKRIVAQIKELCAIMSGLLLSADYKAGQELFQDRDFQANEDFYQTVFELGRRHKIMNPDKMRTTYGKLIYILQVWHLKSPLSFLALICSRTAKHPR # SRIY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 Scaffold_14 AUGUSTUS gene 451416 452480 1 + . g72 Scaffold_14 AUGUSTUS transcript 451416 452480 1 + . g72.t1 Scaffold_14 AUGUSTUS start_codon 451416 451418 . + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_14 AUGUSTUS CDS 451416 452480 1 + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_14 AUGUSTUS stop_codon 452478 452480 . + 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MSRLVFKRYSSTITVKSTPSKAHHHQPIPVSSFPSGYLLTGVHAGVKKKAGALDVGVILSTSERPTSAAACFTRNAFK # AAPVIISEKILGENVGRARAVVVNSGCANAVTGAQGIEDAWAMAKETDALLPSNSSASPPTTSQTLVMSTGVIGQNLPISKILSAIRSQRDGNQQTLG # NDFNAWERAAKAFMTTDTFPKLRARKFNINGVEYRMAGMDKGAGMIHPDMGPPALGPLHATLLGCIMTDAAISPRSLQRALTYAVERSFNSISVDGDM # STNDTILLLANGAAAEKDGVKLKEIDEGTDREAFEVFKRELTDFTIDLAKLVVRDGEGATKFVTVTVKVCNLFHCSLFGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 Scaffold_14 AUGUSTUS gene 457833 458601 0.41 + . g73 Scaffold_14 AUGUSTUS transcript 457833 458601 0.41 + . g73.t1 Scaffold_14 AUGUSTUS start_codon 457833 457835 . + 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_14 AUGUSTUS CDS 457833 458136 0.41 + 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_14 AUGUSTUS CDS 458231 458601 0.98 + 2 transcript_id "g73.t1"; gene_id "g73"; Scaffold_14 AUGUSTUS stop_codon 458599 458601 . + 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MLLCSMMMERRSPGQKDTSTYDRLWSTCHHLNGVVSYRYFGRAKDLPGVRELFQSRKVDEDEDNQTLAYYKKFMNQGP # AYYGDLDEEDESFLESERLAEEEGLSEEDPIPQMVRPKPPSASSDPSTVQSKPKARTADSVGDNSEPSPSDSQPKTPASNATIPADQSQQASLHAQTA # ASFIPFLSAENLLPPKMPTRVEMEQVLLDLKKKALVEEYFGDEKMAET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 Scaffold_14 AUGUSTUS gene 464688 465140 0.65 - . g74 Scaffold_14 AUGUSTUS transcript 464688 465140 0.65 - . g74.t1 Scaffold_14 AUGUSTUS stop_codon 464688 464690 . - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_14 AUGUSTUS CDS 464688 465140 0.65 - 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_14 AUGUSTUS start_codon 465138 465140 . - 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MSYVGTGFLTRNRNEQDVEDEIDIDGDDAEIFGSAQFHEGDILDVDVPPTTAARTQPTSGRFQTGGVDDTFSEGDQPA # KILRDLIADSKARQSSIPQEVAVIPEIDKADVAILMAKSRGTQAALVVALENKIKLLVGFLSAVLLWNRYSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 Scaffold_14 AUGUSTUS gene 467206 468024 0.67 - . g75 Scaffold_14 AUGUSTUS transcript 467206 468024 0.67 - . g75.t1 Scaffold_14 AUGUSTUS stop_codon 467206 467208 . - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_14 AUGUSTUS CDS 467206 468024 0.67 - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_14 AUGUSTUS start_codon 468022 468024 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MPVATSTMVNTSSSLVHSPSAVDVIKNHSLAYGTPSKGSKVKQSRVLDKVYHRAARAFLNRNVALTHELLDTGFKILE # GAGLNTTYLWKWDILRITFDTMLYTSPPFSSASHIPFMSEILSKPAQSFVEDMYIRSLNLFQQNENNATAALPAQVLSTLVYSSLKVDAPDIGRRMIE # DWLVSRGDTTDLSSSWTSTFTSLTENSMSDGYDADGSVNGDSPVDVSLVKGSDGYAKILELYCLQVLPKLGQWEYAMEFLEYESELELEPRDVSFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 Scaffold_14 AUGUSTUS gene 471128 471484 0.74 - . g76 Scaffold_14 AUGUSTUS transcript 471128 471484 0.74 - . g76.t1 Scaffold_14 AUGUSTUS stop_codon 471128 471130 . - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_14 AUGUSTUS CDS 471128 471484 0.74 - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_14 AUGUSTUS start_codon 471482 471484 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MQYLNRDGDDMRVGGLAGNGNDPPPAMGSGNGIIVPTPTSGAFPSQTSPLMRNDPLGPGFANAVPGTPGPAAAEAYYE # LGMDPLGDLYGDEMIEDLEEEALDLAIEEVLLKPWSPSDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 Scaffold_14 AUGUSTUS gene 471782 473363 0.88 - . g77 Scaffold_14 AUGUSTUS transcript 471782 473363 0.88 - . g77.t1 Scaffold_14 AUGUSTUS stop_codon 471782 471784 . - 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_14 AUGUSTUS CDS 471782 473247 0.96 - 2 transcript_id "g77.t1"; gene_id "g77"; Scaffold_14 AUGUSTUS CDS 473309 473363 0.88 - 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_14 AUGUSTUS start_codon 473361 473363 . - 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MDYDRWDALLHHIFKQTQGDAWFRPAEENLSSGVAIRVADGPVPEYRVFPYENVSLEPFEAAVKKLGPVVAVKVRSAA # VHAAIAEAPPDDNSLYVDVNTRIQIIDTMLQLPFADKEQCAAFIRDERVLVVWSNSLDTIIPVCQDFDASLIKLLWRSRPTGTATSSSLHSQSFLGAG # SVSGHDSASVSVHSQGLITAAESGRPVETKTIRTWYGRKRTVPVAPSITGPEPPRKLALYAPLYNGLAAGLALVFIGNGVRVLIREFLLTAPVPDTPN # PEPTSMQRYLRFVLAVTLPFLYCVSLFFTLQILQNVTMAIGPIAHYHQNSRYYSAVPPKAPQSTTEEDKPEVLPHITIQMPVYRESLETVLAPSIASL # KRAMQTYARQGGTSSIFVCDDGMRTSGMSKADRDERIRYYRSEGIGWVARPRDGCPAGGLDSIEEALDATADPEKGFGAKKKKSKSDSSHRGIPVFVR # AGRFKKASNMNYGLSLSLCMERHLMGLVEAKKANAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 Scaffold_14 AUGUSTUS gene 474895 475727 0.3 + . g78 Scaffold_14 AUGUSTUS transcript 474895 475727 0.3 + . g78.t1 Scaffold_14 AUGUSTUS start_codon 474895 474897 . + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_14 AUGUSTUS CDS 474895 475211 0.3 + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_14 AUGUSTUS CDS 475271 475727 1 + 1 transcript_id "g78.t1"; gene_id "g78"; Scaffold_14 AUGUSTUS stop_codon 475725 475727 . + 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MVSLKTSTRSCIVHIGGWTFGTIGSEATFATNMSVRESSFISCFGHYRFPAGAKCIVISVNYRLAPEYKYPIAVEDAV # ESLQWVLRNGKTELNIDTAKIAVGGSSSGGNLAAILALKAAEPSFTPPLPSPLVFQLLVVPVTDNTATDGPGGLWEENKHTPWLSPARMNWFKDNYLP # NKEDWTKWTASPIFAPAELLAKTPNAWIGLGELDILKGEGVKYGEKLKEVGVKEVEIVIYKGGPHPIMAMDGALFLLRVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 Scaffold_14 AUGUSTUS gene 476118 476690 0.97 - . g79 Scaffold_14 AUGUSTUS transcript 476118 476690 0.97 - . g79.t1 Scaffold_14 AUGUSTUS stop_codon 476118 476120 . - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_14 AUGUSTUS CDS 476118 476690 0.97 - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_14 AUGUSTUS start_codon 476688 476690 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MGIFPIIMNILQFWLIDSIVKASSSPVALGADLDAPDPGNPDREPLFGVPSDDEDDDNLRPRHGAEHQRPRSRSRSSP # NSRSHSRDKSITFSDNPYESKSSGSGSRTEVADTHSYPPSLSSSLTSTSSTSSMREASKLNKKRRPPPAPLNLSPAPQPLSIPSKPATRPTNDRPIVV # DPSRDEWADTWHDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 Scaffold_14 AUGUSTUS gene 483356 484646 0.39 - . g80 Scaffold_14 AUGUSTUS transcript 483356 484646 0.39 - . g80.t1 Scaffold_14 AUGUSTUS stop_codon 483356 483358 . - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_14 AUGUSTUS CDS 483356 484089 0.74 - 2 transcript_id "g80.t1"; gene_id "g80"; Scaffold_14 AUGUSTUS CDS 484175 484646 0.39 - 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_14 AUGUSTUS start_codon 484644 484646 . - 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MDGVDQLNNILIIGMTNRKDMIDEALLRPGRLEVHMEISLPDEHGRLQILNIHTARMRTNGVMDDDVDLPEIASVTKN # FSGAEIGGLIKSATSFAFNRHVKVGTMAGISDDVENLRVNRRDFMSALEEVHPAFGVSEEELLQVIQNGIIHFDPIIDVKQVRTSTRTPLVSVLLHGP # AGSGKTALGASIAQASQFPFIKLISPDSMVGFSESQKVTAINKIFADSYKSPLSVIVVDNLERLLGSLLFEFLIHRKLTPSCLPEWTPIGPRFSNAVL # QTLLVLFARRPPKGRRLLVIATSSLRPVLTEIGLSEVFDSELRVPPISNLVALEYVIQEVELFSSSQERREAIRMLEDAGFASTEGDETSGRLHIGIK # KLLSMIEMARQEPDNVAQRLTGALMGLGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 Scaffold_14 AUGUSTUS gene 485029 485533 0.61 - . g81 Scaffold_14 AUGUSTUS transcript 485029 485533 0.61 - . g81.t1 Scaffold_14 AUGUSTUS stop_codon 485029 485031 . - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_14 AUGUSTUS CDS 485029 485221 0.62 - 1 transcript_id "g81.t1"; gene_id "g81"; Scaffold_14 AUGUSTUS CDS 485274 485452 1 - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_14 AUGUSTUS CDS 485531 485533 0.99 - 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_14 AUGUSTUS start_codon 485531 485533 . - 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MNLKGFVRAVSVLELAEEQRRGGGGGGGRAPQHMGILMDKTDVTFMKAPDSAIKIKSSAKKAPPNAILAPNFKFEDMG # IGGLDTEFNEIFRRAFASRVFPPGLVEKLGIQHVKGTFFRFQRYVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 Scaffold_14 AUGUSTUS gene 486578 486904 0.53 + . g82 Scaffold_14 AUGUSTUS transcript 486578 486904 0.53 + . g82.t1 Scaffold_14 AUGUSTUS start_codon 486578 486580 . + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_14 AUGUSTUS CDS 486578 486904 0.53 + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_14 AUGUSTUS stop_codon 486902 486904 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MSTSLSGKGLLLKADLIAAAFRDEVERSLAECSRSPKLVGILSTSSGPSRTYAEFTRKQCESLGFEFALKETGAALMN # GGLGEGEGVEEAIMEANEDDSVDGVMVSPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 Scaffold_14 AUGUSTUS gene 490777 491340 0.99 + . g83 Scaffold_14 AUGUSTUS transcript 490777 491340 0.99 + . g83.t1 Scaffold_14 AUGUSTUS start_codon 490777 490779 . + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_14 AUGUSTUS CDS 490777 491340 0.99 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_14 AUGUSTUS stop_codon 491338 491340 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MSSPPQPSTSTHAALYLDALDNPPPPAESEQLTWKKILEEDPYEGDHWVGVPGGIPLRRKHRPSAYTSEDDGDKSPDD # LDISPSLSPLNSDDLSLDDTDSEYEAFPLPDKSPNTVGLVTPVTNASYKPLYATHAYRRELEDLKFRQYWQPDWRMNSEADLQRRGTFDIGDASTLGL # DLTETFINHVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 Scaffold_14 AUGUSTUS gene 491738 492922 0.95 + . g84 Scaffold_14 AUGUSTUS transcript 491738 492922 0.95 + . g84.t1 Scaffold_14 AUGUSTUS start_codon 491738 491740 . + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_14 AUGUSTUS CDS 491738 492922 0.95 + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_14 AUGUSTUS stop_codon 492920 492922 . + 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MRHSSDARSNGRQTLSALDRIRATRVGKITRTLEAFADAIDTEIRMLEVWCSDKEEAWLRALGGLTPFLEFGKPNKGL # VVSLLGTEKAFRDQFEDSFNVMLDVVIQIVGEPESEGWALPTRSPSLTTTLLLDTLFSTVQQRLERGDKITADTLMRVCVRSAEPVWNMIGKWIGTGF # DMNRGHDQGQYQVGGELEEEFFIESNGLGIELGVLGLLDPDFWQDGYCLRDGAFLGSTSTSQENEEPTSTQTQRCIPSFLQHVAVPVLESGKAIGLLK # ALGADVQDLIDEEAQFLRDWQWTSFQNVVAGDPTSSSQNDTDGRALFSVSVDQLSRLIYDKLTPYAQAAGSLLAKVIFEKCDFWSHLRSIESLYMMRR # GDIISDFTDILFAKVDGQFRLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 Scaffold_14 AUGUSTUS gene 493902 494162 0.61 + . g85 Scaffold_14 AUGUSTUS transcript 493902 494162 0.61 + . g85.t1 Scaffold_14 AUGUSTUS start_codon 493902 493904 . + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_14 AUGUSTUS CDS 493902 494162 0.61 + 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_14 AUGUSTUS stop_codon 494160 494162 . + 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MNPSPQTSDSEREGDEDEEDYSYSVSINASTFAEGDDLFTKINKMSTDLDGLIRFIRRGVETLAGGTGDASTTFGILA # FSLEDWDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 Scaffold_14 AUGUSTUS gene 494525 495493 0.81 - . g86 Scaffold_14 AUGUSTUS transcript 494525 495493 0.81 - . g86.t1 Scaffold_14 AUGUSTUS stop_codon 494525 494527 . - 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_14 AUGUSTUS CDS 494525 495493 0.81 - 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_14 AUGUSTUS start_codon 495491 495493 . - 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MEHTLCRHPFILDPAIQQKLEQLSLEPQKTDPTRWVQTEEAVMRNPTGTVPEEQQEQPPLSSMQHTFSPSDQVSPGYG # SPYQYAPHLPPGLAINSAGMAYEVATGRPVYLQAPANMYAAPMMQPVPFVPSHVHHHSAVSSSEFIPAGTPPINGGYMEYTPTPSIFSFPRQSSRVQI # RAPDEPKQNARSTSTSEAVDLAAGQQSSTELRSDAVAFEPAEQYYSEGDGLTAVSHQHQVQDPMMGYYNPYYYPDPSMDITLTSTCHRLRRMRCFLRR # VLYTTSNLSVSFHLPAFLYFPRSSTIVVFFLWRQDLLITRPTSIKPCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 Scaffold_14 AUGUSTUS gene 496368 497033 0.66 - . g87 Scaffold_14 AUGUSTUS transcript 496368 497033 0.66 - . g87.t1 Scaffold_14 AUGUSTUS stop_codon 496368 496370 . - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_14 AUGUSTUS CDS 496368 497033 0.66 - 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_14 AUGUSTUS start_codon 497031 497033 . - 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MSAQVASSTSATARNMADNDSTSRTGGSQGKRRRFIRRRGRKPSLDSDDEVEREVRTDSESEDDLSSSDSTSDSDTEP # ASEDVQPNEQPRVLTPSTSQSPEGASHLLVNGHSQPFFGSSGNWSEMVANEAEHGPENLPVIDFTELDSQVLPLPNQSRKSKKNQKHINNRSSVPSLL # TSPAQPQTADELEESQESRAPSSHFTPRRPPGQSATPGLSATVRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 Scaffold_14 AUGUSTUS gene 502501 504851 0.94 - . g88 Scaffold_14 AUGUSTUS transcript 502501 504851 0.94 - . g88.t1 Scaffold_14 AUGUSTUS stop_codon 502501 502503 . - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_14 AUGUSTUS CDS 502501 503608 0.99 - 1 transcript_id "g88.t1"; gene_id "g88"; Scaffold_14 AUGUSTUS CDS 503656 504851 0.95 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_14 AUGUSTUS start_codon 504849 504851 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MSSPILALNILFRSPIPIPSGLFDSPDDLPTNLLRGATPNSDTVKWSYEYKRSASVTVVEGRRSGDVWLTNGDAADGK # SKVSRALGMMSPMPKLSVLPPEENADEPTTPPLPIQDGDSSMPVNLHSRSYSETSAQFGRIRKDSKASSYFSGADESLAFASKIMIAQKHYSALAQTI # QVSGSPEKGPSAGAELFLNGPIATTSAVDVPVSGSNRASQHLRTRSVTSVGPETPTSISFNASPSPPPAFPLPPTPPNVRAARLAKHKKSYSSISAGK # FSFGPVDDMNEIDALTAGVLPLLVPGLKVGDNMKIRDSPPATWRKRAMAELEISRERSRSRSTSRTRGEGRSARLLKALNEFGEDFSSPEIHSTPART # RAGATKAREARGRKISAHKRNHFSLPSLGLGKDGVQSLSYWSTELGRAIENRFGPYTAVPSNVEFRRNTVFGADSIPNDLSNLRAGPEEIVSQTNSRG # APLGRAMSTRSLGLRAEVPHGIDTARSSIQSMHNIVPPSAASTVTLFEDFVNGLESGPQAESTPHNNIAHKRGSEDIVPPLPSSSQFRTSTASHQYRN # PTNKNRSSSASSRRSSIVYIKSDENTTITPPNATSTSSTSAMSSLAQWSSRAVRPLMPKSSKLQRKASKASPPTQNTSKPESPRGGLRPLSLLQERDT # NSAVGTGVQAANSQGTRPLVLAKKEGAAISKKAKAMPADENASPDAPRSRRNKHNLKPLNLARSDTNKMRAILRQDELLPDVVVRPPSTTEHQVYAYS # FRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 Scaffold_14 AUGUSTUS gene 521332 522858 0.25 + . g89 Scaffold_14 AUGUSTUS transcript 521332 522858 0.25 + . g89.t1 Scaffold_14 AUGUSTUS start_codon 521332 521334 . + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_14 AUGUSTUS CDS 521332 522858 0.25 + 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_14 AUGUSTUS stop_codon 522856 522858 . + 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 Scaffold_14 AUGUSTUS gene 522888 523625 0.92 + . g90 Scaffold_14 AUGUSTUS transcript 522888 523625 0.92 + . g90.t1 Scaffold_14 AUGUSTUS start_codon 522888 522890 . + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_14 AUGUSTUS CDS 522888 523625 0.92 + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_14 AUGUSTUS stop_codon 523623 523625 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRICLKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 Scaffold_14 AUGUSTUS gene 523945 525203 0.85 + . g91 Scaffold_14 AUGUSTUS transcript 523945 525203 0.85 + . g91.t1 Scaffold_14 AUGUSTUS start_codon 523945 523947 . + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_14 AUGUSTUS CDS 523945 524317 0.86 + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_14 AUGUSTUS CDS 524392 525203 0.96 + 2 transcript_id "g91.t1"; gene_id "g91"; Scaffold_14 AUGUSTUS stop_codon 525201 525203 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ # VFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNS # QRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEK # PINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 Scaffold_14 AUGUSTUS gene 525274 527805 0.71 + . g92 Scaffold_14 AUGUSTUS transcript 525274 527805 0.71 + . g92.t1 Scaffold_14 AUGUSTUS start_codon 525274 525276 . + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_14 AUGUSTUS CDS 525274 527805 0.71 + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_14 AUGUSTUS stop_codon 527803 527805 . + 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPW # VERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDER # ELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVI # QRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKA # MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDA # SYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDP # RSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGE # MSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMKLL # KAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCCHEAAEAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 Scaffold_14 AUGUSTUS gene 530041 531339 0.36 - . g93 Scaffold_14 AUGUSTUS transcript 530041 531339 0.36 - . g93.t1 Scaffold_14 AUGUSTUS stop_codon 530041 530043 . - 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_14 AUGUSTUS CDS 530041 531339 0.36 - 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_14 AUGUSTUS start_codon 531337 531339 . - 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MGKSRNSRGTDGGSLVRRRIHLLPAASRGSQRDKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGA # PATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGY # NNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHDLYLRPEKCEFE # QQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALW # TPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYESTIEKCLLSSKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 Scaffold_14 AUGUSTUS gene 532044 533060 0.99 - . g94 Scaffold_14 AUGUSTUS transcript 532044 533060 0.99 - . g94.t1 Scaffold_14 AUGUSTUS stop_codon 532044 532046 . - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_14 AUGUSTUS CDS 532044 533060 0.99 - 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_14 AUGUSTUS start_codon 533058 533060 . - 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MALKPVAFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNVENPPFGGNWEAFLKEFSQRFEPMD # PGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPP # THTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGP # APFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 Scaffold_14 AUGUSTUS gene 534042 534761 0.81 + . g95 Scaffold_14 AUGUSTUS transcript 534042 534761 0.81 + . g95.t1 Scaffold_14 AUGUSTUS start_codon 534042 534044 . + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_14 AUGUSTUS CDS 534042 534761 0.81 + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_14 AUGUSTUS stop_codon 534759 534761 . + 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPR # FRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTANNWI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 Scaffold_14 AUGUSTUS gene 535147 536604 0.19 - . g96 Scaffold_14 AUGUSTUS transcript 535147 536604 0.19 - . g96.t1 Scaffold_14 AUGUSTUS stop_codon 535147 535149 . - 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_14 AUGUSTUS CDS 535147 535574 1 - 2 transcript_id "g96.t1"; gene_id "g96"; Scaffold_14 AUGUSTUS CDS 535656 535792 0.5 - 1 transcript_id "g96.t1"; gene_id "g96"; Scaffold_14 AUGUSTUS CDS 536206 536372 0.31 - 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_14 AUGUSTUS CDS 536437 536604 0.51 - 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_14 AUGUSTUS start_codon 536602 536604 . - 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLHRSTEYLHDLLPVTLRSHVRQISNLTARQSIID # TLCLGHKLFPDIVSDSHFEQHLKFMAFANECSCIIVAALLIPPLVPTKVPIRKKKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNL # DTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMAVPVPK # TVERATTPFTRGATPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 Scaffold_14 AUGUSTUS gene 552012 552371 0.64 - . g97 Scaffold_14 AUGUSTUS transcript 552012 552371 0.64 - . g97.t1 Scaffold_14 AUGUSTUS stop_codon 552012 552014 . - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_14 AUGUSTUS CDS 552012 552371 0.64 - 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_14 AUGUSTUS start_codon 552369 552371 . - 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MPDNSVRQFAGTRRVSNALDAASVSQADALATDYVGAFQGPSVLPLSHGSMFDPFFGVNIAASEQPTVGFDVQQQLFP # AYPSSFSFNPTAASADAASFDSGMDGSGFTTSFSSDWSNSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 Scaffold_14 AUGUSTUS gene 555354 557214 0.13 - . g98 Scaffold_14 AUGUSTUS transcript 555354 557214 0.13 - . g98.t1 Scaffold_14 AUGUSTUS stop_codon 555354 555356 . - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_14 AUGUSTUS CDS 555354 556390 0.41 - 2 transcript_id "g98.t1"; gene_id "g98"; Scaffold_14 AUGUSTUS CDS 556980 557214 0.32 - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_14 AUGUSTUS start_codon 557212 557214 . - 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MSSNLTSGNANEPAAATKAAPNSRKRKKAKFVKMEAKFAQSASTFDSVSVNSADSSVSMRIGNVEKVWWEAWMENRSV # RESCPDHFNLTCKELLCDDSQGTLSDTNGTLADSNAETQIQPDSTPVSPQSPKKTKKKKKKKSQAKPQAMTEVSAENSIASPVNFSVSVECEITSPAI # LSGWGGTAAVDSWGEGASSGWGNGGSASISGWGVVVDTPAAPLEDIGWESFSTLPPASSFVSAHITRALPQTHIRGVVEHAVRRVKAIIPPLEQDTIK # CKQEDNTILNSIALENELKRCYWTVVLEPWPIEGAQEFISILSTSKGNVDLHADQMTVEDGSINDLYVGSVKPHNCLSDDITIFLEDETRKVLRLGMG # LGGTWVQLLRVSDCAQGIKGEEEEKKKKRPNERRYWFLLEVLRILPSYYIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 Scaffold_14 AUGUSTUS gene 562038 562379 0.69 - . g99 Scaffold_14 AUGUSTUS transcript 562038 562379 0.69 - . g99.t1 Scaffold_14 AUGUSTUS stop_codon 562038 562040 . - 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_14 AUGUSTUS CDS 562038 562379 0.69 - 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_14 AUGUSTUS start_codon 562377 562379 . - 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MKVVSVSTASLEILPLGHGKPFDPDRSLIVSPSVLEAAAVGVPDDRLGELVTAIVTVKPAFRGKVSPNALMVLANKRS # GVLGLNTQHVANVVISLPKFAVPVMILVREDDFSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 Scaffold_14 AUGUSTUS gene 572304 572889 0.33 + . g100 Scaffold_14 AUGUSTUS transcript 572304 572889 0.33 + . g100.t1 Scaffold_14 AUGUSTUS start_codon 572304 572306 . + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_14 AUGUSTUS CDS 572304 572312 0.33 + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_14 AUGUSTUS CDS 572440 572889 0.76 + 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_14 AUGUSTUS stop_codon 572887 572889 . + 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MICSIDNKINIVSLLQSKREIALVHSIKEAGDLIFQRIDAFKFLEKSLLSSMGASPSDRASDTDATALNSLWNNFAGL # FSAAQKPNNPDPSVTEFQAHDIALYIRALKDCMVGFLHWAYETDIFFGTKGDTVKGFGWVFLLPNPSRRAETTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 Scaffold_14 AUGUSTUS gene 574561 575768 0.44 - . g101 Scaffold_14 AUGUSTUS transcript 574561 575768 0.44 - . g101.t1 Scaffold_14 AUGUSTUS stop_codon 574561 574563 . - 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_14 AUGUSTUS CDS 574561 575490 1 - 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_14 AUGUSTUS CDS 575589 575768 0.44 - 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_14 AUGUSTUS start_codon 575766 575768 . - 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MNPSSPNSGAPSPVSDDSSIQPHSPLSSGDNNQNNSKIPVAKRKANRRASTAERRATHNADLAALLPNLSQLRRPSKS # AIVNSSIAHVHAARRHRLLASRELRLLKLESDALRRELNEWRNRASIPRIDEPVRGEGFSVVLSGEPEIIPIPGGAGLQEEGDEDGYGDEMDDDYMPM # STTTMHSDEEARVAALLKSQPQGPFVPAIDTNVHPMMRTSSMHSHPGVRPMASPAGGPMIASPTAMPFENPVIGRMYESVPYHAGDAYTGNYGPIQDK # WGPVGGYGPGNVNEQAYLRSLAQSRRSRSGSQSSGSASPPSVYYEQAGWNGNGMRNGGNMNGGMNMSMGMHNGNMGMVGGGGSTMGNGGVAFAMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 Scaffold_14 AUGUSTUS gene 593138 593824 0.5 - . g102 Scaffold_14 AUGUSTUS transcript 593138 593824 0.5 - . g102.t1 Scaffold_14 AUGUSTUS stop_codon 593138 593140 . - 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_14 AUGUSTUS CDS 593138 593824 0.5 - 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_14 AUGUSTUS start_codon 593822 593824 . - 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MNSIQNFTHLAKGQRNSHTSSSTPAASVASSSSLSSGASSSSDPFSAYQMPAPTRCPSSVVESPSFSSSVVGYASNHR # NATPSPSPSFADTTVSQSNYQNTGNSYSASDYWNESSSRSMGYFDSDKPHVRLSHHSELTPHQGRSTSNLAIEDAAQALSNSSSDVLSSQTPFRRSSS # GYTTPMGGDNFSGYADNMPAGQSSHLRSTVYESRYGMAIRNSSGGHYTQTSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 Scaffold_14 AUGUSTUS gene 602352 604010 1 + . g103 Scaffold_14 AUGUSTUS transcript 602352 604010 1 + . g103.t1 Scaffold_14 AUGUSTUS start_codon 602352 602354 . + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_14 AUGUSTUS CDS 602352 604010 1 + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_14 AUGUSTUS stop_codon 604008 604010 . + 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MPRPPTLYERVEPDHENNKPPHSQYNINYRQVAAQTSLVSPLYGVTQSVTTSSSSYDYWWPYPPGGVSTTTNSPSPSP # IISSTLADPLPVAILSSLSSDAFSSSTDSFADSTSSTSVSISTSTLTTSASQSIISINAAMSSQIAASTFTTYPKNSQNQNQSQSSNNSKSEVYLVPV # FVVLGIILGSVVAWIGWGCITRKPRIRDFDEDVAIGRKKTGRRPRRSELEVGPAYWSSMSERNNLLEDSGDSHEKNVVASQSAMFSWRSLDADGVKDE # EPQRDYLSPPKLPSKRSRAKTLGRIKHQQGLSRAVTSKTATSVSVYSQVGDEDETFDEDITDSMSFLDEFDPRTPHTGDKSAVATPNSSSSTRVISLS # RRRPNHTRTDSDSHLDIAGTPVGEPRDLKKNILSRTATARTQNSTRTAQTGFRMIEGSPSPTPAVSISDKSQTGGSFFWGNNEPEDRVTSSKPKSRGR # SNSHVLTRSSDSYTAFPVRGSRGRSNSPAKKPIVSRQAINQRQVSARDKVIEEYYGSSLPQSPPQVTCPKLESSLCFTPTLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 Scaffold_14 AUGUSTUS gene 614171 614650 0.98 + . g104 Scaffold_14 AUGUSTUS transcript 614171 614650 0.98 + . g104.t1 Scaffold_14 AUGUSTUS start_codon 614171 614173 . + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_14 AUGUSTUS CDS 614171 614650 0.98 + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_14 AUGUSTUS stop_codon 614648 614650 . + 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MATVAYSKSLANQFNQYEDGAATPSHGGIVPGGFEYDMPISQVQPGHQPQPQPRLTTSTRPRPVSMPPQSFNAAVAAI # PSPGPATDDRASERDKDTRDRDRDRERERRHVPSSRTSRSNRILGDYTLSKTLGAGSMGKVKLATHNMTGEQVVTARYSVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 Scaffold_14 AUGUSTUS gene 615412 616942 0.21 + . g105 Scaffold_14 AUGUSTUS transcript 615412 616942 0.21 + . g105.t1 Scaffold_14 AUGUSTUS start_codon 615412 615414 . + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_14 AUGUSTUS CDS 615412 615996 0.27 + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_14 AUGUSTUS CDS 616074 616449 0.62 + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_14 AUGUSTUS CDS 616602 616942 0.67 + 2 transcript_id "g105.t1"; gene_id "g105"; Scaffold_14 AUGUSTUS stop_codon 616940 616942 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MSSGSILGSECKHLLSRMLVTNPALRAPLTEILSHPWMIRGFSGPPENFLLHREPLRADELDRQVIHGMTGFEFGSDD # EIEKKLINVLESDAYIKAVQYWERKRGGTVNGSKWGESMSNSSLAVSFTSDGGTSYSSRTGIEPPTPSKKSKRFSGFDFYRRKLFSPSPSPSSSSNPF # SSSSPPQSQSQLISHGGALKMEREKVYGPGAFASSQLSIADPAHNRANNGINGVINGTPTAGVPSPVPERREKLSAPAPAALPIPIIAAPPSANTNAK # ADYSMPLPRLPAPETSHYSGMSTNNTAAPSPTSPSFQTAFQQGPQPLTSTAGTVGRGWGGMFNPPAPVDETGEKSYSPPSKLSPVMVGGRERPAMDAP # ASPTSARPPQLPHTAGPEVTSFAERERQNEEEKEKDHEHGYVPASPLTTGATLVRKLVVCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 Scaffold_14 AUGUSTUS gene 617041 618382 0.65 + . g106 Scaffold_14 AUGUSTUS transcript 617041 618382 0.65 + . g106.t1 Scaffold_14 AUGUSTUS start_codon 617041 617043 . + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_14 AUGUSTUS CDS 617041 617567 0.65 + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_14 AUGUSTUS CDS 617632 618382 1 + 1 transcript_id "g106.t1"; gene_id "g106"; Scaffold_14 AUGUSTUS stop_codon 618380 618382 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MDTTASASAQKAWSEKDKVMSIDEKSVETGSKEGKENTPVSSTVEPLSPKPISHSQSQSLSGVHRRAATILDPTGSRS # RHERRSSTGGALLSGAGIVGGTLGRHRRPSTGQSGMPRPLAERLFSRTDEEDEDEKKEAQAENEKDTRGVITGDEHGTDTEAEDDRHVKPVYLKGLFS # VATTSTKSPSLIKADIRRVLDRMQVQYREVKGGFECIHLPSIDISSVEPTTPGYRHNHHHHQQTSSGSGEPSTPRPTITKKSSKLSFSIRSRSIRDRD # TSMEKEREHPGRPSGTTTLTATPSTGSSSFFNVSQNHTAAEGDAATPTATINGVPTTPSLEVDAPAQTSPMTPITPNSPAGSTKSKVLPPIPRDFGPS # APPRSPSPMPSGQVDREVFETMGNNSLSVRFEINIVKVSKVFVLDTRLSDCLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 Scaffold_14 AUGUSTUS gene 622900 623295 0.99 - . g107 Scaffold_14 AUGUSTUS transcript 622900 623295 0.99 - . g107.t1 Scaffold_14 AUGUSTUS stop_codon 622900 622902 . - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_14 AUGUSTUS CDS 622900 623295 0.99 - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_14 AUGUSTUS start_codon 623293 623295 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MVAAPDSESSSSRPSSPAISPDAIIGSLVQFPHYDTEPHIGTHFDDPSTQLSAILKAPNSDQLIKDLATLVSHRGVVF # FSSQDLTTQEQLELGRRIGELSGKPKTSTLHRHPISEETPELGADVSVISSMG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 Scaffold_14 AUGUSTUS gene 637653 638954 0.39 + . g108 Scaffold_14 AUGUSTUS transcript 637653 638954 0.39 + . g108.t1 Scaffold_14 AUGUSTUS start_codon 637653 637655 . + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_14 AUGUSTUS CDS 637653 637776 0.69 + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_14 AUGUSTUS CDS 637857 638240 0.42 + 2 transcript_id "g108.t1"; gene_id "g108"; Scaffold_14 AUGUSTUS CDS 638319 638564 0.89 + 2 transcript_id "g108.t1"; gene_id "g108"; Scaffold_14 AUGUSTUS CDS 638662 638954 0.99 + 2 transcript_id "g108.t1"; gene_id "g108"; Scaffold_14 AUGUSTUS stop_codon 638952 638954 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MQSALIDYPQLDVRAGSVFDLVFNHEDVAKSRWGKISGVRLVVICTGTFLSGEIHIGEGNLTSTTQQGSIFIGLQRFP # AGRINEAPSLGLSASLNAAGFKLRRLQTGTPARLDGKTINFANLDRQDGDASPSAFSFLNSTVDNAVNQIPCFKTNTTAATHQIVKDNLHNCPRYCPS # LESKILRFGHRESHNIWLEPEGYNSDVVYPNGISCSLPEDVQEPMMRTIPGLENVKMVRPAYGVEYDHVDARELGHLLFALIYSHLQGLFLAGQINGE # PFFSFVPTMILTCIRFLGTTGYEEAAAQGIVAGINAGLSALQRPPFILTRGDGYTGVMIDDLIIKGTEEPCMFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 Scaffold_14 AUGUSTUS gene 646477 646857 0.99 - . g109 Scaffold_14 AUGUSTUS transcript 646477 646857 0.99 - . g109.t1 Scaffold_14 AUGUSTUS stop_codon 646477 646479 . - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_14 AUGUSTUS CDS 646477 646857 0.99 - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_14 AUGUSTUS start_codon 646855 646857 . - 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MIEFLKPTDRVGIIGVGGLGHLAIQFAANMGCDVIALSSTELKREDAINLGAREFYATDGVADYSTLNVTKPLDSLIV # ATGSENLDLANYYKLLKPVATVIPLTISFEPMLVPTIPTIANGIKIVG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 Scaffold_14 AUGUSTUS gene 651254 652285 0.47 - . g110 Scaffold_14 AUGUSTUS transcript 651254 652285 0.47 - . g110.t1 Scaffold_14 AUGUSTUS stop_codon 651254 651256 . - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_14 AUGUSTUS CDS 651254 652162 0.52 - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_14 AUGUSTUS CDS 652232 652285 0.47 - 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_14 AUGUSTUS start_codon 652283 652285 . - 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MHVPTPHIPASDEELPSIMHGLTKKKVYGTKPKRLPFVSSEVYRESSRKAASLSPVSPSDTHHGGRVTSPSLIDRTTR # VHQNGSVLPHPGIARSSADVGSSGSTSVFHSAPSYRLPTMTMSVPSSPVSTRPPFYLDTPEVSPRTTYHQPQSSSIMTASQPHAVHNSASYFTEDKTI # KAYSRGDGGALSTQVEGLSLKNQNQNSSINATASYSVPRSVYRDELLSHLGGPSVGSTSSDHLFTQDPSSESTPYAENARKIESYPPLSQPTPWHAPY # DSQYDLPSNQISTISQYGMTSGHSTASSYPSSPVSSKSNSLTGWAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 Scaffold_14 AUGUSTUS gene 661413 662286 0.32 + . g111 Scaffold_14 AUGUSTUS transcript 661413 662286 0.32 + . g111.t1 Scaffold_14 AUGUSTUS start_codon 661413 661415 . + 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_14 AUGUSTUS CDS 661413 661524 0.32 + 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_14 AUGUSTUS CDS 661613 662286 0.98 + 2 transcript_id "g111.t1"; gene_id "g111"; Scaffold_14 AUGUSTUS stop_codon 662284 662286 . + 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MYEKATKSINSQVNTETAKLNVVQEDADALHTLETFAGQHRQESTTSSNDWYINPPHSDQQSEHSFSSYPSNSPSFSV # PGPSHNRTFQPRSERALPVGRHSLLNNNVSTRSGVPFEYNLATSQNGAPAWNHGPSSTGSATQHECWNDRESRLNPLAVHRKGGYDARPSWMSTQAHE # SDPSVQPGTNQGWRHVGGQNASGHNASANQIPFPEMDVQWVELMQNEGVYGVSEMDVQWVELMQNEGVYGVNASEYDSAPAWPGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 Scaffold_14 AUGUSTUS gene 667441 667650 0.69 + . g112 Scaffold_14 AUGUSTUS transcript 667441 667650 0.69 + . g112.t1 Scaffold_14 AUGUSTUS start_codon 667441 667443 . + 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_14 AUGUSTUS CDS 667441 667650 0.69 + 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_14 AUGUSTUS stop_codon 667648 667650 . + 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWVRTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 Scaffold_14 AUGUSTUS gene 672427 673737 0.97 + . g113 Scaffold_14 AUGUSTUS transcript 672427 673737 0.97 + . g113.t1 Scaffold_14 AUGUSTUS start_codon 672427 672429 . + 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_14 AUGUSTUS CDS 672427 673737 0.97 + 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_14 AUGUSTUS stop_codon 673735 673737 . + 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISDFREPDTSRSLMSAGVTITYGLRRGMNGKARSQQPEACSSLRSCSLVSQIPLPRSKHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 Scaffold_14 AUGUSTUS gene 681096 681407 0.84 - . g114 Scaffold_14 AUGUSTUS transcript 681096 681407 0.84 - . g114.t1 Scaffold_14 AUGUSTUS stop_codon 681096 681098 . - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_14 AUGUSTUS CDS 681096 681407 0.84 - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_14 AUGUSTUS start_codon 681405 681407 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MTTYFFLDFKTGFGKLILQVFNTSKCHNTSAFRSTSAERLLRLIGRVHMRINCCFASAFSLKLLGPEETEDESGEDNC # PVEPVDSGVKTDGVVGVEDSEFIAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 Scaffold_14 AUGUSTUS gene 682587 682841 0.92 + . g115 Scaffold_14 AUGUSTUS transcript 682587 682841 0.92 + . g115.t1 Scaffold_14 AUGUSTUS start_codon 682587 682589 . + 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_14 AUGUSTUS CDS 682587 682841 0.92 + 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_14 AUGUSTUS stop_codon 682839 682841 . + 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MLPELLDRVNLTDEPQQMEGISEEAENQETRIEVDDDAENDVEEEENSVLEDDALPEWAQRLAFIDSDLGSCPGVELP # FLASNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 Scaffold_14 AUGUSTUS gene 686099 686605 0.91 - . g116 Scaffold_14 AUGUSTUS transcript 686099 686605 0.91 - . g116.t1 Scaffold_14 AUGUSTUS stop_codon 686099 686101 . - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_14 AUGUSTUS CDS 686099 686605 0.91 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_14 AUGUSTUS start_codon 686603 686605 . - 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MNYPNFRTKFSAKYKVKIIGWPIDVPLVSPRDITDPSKLDTLYDAWRSGSAYWSTMDKREYKRFMQQLDNDKAAGLQI # EIPRKGRSDIGGTHQKATTKRSRKNDTKEPPAKCKRMSLSTYKTAIIVQDQDQDQDTNDDENMEEDQDANYDEENVEEGSEDEGEDELDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 Scaffold_14 AUGUSTUS gene 687255 688256 0.96 - . g117 Scaffold_14 AUGUSTUS transcript 687255 688256 0.96 - . g117.t1 Scaffold_14 AUGUSTUS stop_codon 687255 687257 . - 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_14 AUGUSTUS CDS 687255 688256 0.96 - 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_14 AUGUSTUS start_codon 688254 688256 . - 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MQRFQPVNSQHYAAGSFSSGYNLPPHSDFSAVTSQQGYLGSSQHGALQWKETVICSNVDASKLHSPTPPHLSYSSPPT # QNSGRSYYGPGRDHHVVSIINNDINPTKTFSVPQSPQNLFPSREPSPMLAPSAGPCFGVRPLSHEPLLTPFSPSSPQLSSHSPTLNSLPSLARSADSQ # LSSHSVSSGPLPPGEESPSSTRRSSGEADLSPVHNKPNSIQSTPVSTGQAEQVQCPIVNLGVLEKSLAKATSALKTKLLNQAISQLQAEQEEKVVDLA # DTHGVAVSRLKKLAGTSKHHRKRRVNSVQDAILHAKSKELNQGMITLRRLLIFANTYYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 Scaffold_14 AUGUSTUS gene 689416 689817 0.32 + . g118 Scaffold_14 AUGUSTUS transcript 689416 689817 0.32 + . g118.t1 Scaffold_14 AUGUSTUS start_codon 689416 689418 . + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_14 AUGUSTUS CDS 689416 689817 0.32 + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_14 AUGUSTUS stop_codon 689815 689817 . + 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MILKTQMIPQSATEVSSDEDEPLPGSGGVTAVEARVQRAGKSIEKNIPGNHGRNNSEGLYFEWQGTKGATGVLELTDE # FPDVVYKLFNNRKLAAKAYKECKCTGVLDIFKSPVQAKEHLIVVKGENPGVYNRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 Scaffold_14 AUGUSTUS gene 695590 696614 0.5 + . g119 Scaffold_14 AUGUSTUS transcript 695590 696614 0.5 + . g119.t1 Scaffold_14 AUGUSTUS start_codon 695590 695592 . + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_14 AUGUSTUS CDS 695590 695902 0.5 + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_14 AUGUSTUS CDS 695953 696614 0.97 + 2 transcript_id "g119.t1"; gene_id "g119"; Scaffold_14 AUGUSTUS stop_codon 696612 696614 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MDFTDYSQDDYYNLILQAACEGAHSNISQPASDFNVAMKAQDSLEPSAGDHNLGNEIAVVSEVAVSKQGKIKIYSPDA # YLIRLPDCDAQVHAVPMNSLVTGKHQNTVLSVEGSLFGIHDALGGHSFVSPSSIDCPSGIPLSVPSSTYNSSGIFSPSTHPSPPGIYDGLSGRIFNGP # PPGVGNGPSPGIYNATAAQICNAPGVFNAAAPAPGAYNTPVPGIYDTAAPHVHDVTAPGIYDAAAPHVHDVTAPGIYNGPQSIFNNWSGVYGAGLYGL # PSVYGAGLYSPSGVYSAGFYGAGVHDPDIYNPPQNPAHNFPQAHGPGIHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 Scaffold_14 AUGUSTUS gene 703073 704273 0.77 - . g120 Scaffold_14 AUGUSTUS transcript 703073 704273 0.77 - . g120.t1 Scaffold_14 AUGUSTUS stop_codon 703073 703075 . - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_14 AUGUSTUS CDS 703073 703997 0.94 - 1 transcript_id "g120.t1"; gene_id "g120"; Scaffold_14 AUGUSTUS CDS 704254 704273 0.77 - 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_14 AUGUSTUS start_codon 704271 704273 . - 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MSNSDELGTYLISPASSLTTTTQYLKFQNFDLGRALQEDNNCRIEVEREGWTLENEDVEFEDVVGGGAEENTGGHLNL # TNFTITSPLSNPSSSQLPSFPKRDSLPSTSPRASSKRSQKTSASRRKRATAASARDAAAEVKAHAIRTAQDSAPISLKAFDISNLPAGSNGWTGSPTS # KLSPELKKIWRNLKVLSTSSLQVLDWHGIYRGYASSDRRGFDAGYKTAGISSITSLRRAGMPGLGAPGGVPGQVQALTLTGVGAPANNLNPNPGNANI # SSHLNPPSSSNAPITSSPATKPNDHLMPVKSSIISNLTWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 Scaffold_14 AUGUSTUS gene 704936 706533 0.22 + . g121 Scaffold_14 AUGUSTUS transcript 704936 706533 0.22 + . g121.t1 Scaffold_14 AUGUSTUS start_codon 704936 704938 . + 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_14 AUGUSTUS CDS 704936 705207 0.52 + 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_14 AUGUSTUS CDS 705261 705584 0.7 + 1 transcript_id "g121.t1"; gene_id "g121"; Scaffold_14 AUGUSTUS CDS 705775 706171 0.79 + 1 transcript_id "g121.t1"; gene_id "g121"; Scaffold_14 AUGUSTUS CDS 706255 706533 0.75 + 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_14 AUGUSTUS stop_codon 706531 706533 . + 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPCHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNMTIWMTIPAVYRVVNLVTPVDLVDLVDLVLPYLLTS # PTSNVLCWNSSRDSRVPLRPLVPGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAAST # NWDSAALKWAYGRGLAERIKDEMARLPEPATLADYVKKFFVLTIVIGNARKLESVRLPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPA # FNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKAKGPRIEGPCCRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 Scaffold_14 AUGUSTUS gene 710965 713342 0.49 + . g122 Scaffold_14 AUGUSTUS transcript 710965 713342 0.49 + . g122.t1 Scaffold_14 AUGUSTUS start_codon 710965 710967 . + 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_14 AUGUSTUS CDS 710965 712178 0.49 + 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_14 AUGUSTUS CDS 712280 713342 0.81 + 1 transcript_id "g122.t1"; gene_id "g122"; Scaffold_14 AUGUSTUS stop_codon 713340 713342 . + 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MDKTTGFDLMNPSRPYPPLPLLSPKERRNEILVTHEEIFEQKKSLILELRAYFHDHPRLLLSDPVLPIDVAAAVRSRI # EHLLVLDSLQKRGDDIKTHFADVFGDIPHIDELPTDITCEISLKEANMTMQSRGYASPRKYHEAWSVLIEKHLQAGRIRPSSSQYSSPAFPVPKADPT # ALPRWVNNFRKLNANTVPDRHPLPWIDDILADCAKGQIWGKMDMTDSFFQSRMAPESVPYVSVQTPLGQYEWLVMPQGLRNAPAVQQRRVTQALREYI # GRFCHVYLDNIIIWSKDEDEHAHHVELILEALRNAKLFCNPKKCQFFQLELDFLGHHISRRGIEAQSLKCQAIIHYPRPTSASEVRRFLGMVRFIAGY # LPNLAEHTRFLTPLTKKECEKSFPEWNREHENADWRHGAILMWGPTLDTARPVAFDSAQFSGAELNYPVHEKELLAIIRSLRKWRADCLGMRVHVLTD # HRTLENFEKQKDLSRRQLRWQEEISQFDLEIAYIPGDDNVGADALSRIRAGALPWDIVDSEPPSVVNVEAWKINPFMCASVLSLSADKQFLAQIKLGY # KTDPFVIKLIEGGSLVPNVTHKNGLWFVSGRLVIPNYLSLREDLFHLAHNTCGHFGSDKSYAMLADSYYWPHMRRDLCKFYVPGCEDCQRNKGRTAKN # RKGPLHPLPIPEGRCDSVGMDFIGPLPNDQGFDCILTMMDRLGSDLKIIPTNVDISAPALAKLVFDHWYCDNGLPLEGLDRDKLFVSNFGRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 Scaffold_14 AUGUSTUS gene 732808 733767 0.82 + . g123 Scaffold_14 AUGUSTUS transcript 732808 733767 0.82 + . g123.t1 Scaffold_14 AUGUSTUS start_codon 732808 732810 . + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_14 AUGUSTUS CDS 732808 733767 0.82 + 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_14 AUGUSTUS stop_codon 733765 733767 . + 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MFMTHQITAIHCHTATQNQTNTTENENPPKPEPVQCSARGHIPSQGYTDSAEYRNRERAAHSQGEDWMVDTPATGVLL # ALIMQTPYSFAATTGNLWVPQSFKQAMRRADLWREPMEREFQTLTLKDCWELVPLPPDANLTGGRWTYKFDVQGNLLKRKARYVAQGYTQVQGQDYDK # TYGGVAQMESVRIVLAIIATLKLSIFQVDFTAAFLNSPITHDVYMKQPDRFVKPGTEHLVCKLKKSIYGTMQGSHDWQETLATGYQADGYTTSCADPC # IWYKRVGGEYTITSTYGTTYAAALPPRQAGIRQYMTWGNAGRLTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 Scaffold_14 AUGUSTUS gene 751054 751725 0.97 - . g124 Scaffold_14 AUGUSTUS transcript 751054 751725 0.97 - . g124.t1 Scaffold_14 AUGUSTUS stop_codon 751054 751056 . - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_14 AUGUSTUS CDS 751054 751725 0.97 - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_14 AUGUSTUS start_codon 751723 751725 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MQKGRDADVFGILVGTLGVGKLSQPPHLDADIESLYEASYLPLIKHIRTLLNASHKKSYTISVGKLNPSKLANFMEIE # CSFLSRVLKIVLLTRRFVFLFHFFYNHMLTVSCQDFYRPIITPYELEVALQAEQSWTGKYILDFEKLLAEYGQGDKTEIAERNDEDKDEDAPVFSLVT # GKYRHAKQFGPISSETNPMGSPNSSAALIQRNQDNALSLLNDSAAGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 Scaffold_14 AUGUSTUS gene 757246 757986 0.72 + . g125 Scaffold_14 AUGUSTUS transcript 757246 757986 0.72 + . g125.t1 Scaffold_14 AUGUSTUS start_codon 757246 757248 . + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_14 AUGUSTUS CDS 757246 757986 0.72 + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_14 AUGUSTUS stop_codon 757984 757986 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MSTKDRHYWSQLRAALTAGHWSSSSPAKAFNGAPLSWSELFRKFNKHCKGYVDVAEVASQTHALSLLLIANSKDEDQD # EPVRPEEYPLELGDECILASERVEEARLGYDILKKIESSNFDVSLCSLNPSIFLNNTFHKTLNFALAYYAYALGNPSECLDHLKKVPDVAHVQNHIPL # PATLRANTLRVPTGGSSITTSPAESIAGTESTISIADIKDGRAWAITETIRSLCLQGDLYPYSSQNCISC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 Scaffold_14 AUGUSTUS gene 758445 759938 0.36 + . g126 Scaffold_14 AUGUSTUS transcript 758445 759938 0.36 + . g126.t1 Scaffold_14 AUGUSTUS start_codon 758445 758447 . + 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_14 AUGUSTUS CDS 758445 758615 0.96 + 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_14 AUGUSTUS CDS 758706 758736 0.85 + 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_14 AUGUSTUS CDS 759047 759070 0.49 + 2 transcript_id "g126.t1"; gene_id "g126"; Scaffold_14 AUGUSTUS CDS 759166 759938 0.9 + 2 transcript_id "g126.t1"; gene_id "g126"; Scaffold_14 AUGUSTUS stop_codon 759936 759938 . + 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MNTARSVIQEYRAILNVSTKFPKAGERNHKVEDFAEQCVAVWEASGGVGEYGGWVLDHSKAFDAVIILWIWQREYDTR # PSNFAKAHALFLRSIDTFPTASAHYHIALSYARYIPPTPRLSSEDNYEDNYNQGSEVFHEQNLEKAILHVATAAESKPSEIRYWHLIGLLSAKMEQWE # AAQSALETGAALGEVSDVAQNAEDLTDTQSTTRLSVPSQEQQKLMTTRHVQLGLPPSDPSHSIFETLLPPNEEDVPPVYALGPNTTGLSQTQSLPPSS # ELLQAVADHPEPSRHEKFEYALQLRMTQVAVIEYVEGARGRSRQASRSIPVDRGKARY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 Scaffold_14 AUGUSTUS gene 774669 775466 0.49 + . g127 Scaffold_14 AUGUSTUS transcript 774669 775466 0.49 + . g127.t1 Scaffold_14 AUGUSTUS start_codon 774669 774671 . + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_14 AUGUSTUS CDS 774669 774804 0.74 + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_14 AUGUSTUS CDS 774854 775193 0.67 + 2 transcript_id "g127.t1"; gene_id "g127"; Scaffold_14 AUGUSTUS CDS 775271 775466 0.99 + 1 transcript_id "g127.t1"; gene_id "g127"; Scaffold_14 AUGUSTUS stop_codon 775464 775466 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MQSSYGGYDPTGGGGGYGGGYGSSSMGGYGVPGNGFDPNTDPNASTAVQSLVGPKAALISASTQTAVATVGALVATGA # LPVVITGTKKAVNKTVQTVNSTYHHTKEKMHNVTTHILHPFRDNQEEKKTDKDDHTKGKKDEGRIVHSSVHIHGAKVCLSNSSVDVDEQDSDSGKTRP # HYERGDVFSSDSKIDSASSSQRHHWEITDSDWELGVSHDDSRVNYSE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 Scaffold_14 AUGUSTUS gene 779414 779953 0.64 - . g128 Scaffold_14 AUGUSTUS transcript 779414 779953 0.64 - . g128.t1 Scaffold_14 AUGUSTUS stop_codon 779414 779416 . - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_14 AUGUSTUS CDS 779414 779953 0.64 - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_14 AUGUSTUS start_codon 779951 779953 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MCSPLPTLSTKQFSSMFFLWSFVLPTLIHAATVTFPPTVGVGASDVLYTSSASSFDSLKISNVNSTTYEWYYFDAISD # DGSYSVVATFFVAPDTAFPFTGSPTMTLEVLLSIQTPDSDVFYLNGAFATDAQLQLMVTGLPAFGRALDLASTEARICLLMKSSSTQLMLWGLQARFL # CNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 Scaffold_14 AUGUSTUS gene 782064 783028 0.67 + . g129 Scaffold_14 AUGUSTUS transcript 782064 783028 0.67 + . g129.t1 Scaffold_14 AUGUSTUS start_codon 782064 782066 . + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_14 AUGUSTUS CDS 782064 782222 0.75 + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_14 AUGUSTUS CDS 782341 782384 0.69 + 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_14 AUGUSTUS CDS 782456 782658 0.69 + 1 transcript_id "g129.t1"; gene_id "g129"; Scaffold_14 AUGUSTUS CDS 782727 783028 0.69 + 2 transcript_id "g129.t1"; gene_id "g129"; Scaffold_14 AUGUSTUS stop_codon 783026 783028 . + 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MTQGARSRLVVQSPEDVQHDIASNYVPHDDDDDDDVESQRPLLSRKRQVVGILGLNLVSYLSPSIIPFLGIRIAAIPP # DEGDTSPRPSRSSSPSASLARKSHHSVLQPVLTILFALTTPLGIAMGMLVFSSQRGKTSEARMLLTQGLMSAISAGMLIYAATVEMMAGDFVFGNLGG # HGTGTAGHGHSHGSEFINGDDEDDSSDAEEEGISPRRRVLAVGSLLAGVLAMGLIGLGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 Scaffold_14 AUGUSTUS gene 783422 784752 0.37 - . g130 Scaffold_14 AUGUSTUS transcript 783422 784752 0.37 - . g130.t1 Scaffold_14 AUGUSTUS stop_codon 783422 783424 . - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_14 AUGUSTUS CDS 783422 784572 0.58 - 2 transcript_id "g130.t1"; gene_id "g130"; Scaffold_14 AUGUSTUS CDS 784641 784752 0.41 - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_14 AUGUSTUS start_codon 784750 784752 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MLENIFTVLHIPGRLPLRNAYGITAHTSTPVDDVQCSLALSPSILSSHTAPAPSSSSEHTLTQSSTADIATVIDSDAP # NVSSSYIDNVALVSVTIAAIKSDTDVGPSCSTASSGLEVKSGVRPPNSVDISSAFSMTSIPTCITGSAASSPSTVRPSITPKPSHTANSQAVSDQHNT # PASSPSPHLSHANPPSATRGRVRQLNEIARLPAFYGSNDFVRMNWKKGYGAYEGQTALPTWNPVTKQWQHPRTASVVSASAAPVCAIPVKSSASALAA # SVMTTNPAPTLSATAIASSTLEGLPSVESSTLQQEKVQVKTTHTAIKNAEAGISHVPTITEIVSPSPRRSVRIAHSATFPRVSVPSLESAVVMPLLRK # RPRETEDEDVTSEDNASSGSGESASKKVKRNAGSVNTKNPTRKRLVRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 Scaffold_14 AUGUSTUS gene 803796 804422 0.89 + . g131 Scaffold_14 AUGUSTUS transcript 803796 804422 0.89 + . g131.t1 Scaffold_14 AUGUSTUS start_codon 803796 803798 . + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_14 AUGUSTUS CDS 803796 804422 0.89 + 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_14 AUGUSTUS stop_codon 804420 804422 . + 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MRDERRTKNLYRLSRARSETLASDSSIDDDGVSDSVFRSTSPPLPPANSFVASSTYIPPSTSELLNRGGKPKEVENPW # TRSSTSYKNEFYPLLPPPGYVIPSPSLYRATVAKLERLEQCSSLLNSLKRELEDEENEDSSRTEDDLNAELEYVDVVALVPLTKKNVVSWSWRSSLWD # YLELSVSISAGKRRKRQLEFDGDEEDDWAKGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # start gene g132 Scaffold_14 AUGUSTUS gene 804697 805389 0.57 - . g132 Scaffold_14 AUGUSTUS transcript 804697 805389 0.57 - . g132.t1 Scaffold_14 AUGUSTUS stop_codon 804697 804699 . - 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_14 AUGUSTUS CDS 804697 805389 0.57 - 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_14 AUGUSTUS start_codon 805387 805389 . - 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MQEHFLWEHVSDDDVGTFLDELDSVIRADLPGTSFDWQAAAMDIVTFWADRIAQIQNLLEAVNSTSNLTHVVATVQQL # SYSPLDPFIAYGEALNASGHEIVFNVRSSPTIVLRTITPNTTALERCTYSATEFLTEPELQILMTNSEHILKTSMETILERICNDFGILFAESTDLTD # SVSYPTYISAWNSRINSLMKWLEWSSWLRCEEFVIWMCVFNPPHRHRITLTRDF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 Scaffold_14 AUGUSTUS gene 808193 808789 0.88 + . g133 Scaffold_14 AUGUSTUS transcript 808193 808789 0.88 + . g133.t1 Scaffold_14 AUGUSTUS start_codon 808193 808195 . + 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_14 AUGUSTUS CDS 808193 808789 0.88 + 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_14 AUGUSTUS stop_codon 808787 808789 . + 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MSNIQELLPLATSAVQNIISSIPNPALLEEIRIRFEIDLSEFEAMADMANTSSTALPLDSDDADSVPFMDQFARFHWA # EFSKFLLGIPFVETLPAIGVTSDPKSTSKHDYSLSYIGSESIPLATRNHSSHSPRSKRLHIELGAYPFENKLFEDIFVKNYDEYVKYMYENGLNLVEK # GGNELVFSQVQYSNSYEVDRLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 Scaffold_14 AUGUSTUS gene 810170 811659 0.25 + . g134 Scaffold_14 AUGUSTUS transcript 810170 811659 0.25 + . g134.t1 Scaffold_14 AUGUSTUS start_codon 810170 810172 . + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_14 AUGUSTUS CDS 810170 810398 0.54 + 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_14 AUGUSTUS CDS 810446 810769 0.42 + 2 transcript_id "g134.t1"; gene_id "g134"; Scaffold_14 AUGUSTUS CDS 810926 811659 1 + 2 transcript_id "g134.t1"; gene_id "g134"; Scaffold_14 AUGUSTUS stop_codon 811657 811659 . + 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MEEITHAQLSYDAQHQPQYIVHHIQYGTPSNFTQTVNKALLQEGANLVKQVRTEEIWHNVEIKAGYHTPALIICVYPS # RIVTLSQPPPQATIYQAAPAVTKTLRDWLEPPTDEEIYALDDLEEFESTDLSGLLCITYDNGSQFQGKKRCLPLDSEHSEDFDQDKPSRKILRLDSDS # LLRVIPQVCPLPSTNDDFSRRAWVIPARGYLPSAWSESGASSAVVLDPEEPGSSLEMTTTGSTIKWSHFALKEFWKYLNTLRDLKKLGSLGISFQPAQ # SASLRLRREKENLSSLGSPDAHQLQGLHVAESLSQSLQSSTPSGASSSLRDCDYFKVYHDAKISMHLRRALDLFTFRLGANEEQSVHLEQFEKAEFFE # QSRESGVTSSPSSVHSKETENPEGEGRPKRKKPKYCLLRGARLVLVDERSRGVLIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 Scaffold_14 AUGUSTUS gene 813709 814653 0.42 - . g135 Scaffold_14 AUGUSTUS transcript 813709 814653 0.42 - . g135.t1 Scaffold_14 AUGUSTUS stop_codon 813709 813711 . - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_14 AUGUSTUS CDS 813709 814178 0.65 - 2 transcript_id "g135.t1"; gene_id "g135"; Scaffold_14 AUGUSTUS CDS 814341 814653 0.42 - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_14 AUGUSTUS start_codon 814651 814653 . - 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MDPIQNQVHEDGQQWHDASNSAPPPDIPKVHSAPPSESAQTVISGAFFAGAHRFSINGGSFNHSNGDINQDIVNDHSN # RSNFGNRYGDNRSNSNNRTNNYNAGYNDQTPAPGSGLGRGGRSSVPPNFQPSQRSIPTIPGSAFFGENPLHRPSSAPTHGAPTHVDARIIEGDEHGPY # DNREEEPEYYYDPQQGPDTQYYQDYHPERNNYSGPGEEMYHEGQQQNQPRERSYYYSELQPVQPASTQPRFKSNNPFAKMMSPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 Scaffold_14 AUGUSTUS gene 818799 819503 0.67 - . g136 Scaffold_14 AUGUSTUS transcript 818799 819503 0.67 - . g136.t1 Scaffold_14 AUGUSTUS stop_codon 818799 818801 . - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_14 AUGUSTUS CDS 818799 819503 0.67 - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_14 AUGUSTUS start_codon 819501 819503 . - 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MPLSYGVNHNILSVAHNDHPQFTANSSSSSDSNRSTFSPTAQTIPADTSSVSDGGVGHAHQRGTKPRVVPHSQRTIRE # STVELSGLMVSSGVTSTSFPSTYRSSNGSQTRSDWTPSTFLLDNLGVFDSTIRTEPRSLVVGGNLRSAELSGFDGNHTLSEYKTSLEPSLNDEKGRSS # GSRHQGFDGPQSSMLEPALDVSDDHSSQFKSGLSLLLHSIAFLTGQIISLASSSEAIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 Scaffold_14 AUGUSTUS gene 824059 824708 0.32 - . g137 Scaffold_14 AUGUSTUS transcript 824059 824708 0.32 - . g137.t1 Scaffold_14 AUGUSTUS stop_codon 824059 824061 . - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_14 AUGUSTUS CDS 824059 824095 0.52 - 1 transcript_id "g137.t1"; gene_id "g137"; Scaffold_14 AUGUSTUS CDS 824146 824708 0.5 - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_14 AUGUSTUS start_codon 824706 824708 . - 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MDVYGTKIRTLIMEESRCPNDAVIRRSSTRISPGKRMTREAPSKDSPKKQKLSTEDDTKVTTPHKQPNTLFQAFGPPT # GMFPPSISPRKSPLKPSFQKLLTRDHAQDKAITQDSDVEMSLPQTPSKTTHRATSSGGIPHIPATSPFPMRRSDRLNSTTVSPSKSGTLDPEKSLDSA # DKLSTVRKRFRPLNRRIEQVALV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 Scaffold_14 AUGUSTUS gene 826729 828671 0.5 - . g138 Scaffold_14 AUGUSTUS transcript 826729 828671 0.5 - . g138.t1 Scaffold_14 AUGUSTUS stop_codon 826729 826731 . - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_14 AUGUSTUS CDS 826729 827214 0.68 - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_14 AUGUSTUS CDS 828274 828407 0.86 - 2 transcript_id "g138.t1"; gene_id "g138"; Scaffold_14 AUGUSTUS CDS 828464 828671 0.71 - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_14 AUGUSTUS start_codon 828669 828671 . - 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MIIPPTFFNSWAQSDDAVAFFRTMRNLVGFLNIPSLSLLTDIKSFGGGPIAPSVAESLIARGVPVSAGYGGTEFGVVS # ELRVDNAETWQYFEFRDRTNIRWVAQGDGTFEAQFLLTDAIVNIIANPNDQTKSEKTHEALMEEMISKYSQGLDVPLPQSATSINPTQQYVLLTGSTG # NLGAQLLESLLSKDSVVRVYALNRPSTRASMYERHRARFEDKALDISLLSSPKLVFLAGETSHDDLDLPENILKEVSIYDEWWIFDSCINITPHSSVK # T] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 Scaffold_14 AUGUSTUS gene 834438 836072 0.9 - . g139 Scaffold_14 AUGUSTUS transcript 834438 836072 0.9 - . g139.t1 Scaffold_14 AUGUSTUS stop_codon 834438 834440 . - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_14 AUGUSTUS CDS 834438 836072 0.9 - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_14 AUGUSTUS start_codon 836070 836072 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MSIRTEHITNSPPQISFLELVLIFREETIMLLFDTPFVHRILDKHPVSQIVSVVSIVIIVMYLYAGDGPLRHRARDIQ # GAGVLVVLPLGFKFILLYLLFCYVCTIFYAISPSPPSNVRHGASSVRVLQTAEAPPYRIKKSILPQQVKIRLPVEGWSIDVEFSSSRPHVRFPKYHFD # FEKQLDQTLGLINRSGQVFVEFAINPVNISWNTDTFLRFPDDNRQWDARLKVIHKEHRAMSIYEFALTHASIRLPIHIIPEQFRKGGADGNAWSIDVP # KFADFQNFVKGALAPERSTEDTPLGFSDSGGRRQFNSYIPCVDLTQAYIPIIVPHLKAISIGSDSQYGGTGAGPFHGQFRKINWTNLTHISFYAVTIF # AEDYKAILDCCPELRTFILHRPGEGYGTFGLVCPAKVVRPTQLKTLQLVDCRVDIHGFLSAAAVDLQSITELVLLCTTTQSIRANELNVDWTGIRTMK # LSNTLGEAFIRSCRTMLSINGNLDIITIKSRYSKFDLSWLMTGEHVPMSPGIEPIRNFFKAGFKPSGLNAERIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 Scaffold_14 AUGUSTUS gene 844330 846422 0.16 - . g140 Scaffold_14 AUGUSTUS transcript 844330 846422 0.16 - . g140.t1 Scaffold_14 AUGUSTUS stop_codon 844330 844332 . - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_14 AUGUSTUS CDS 844330 845808 0.31 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_14 AUGUSTUS CDS 845850 846422 0.21 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_14 AUGUSTUS start_codon 846420 846422 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MVAENLDPMHLMSSLRTKVSKHNGHLLISTSRMEEPKGLSGLLLRKVNHSAFKPVFLIPGGNSLLHAVHVYNRTPMRR # HKWKTPYEILYNKVPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHRSTRLPDR # NPDPKDPIPPPGDDDDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGSSS # AEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEELE # ALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIYM # EQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYMKTLGFKRLSSDAGIFIRRGKDGSLVIAIIYVDDALFAGPDKKLVDSLKGKFMSHWECR # DLGEAKEFLRMRINRHGKKIYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPEPTKGQSNSALRSKFKWLLVPFSTLCWVHVPTSPLLLPSLHNMQL # THLKSTLTRHSIFAATS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 Scaffold_14 AUGUSTUS gene 846486 848207 0.24 - . g141 Scaffold_14 AUGUSTUS transcript 846486 848207 0.24 - . g141.t1 Scaffold_14 AUGUSTUS stop_codon 846486 846488 . - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_14 AUGUSTUS CDS 846486 847759 0.68 - 2 transcript_id "g141.t1"; gene_id "g141"; Scaffold_14 AUGUSTUS CDS 847858 848041 0.38 - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_14 AUGUSTUS CDS 848148 848207 0.68 - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_14 AUGUSTUS start_codon 848205 848207 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MSQLETAELKKLTFAKVRIAQHGNGSNQQQKGQNGNDDNKKKRKRGSGKNKKAKKNANAAQADADSMDFSPIGSTVDF # GPVQDKDGIKRARDIGVRATAEVIRTLEPAGHISELDSDDELDPPTKRTRAMSPVDDVENGSKAPTPPPPSPPMDFEVPGTASFDPDELMNFDLDREI # LAITGFMDTMGSVPSSDLDHMGYTNAPSSVAVAKTCKSAFEPDLLSRLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTT # FDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIAPVFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRT # HSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAEGVPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEW # PTISYHKYKYTIFFIDDYTSHGFYCHLKKRAELFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 Scaffold_14 AUGUSTUS gene 848254 848748 0.57 - . g142 Scaffold_14 AUGUSTUS transcript 848254 848748 0.57 - . g142.t1 Scaffold_14 AUGUSTUS stop_codon 848254 848256 . - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_14 AUGUSTUS CDS 848254 848748 0.57 - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_14 AUGUSTUS start_codon 848746 848748 . - 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [MSSALFTAVTTTLKGDNYDTWASEMEAFLQATGLESAITTDQPSEPSPLVAANAASVEAWKNYEVVFKAWKEIDTKAI # GNIRLRISPSIRILAKEYSDTAKKLWNYLAKTYNVKSLGAVFNDFAAAMAIKIPYKQNPLSSMMEIGMYFTRMDEAGIGLADHLKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 Scaffold_14 AUGUSTUS gene 854834 855481 0.98 + . g143 Scaffold_14 AUGUSTUS transcript 854834 855481 0.98 + . g143.t1 Scaffold_14 AUGUSTUS start_codon 854834 854836 . + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_14 AUGUSTUS CDS 854834 855481 0.98 + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_14 AUGUSTUS stop_codon 855479 855481 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MPILFFVYGGGYATGSRTLPAPADLAYANVGAYFSRKGFITIIPDYRLSPEVTYPAPTEDVRDAIVWITENSHSLVHE # NVVDIDLDSLFIMGHSAGALNVATMVLLSLLPENVESKVKGIILISCPYTCDMKRVGPTFDPEVATQFFGSLDKAKENTPLSLLQDIPKDKASIFDRV # LLAESERDPEPFLRTGELFQDALSTLMDKKGTQDHRYWP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 Scaffold_14 AUGUSTUS gene 856456 856863 0.65 - . g144 Scaffold_14 AUGUSTUS transcript 856456 856863 0.65 - . g144.t1 Scaffold_14 AUGUSTUS stop_codon 856456 856458 . - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_14 AUGUSTUS CDS 856456 856863 0.65 - 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_14 AUGUSTUS start_codon 856861 856863 . - 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MFDVQAIADSTPHLIVQIVSMSLTYLFGAFASNLTTDAVVPVSGTNMGSIQLPNGDTRLYYQDQHNGSIIEMVISNAF # TIGVFEESAVLVPSSQVRSNSPVAVSLVADGDTFIQVCSTTFHHFPRIGDFQTLNSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 Scaffold_14 AUGUSTUS gene 865325 865908 0.92 - . g145 Scaffold_14 AUGUSTUS transcript 865325 865908 0.92 - . g145.t1 Scaffold_14 AUGUSTUS stop_codon 865325 865327 . - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_14 AUGUSTUS CDS 865325 865719 0.96 - 2 transcript_id "g145.t1"; gene_id "g145"; Scaffold_14 AUGUSTUS CDS 865776 865908 0.92 - 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_14 AUGUSTUS start_codon 865906 865908 . - 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MSAAASNLPAPARHDSQGIPMHSPGLRLTTATNPHKDIHPVPDKSHIGPDIEAYKAAHSDTVGPHSDSWWAQQARDNL # TWIKDFSIVRTGGFPSAEELKEDNPSKPQRPEHLSLLLIRCLQIPRLPCLLPGSRMVLLTPVTIASTDTLSEILIRQPSFTKLTNPENINISPMACS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 Scaffold_14 AUGUSTUS gene 869905 870853 0.65 - . g146 Scaffold_14 AUGUSTUS transcript 869905 870853 0.65 - . g146.t1 Scaffold_14 AUGUSTUS stop_codon 869905 869907 . - 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_14 AUGUSTUS CDS 869905 870354 0.73 - 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_14 AUGUSTUS CDS 870413 870853 0.89 - 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_14 AUGUSTUS start_codon 870851 870853 . - 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MIFSQYILQKLARQILKDYLQIDDPSNWQHFTVPAEELGNFLADPQSYTFELTPGMKLDTSAPTAPHMQNSHWNRVVI # SLLAAKASERASERAEYYGCDTREIEWTRLLKDRVYRILLEVVKAKAGNRDPIYETQKQASRKRRCRQYVFERRVQISTTMMTVARGFGDDEEYHCWS # EILYSLDRLGVDGMSDNEEILDSQGQQGIAVYEPDYRNPGFSAVYDRVDEVPQTAKHLFSQVGRKRLPRIRSNEKVKCPPPAGLPRSYYRSGYLERME # NSLLTPTVDVVSEELDRPIPRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 Scaffold_14 AUGUSTUS gene 871396 872037 0.42 - . g147 Scaffold_14 AUGUSTUS transcript 871396 872037 0.42 - . g147.t1 Scaffold_14 AUGUSTUS stop_codon 871396 871398 . - 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_14 AUGUSTUS CDS 871396 872037 0.42 - 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_14 AUGUSTUS start_codon 872035 872037 . - 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MKASPWNRAVAYKFAEKAKEIVANCRDGRFGKAPIDWNKLFNDRLYTVYKDIIDARPLPGETKDDLVLRLALKQDKRK # ERSANRSILHVVRRLFFCFGCFDNPDNLLIQKRTSRSDIATIMIKVSRERNDNASIEFWSYGLNVMEILGDQGQSDEEDITLDVEVEGVSVKQSAKRV # LRLFWRHPYIEDLIRIMEKAPALEKLLFHRAGAKRIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 Scaffold_14 AUGUSTUS gene 875172 875546 0.93 - . g148 Scaffold_14 AUGUSTUS transcript 875172 875546 0.93 - . g148.t1 Scaffold_14 AUGUSTUS stop_codon 875172 875174 . - 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_14 AUGUSTUS CDS 875172 875546 0.93 - 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_14 AUGUSTUS start_codon 875544 875546 . - 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MLQSECATLEEKVRGAEESEKNTRTKLSTEIERLKEENADLNATKSELFSELEDMQTDIEERMQMFASSQEKMNKEME # KFEQAKNQLDELEADNQQLLNDLDLFKEHHEEYKVGYIPVSILYIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 Scaffold_14 AUGUSTUS gene 881052 881642 0.56 + . g149 Scaffold_14 AUGUSTUS transcript 881052 881642 0.56 + . g149.t1 Scaffold_14 AUGUSTUS start_codon 881052 881054 . + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_14 AUGUSTUS CDS 881052 881642 0.56 + 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_14 AUGUSTUS stop_codon 881640 881642 . + 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MHFPAIAPMAGPTRTQKDSRKPLPYNTPPSGRNTSSFSSLSSSSIQSLASFSSELEYDSDREHLTRSRRRTPVYAGAH # NDPERHQSFYEDNQVVSEPRIRAELSTNTSLRKADSGAGQNTESEKRRGPPAMVFVDDSDDDLLIPKPPGEVGRPNRGGYSLYPVLGWPKKKYDKVKV # SIVTSSSNLVSDSCHLHRTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 Scaffold_14 AUGUSTUS gene 885754 886706 0.59 - . g150 Scaffold_14 AUGUSTUS transcript 885754 886706 0.59 - . g150.t1 Scaffold_14 AUGUSTUS stop_codon 885754 885756 . - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_14 AUGUSTUS CDS 885754 886236 1 - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_14 AUGUSTUS CDS 886299 886706 0.59 - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_14 AUGUSTUS start_codon 886704 886706 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MLDSLNRAALAALLVPLVTLRSCLLPMTSYRDLLAGLKDEPSLQSTHHLNYSKGVSPQNSASDSSRPTLTWPTNNNKK # TGASVSKYQSLLGHTNEASDYSIRVMAAGLSSDKSTGPHLPSTDSSFEQFQMEVTKQVVKSLSVNRTSTGESSTEDDSLESLLVPDQQGHLQFLDSRL # NSRKRTRALITVSSLIKAASNLEIRLHDLSPSQTPVEIQSILGTVEDGAETLRQQIASDGSAIVSEEAQRLGAMLDSVEQTVQIWRQEYPDTSPVKIN # NSEAFHVALDHALTYPDRKVFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 Scaffold_14 AUGUSTUS gene 888698 890928 0.74 + . g151 Scaffold_14 AUGUSTUS transcript 888698 890928 0.74 + . g151.t1 Scaffold_14 AUGUSTUS start_codon 888698 888700 . + 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_14 AUGUSTUS CDS 888698 889299 0.8 + 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_14 AUGUSTUS CDS 889407 890928 0.74 + 1 transcript_id "g151.t1"; gene_id "g151"; Scaffold_14 AUGUSTUS stop_codon 890926 890928 . + 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MFTNQNRSGQHEPDCIQIYHEDHTYEHINVSTEAPHSVCDTVPKRQSRSSIASYPSAGSIYTDDEEAEFSDTTGTGTG # IARSNQSLDLNELDETHSRRKAALLGLVKGLDNFSLQSSSGCAGDINRHMGAPGLGAEISSGRSILSEGESDYCGEKGLAVSGSLGEEANGLNDRDQE # VSESDYGLEGKEDPGAMKQQFQRIRVPNEPEFDRALSSKRHSLHPASAISNSPSPVPPGRYNHIPPSPRLPTTSKSKDKSSANIGGSLHYSRIPHAPI # PSEKDQKLISKRKSYTRDLSLSPLPLSPTTSTATPYCRSSPTPSTVKRESHNSYESVVLAKRSMEAVVRTRQAFGIPPSESDAIYHPSVVNDQVPDKE # NNDIDMSLQSMLPPADSMASGVDVAMERSSWEHEVDNELSVGAENLFRTLSQGGGEARGRSHQAPEDRKNQRYEPQQQRHLISSTGEEHFERSEKSRS # RERRQPRHRSRTPVARSSLTQRTMDSENFKKPSIPSSWRSMVGPDMYMSLLEAHGEVEVQRQEVIWELRTQETVFVERLSSVVSLFIIPLRVHATKSW # IAGVPLEIAKVLDWLEDIVNLHTEIRDTLQLSQTPECPLAGVSEAEDRGGTRVAYALRSFVPRLEIYQPYLVKLSNVSEMLRRLVKDSESDFGEFVRI # QEKTLERRVSFANMLLEPAERIATYPDLFRVSVSLDYLSFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 Scaffold_14 AUGUSTUS gene 893983 894954 0.99 + . g152 Scaffold_14 AUGUSTUS transcript 893983 894954 0.99 + . g152.t1 Scaffold_14 AUGUSTUS start_codon 893983 893985 . + 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_14 AUGUSTUS CDS 893983 894954 0.99 + 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_14 AUGUSTUS stop_codon 894952 894954 . + 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MRPISAPAPSAEVVKAMLDAPANKPFVPARPSTPLRIITNPLEDKYEVDRESGYSPRDSPSPFFSSFRPHQFGGGRSM # DSHRLVLNEPLPSLCPRSPSESSFAENEVPWESEEVGPAITEPGRTLSEEFQDNELAAEIVEEQHIPTQSENSLSSYPSFDSFNDDSLENTVEGDISL # TESVESRVIERSQRPGKVISLTKAVKLKLYGSRQITSSSTLPLGRSSMSPPPPSAFQRFERALGAAAGSSASLSSRVSLKNSNGVGPSSGGKSMKALL # GKAMGIGKGMKRSREDEENMDPDSIQDGVDRPIAGRRTKRKLMGISVGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 Scaffold_14 AUGUSTUS gene 896710 897688 0.19 + . g153 Scaffold_14 AUGUSTUS transcript 896710 897688 0.19 + . g153.t1 Scaffold_14 AUGUSTUS start_codon 896710 896712 . + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_14 AUGUSTUS CDS 896710 897087 0.55 + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_14 AUGUSTUS CDS 897155 897688 0.34 + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_14 AUGUSTUS stop_codon 897686 897688 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MDDQKTSKFAAFAGPLTHLYYSNCQFDGLADDMALKRPQAIEDIGDMRPALLQFMVAATPKAHVVNDILGNYDEHLNK # MSVSGVNHFTPEGEQTYLFVDNVPDTVNPVKANIAYIQIPSEDGSVELFEVEMQDNWYEAAVSAIAPHRIISVVDWASDAPVPVPDAPKEPASYNVFA # WGVNDPSEGNRTLQKENFDNLASPIGWHSLPFANDPSYRGVKPSNEFYRNTSTTFGNNVFAQENWEGQNAYINNYRPDAGSSSVYDFQYKPKVSDSDE # AMAVAHNYINATVTQLFYTSNMIHDLYYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 Scaffold_14 AUGUSTUS gene 905867 906376 0.94 + . g154 Scaffold_14 AUGUSTUS transcript 905867 906376 0.94 + . g154.t1 Scaffold_14 AUGUSTUS start_codon 905867 905869 . + 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_14 AUGUSTUS CDS 905867 906376 0.94 + 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_14 AUGUSTUS stop_codon 906374 906376 . + 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MSFPETYRLVDSRGEPVTHERNESFSGQELYDNNPYRPPQYEGYKPPELDARFAPQGYAPTHIDLRNTRPQIGRTPSP # TPSESHALAEIGNHSGLINWKRISSKDFWFSKEGLSKFWFCFVANILFLHSISEYGLTAAVIITLVVLFAVYHTDIVVFLTPATQWCHEYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 Scaffold_14 AUGUSTUS gene 908112 908432 0.77 + . g155 Scaffold_14 AUGUSTUS transcript 908112 908432 0.77 + . g155.t1 Scaffold_14 AUGUSTUS start_codon 908112 908114 . + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_14 AUGUSTUS CDS 908112 908432 0.77 + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_14 AUGUSTUS stop_codon 908430 908432 . + 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MSTENRRRDYAPPQYRANIDSDGVKPPIFEPHGIKPPDLVYGDRWNTVNVTLPQDPRTRIIRTPSPTPSEARALEEIG # STSGLINWKRIRSKEFWMSKEGLSKSPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 Scaffold_14 AUGUSTUS gene 918374 919006 0.39 + . g156 Scaffold_14 AUGUSTUS transcript 918374 919006 0.39 + . g156.t1 Scaffold_14 AUGUSTUS start_codon 918374 918376 . + 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_14 AUGUSTUS CDS 918374 919006 0.39 + 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_14 AUGUSTUS stop_codon 919004 919006 . + 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MIKIVVHPLPSRTSGVGLNTSSSVSHTYSVPSVYSSRNDARMSLVCEAGERMLQFIKSRGAPPPSDDPPRPVKKPRLE # KLMAAPMHSIARAQPKTEAKRKQGEKRFQMQASAVPKSIKKPKDWDSDTKQPNIDLAYELEPGEIVADDEVTVAGPSTSSIPLRSMYSASSMYSWSQP # SQSSLSCFSIFETIYADFWLASNLKRKRETDGME] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 Scaffold_14 AUGUSTUS gene 920921 921706 0.99 - . g157 Scaffold_14 AUGUSTUS transcript 920921 921706 0.99 - . g157.t1 Scaffold_14 AUGUSTUS stop_codon 920921 920923 . - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_14 AUGUSTUS CDS 920921 921706 0.99 - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_14 AUGUSTUS start_codon 921704 921706 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MPRGSEDVSCVGLNSSPGNTVLLNEEQDAQAGAVAKAKRRQIATLAGILIPLSILIFGGAFIAYRYYIKQQRSKKELA # PEPLVLPEPKVVEEAGAGVLVGSSAVLENQMLSISPAADPSLNPFLTEAERTRVALSDTSDLASSTSRRGFVNFPTSSIRHSNKKAIEAGRTSSNLVS # ADLTESTPTPHNRFAFERSLSAQPRGAPPPSVPTRSASFPSPMITPPAGDPEYLFQHQDGGRFVRELPPPYERRSRQIPDVPQSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 Scaffold_14 AUGUSTUS gene 924616 925023 0.59 + . g158 Scaffold_14 AUGUSTUS transcript 924616 925023 0.59 + . g158.t1 Scaffold_14 AUGUSTUS start_codon 924616 924618 . + 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_14 AUGUSTUS CDS 924616 925023 0.59 + 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_14 AUGUSTUS stop_codon 925021 925023 . + 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MLRATRLPKKELDVTLKTVEHGITLLRDIDEKRNQHQLLGEIKGAVESSFVKLDIEKQLQHQLTQVRNEFNERLDFIA # ANINGTEEKIDSIAKNSQPAAPEASYADVARTNGKRTMAPTQAMTWQRMCAHVEVKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 Scaffold_14 AUGUSTUS gene 928347 928739 0.7 + . g159 Scaffold_14 AUGUSTUS transcript 928347 928739 0.7 + . g159.t1 Scaffold_14 AUGUSTUS start_codon 928347 928349 . + 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_14 AUGUSTUS CDS 928347 928739 0.7 + 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_14 AUGUSTUS stop_codon 928737 928739 . + 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MQKLLNVAVQDITRTIQLSIEKAIPLSQLYPASKRWWTSELSEMKKALNQLSARSYKFRAIPDDDSHRELRELRTQYK # ALIFKEKEDHWKDFLDNVDTDSIFTAAKYATTPNIDQDAATVIPELKALDEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 Scaffold_14 AUGUSTUS gene 942982 945837 0.46 - . g160 Scaffold_14 AUGUSTUS transcript 942982 945837 0.46 - . g160.t1 Scaffold_14 AUGUSTUS stop_codon 942982 942984 . - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_14 AUGUSTUS CDS 942982 945608 0.99 - 2 transcript_id "g160.t1"; gene_id "g160"; Scaffold_14 AUGUSTUS CDS 945663 945837 0.46 - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_14 AUGUSTUS start_codon 945835 945837 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MSPMDDVENGSKASTLPPPSPPMDFEVPGTASFDPDELMNFDLDREFWQSLDSWTPWVMAKTCKSAFEPDLLSRLYNY # RIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGVGTVLINFKDVRGRMHSARIAP # VFYMKELSHRLIAQGRFLQDGKTVRGNADKVDFWDKDGLFLSFEPRTHSDTIYILKDYSPQPMAVNLVIHSVDYTTMHRRMGHPSREALTQLRKHAEG # VPTFSIPHEEDLCEGCAKGKMTLRPFPPTNRRASRPFEIIHSDLKEWPTISYHKYKYTIFFIDDYTSHGFYCHLKKKSGALPVIKQFIATVKNLYETN # VKEWMSDGGGEFRSNALDEFFKNEGIKAQWSSPHIHQQNGRAERFIRTIIEKSEPQRFQACIPDSWWEFSVAHAVHVYNRTPMRRHKWKTPYEILYNK # VPRIDHLRVFGCGAYVYLHEEIRTNKQSPRSELMTYLGVSDGGHGNIYMRSNNAMFTATHAVFDEKLFPRCKSSERHRSTRLPDRNPDPKDPIPPPGD # DDVPIFHQPTTPQMRQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAQEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQVERPKRDIQRRAPQPGSS # SAEQERPEPEQVPGPSTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEEL # EALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLTGLDVRNAYLYGVLHETIY # MEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWRTLDSYMKTLGFKRLSSDAGIFPTRKRWLSSHRHHLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 Scaffold_14 AUGUSTUS gene 948733 950166 0.84 - . g161 Scaffold_14 AUGUSTUS transcript 948733 950166 0.84 - . g161.t1 Scaffold_14 AUGUSTUS stop_codon 948733 948735 . - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_14 AUGUSTUS CDS 948733 950166 0.84 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_14 AUGUSTUS start_codon 950164 950166 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 Scaffold_14 AUGUSTUS gene 950217 951383 0.84 - . g162 Scaffold_14 AUGUSTUS transcript 950217 951383 0.84 - . g162.t1 Scaffold_14 AUGUSTUS stop_codon 950217 950219 . - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_14 AUGUSTUS CDS 950217 951383 0.84 - 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_14 AUGUSTUS start_codon 951381 951383 . - 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 Scaffold_14 AUGUSTUS gene 951991 952785 0.62 - . g163 Scaffold_14 AUGUSTUS transcript 951991 952785 0.62 - . g163.t1 Scaffold_14 AUGUSTUS stop_codon 951991 951993 . - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_14 AUGUSTUS CDS 951991 952785 0.62 - 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_14 AUGUSTUS start_codon 952783 952785 . - 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MTDIGMFFSRMDDADIGIPAHLEALILLSKLPSRYSVIVQTMSQLGTEELKKLTLTKVRIAVMNAFSRDTIGNSQPQN # ANKFLNVHCKGNDPKFSQQQHGNGSNQQQKGQNGNNDSNKKKRKRGNGKNKKAKKNANAAQTDVDSMIFSPIGSTVDFGPVRTDLTPSVQDVRKHSIH # PPYNPPPNATSLRLHKKTRMAINRARNIGVRAVIKYAAPIIFLFSPSRRLYLYDTSSHHCQTPIDTDQITDPPDPSSPSIGFRHIPCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 Scaffold_14 AUGUSTUS gene 960929 961558 0.62 - . g164 Scaffold_14 AUGUSTUS transcript 960929 961558 0.62 - . g164.t1 Scaffold_14 AUGUSTUS stop_codon 960929 960931 . - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_14 AUGUSTUS CDS 960929 961558 0.62 - 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_14 AUGUSTUS start_codon 961556 961558 . - 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MSATLDAVNSNQYFSLHDSAAGEEPSPAPLFKVPGRTHPVEIFYTQEPEPDYVEAAIRTVLMIHRAEDPGDILLFLTG # EEEIEDACRKIKLEADDLLNTDPSSVGPLMCVPLYSSLPPQQQQRIFDAAPKPSQEGYPPGRKVVVSTNIAETSLTIDGLYTSSIQASQNKRSTTQEF # ELSHYSYHRYQKHPLSRGPVVQGVLGQGNALGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 Scaffold_14 AUGUSTUS gene 964723 965424 0.31 + . g165 Scaffold_14 AUGUSTUS transcript 964723 965424 0.31 + . g165.t1 Scaffold_14 AUGUSTUS start_codon 964723 964725 . + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_14 AUGUSTUS CDS 964723 965252 0.88 + 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_14 AUGUSTUS CDS 965394 965424 0.34 + 1 transcript_id "g165.t1"; gene_id "g165"; Scaffold_14 AUGUSTUS stop_codon 965422 965424 . + 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MARLPEPAMLADYRQEVLCIDNCYWKREETKKSEAGKPFIARNPKKGSSDFKAGSTNQQNNSQPSGSSVPFMPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQCPALNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKQKAQESKGRAAEVEETPKQCQSLLKRNRKTNLQL # FRTVKIMYTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 Scaffold_14 AUGUSTUS gene 967113 967883 0.87 + . g166 Scaffold_14 AUGUSTUS transcript 967113 967883 0.87 + . g166.t1 Scaffold_14 AUGUSTUS start_codon 967113 967115 . + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_14 AUGUSTUS CDS 967113 967883 0.87 + 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_14 AUGUSTUS stop_codon 967881 967883 . + 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MALTNGRLCLRPYNAPAAFQCFVNDISDMLDVCVIVYLDDILIYSDMPEEHREHVKEVLWQLRKHRLYANPDKCKFNM # DTVEYLGYILSLDGLTMSKEKVHSEWPVPRKVKDIQSFLGFANFYCHFIYNYSDIVVPMTQSPGRALPGSGTMTVKRPLKTSKLLLLLPILTHWEPNC # PIIVETDASDYAIAAILSIQTVDGEIHPLAFLSRTLHTAELNYDTHDKELLTIFEAFKAWRHYLKGSGDPVECHHRSQKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 Scaffold_14 AUGUSTUS gene 968852 969626 0.47 + . g167 Scaffold_14 AUGUSTUS transcript 968852 969626 0.47 + . g167.t1 Scaffold_14 AUGUSTUS start_codon 968852 968854 . + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_14 AUGUSTUS CDS 968852 969020 0.47 + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_14 AUGUSTUS CDS 969118 969626 0.87 + 2 transcript_id "g167.t1"; gene_id "g167"; Scaffold_14 AUGUSTUS stop_codon 969624 969626 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MSIRLSNSTSGSTALTSKMTGRIYFPIAEFAYNNAPNASTGITPFFANKGYHPKHHPQSRYKEQADRKRILHPEFPIG # SEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLLDYLCWIHPVFHVSQLEPVTPNPFLNRTQSPPPPIEVDGEEEYNIAEILDSKLDRR # YKCCPLCYYIWWASYEGTDDEFSWVAADELHADELVPAFHAQYPQRPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 Scaffold_14 AUGUSTUS gene 969942 970340 0.46 - . g168 Scaffold_14 AUGUSTUS transcript 969942 970340 0.46 - . g168.t1 Scaffold_14 AUGUSTUS stop_codon 969942 969944 . - 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_14 AUGUSTUS CDS 969942 970340 0.46 - 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_14 AUGUSTUS start_codon 970338 970340 . - 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MVKREGGGNPTGEQLAVLESQMAQLLADNQQFREGQVKADTYHCHFNWKLDWLMMDAARRRTSPPEMPKAGPSHLPKK # RRRVVDSKEEEEDQGRVEEEIGEEEKEEDGEEEEERDEPVPKRARSEKGKERAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 Scaffold_14 AUGUSTUS gene 970608 970988 0.36 - . g169 Scaffold_14 AUGUSTUS transcript 970608 970988 0.36 - . g169.t1 Scaffold_14 AUGUSTUS stop_codon 970608 970610 . - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_14 AUGUSTUS CDS 970608 970988 0.36 - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_14 AUGUSTUS start_codon 970986 970988 . - 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MGLSFQETSKSKMSASCTQTTTTTTSLTARPSRSHAAPPPSADPVEDEEDLEEDKDEIIRRAQEKVRRMKERKAAAEE # EAAKKAAEEARRQKEVAARELEEWRRPQPVVDGAPRQEEVWCPHSGRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 Scaffold_14 AUGUSTUS gene 977696 979990 0.91 - . g170 Scaffold_14 AUGUSTUS transcript 977696 979990 0.91 - . g170.t1 Scaffold_14 AUGUSTUS stop_codon 977696 977698 . - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_14 AUGUSTUS CDS 977696 979990 0.91 - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_14 AUGUSTUS start_codon 979988 979990 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL # EKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFD # TLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSN # LEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLK # TVKEHGLQRLANGIAEWEETMGWSTTEVEYTYQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVRRSSDTHGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 Scaffold_14 AUGUSTUS gene 980358 981404 0.96 - . g171 Scaffold_14 AUGUSTUS transcript 980358 981404 0.96 - . g171.t1 Scaffold_14 AUGUSTUS stop_codon 980358 980360 . - 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_14 AUGUSTUS CDS 980358 981404 0.96 - 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_14 AUGUSTUS start_codon 981402 981404 . - 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLK # EFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPT # MTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQP # RRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 Scaffold_14 AUGUSTUS gene 984000 985785 0.17 + . g172 Scaffold_14 AUGUSTUS transcript 984000 985785 0.17 + . g172.t1 Scaffold_14 AUGUSTUS start_codon 984000 984002 . + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_14 AUGUSTUS CDS 984000 984002 0.79 + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_14 AUGUSTUS CDS 984190 984582 0.25 + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_14 AUGUSTUS CDS 985033 985785 0.92 + 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_14 AUGUSTUS stop_codon 985783 985785 . + 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MSSAKSNFVKLSEVESYLRDFVAIASSLKKRGLITEKRYDYYFVLGLPHSMKDWFLSSAPEQKRTRDDPPSVAESLKI # LRTRFDKQSLIYEEWNTDKTDQVKSTFDELGNRVTVAVPSQVNVLNEAVGYKALKCLSGNGFSLDSFPYEYISNPSTRSGLDTSKRLDPRTQVNRPER # YKRSDQAPADFPKVAPPTNPAPVPVPQPPIQQPIQQVRFAPNPTTMPAPPNPRTTFPPPQNPINTNQGWKGSRPGIPRGGNRDVEMQEADKNKSSNNP # QYHFTSKVQDFADPQSMISRIGDMRVEVPLFQLLGLSPQLSKLMSENTRTKREYGVPKEGNTRKAESSSYIPPYDPYKAREQEHAALSTVRGTRGPDS # HERRVFVDEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 Scaffold_14 AUGUSTUS gene 985856 986374 0.46 + . g173 Scaffold_14 AUGUSTUS transcript 985856 986374 0.46 + . g173.t1 Scaffold_14 AUGUSTUS start_codon 985856 985858 . + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_14 AUGUSTUS CDS 985856 986374 0.46 + 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_14 AUGUSTUS stop_codon 986372 986374 . + 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MTVGDVRVSINGSEFLAMIDSGSEMNVAGKHLPEAASLPMDFDGMRWSLKGINGDFERLRGCAVDAPMEIGGHKFNHH # IFISRQSIGRHDIILGQPFLQEFSARLDYERGNHCKLFLWADGDRNARPTLMISITDPNDPRNASAIRLGTDAKPKSSYIEEVYNSDSDLDFHY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 Scaffold_14 AUGUSTUS gene 986810 987822 0.37 + . g174 Scaffold_14 AUGUSTUS transcript 986810 987822 0.37 + . g174.t1 Scaffold_14 AUGUSTUS start_codon 986810 986812 . + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_14 AUGUSTUS CDS 986810 986831 0.41 + 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_14 AUGUSTUS CDS 986877 987137 0.55 + 2 transcript_id "g174.t1"; gene_id "g174"; Scaffold_14 AUGUSTUS CDS 987266 987822 0.98 + 2 transcript_id "g174.t1"; gene_id "g174"; Scaffold_14 AUGUSTUS stop_codon 987820 987822 . + 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MLRKIPLVNRGKAFAWNWAEKGFFSRDYYPDYEIPTIEHIPWQSRPIPIPKAILGDVISVIKNNEEAGRFEPTTSSYR # SSLFAVAKKPGSDPPVRFDACHVGERSRPLQAFHSPDGPKQQTTLVQGFTNSMQEFQRRVKHGIRRISPEIADNFADDCGLKGGESRYNDEPIPENSN # IRRYIFEYAQRLDVFLGTLILVGITASGRKAILAAIKLRIVGSVVSLEGWIIEQSVIQKVLDWPIPEDLTDVRGFLGTAGGGRRWIKGFALIAKPLTM # LFAYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 Scaffold_14 AUGUSTUS gene 987964 988707 0.81 + . g175 Scaffold_14 AUGUSTUS transcript 987964 988707 0.81 + . g175.t1 Scaffold_14 AUGUSTUS start_codon 987964 987966 . + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_14 AUGUSTUS CDS 987964 988707 0.81 + 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_14 AUGUSTUS stop_codon 988705 988707 . + 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MLVVGVDSAWLGAGWAVYQIRDRQKRISLYGSCTFNEREQNYGQPKTEVYGIFRAFKELRHRIWGVLFRLEHDAQSVA # QMLKTVDDVPNAPVLRWISWIRLFDFEMKHVPATAFKLEDGLSRRKPSPNDQPYDEIDSEEFLDAYNDSVYALNAALSVSHAQSAKFLFDQLYIHYSN # RRVQSWNGFHQHVPLLSSSVQNEVLPDFQAPYLLFQFIHRMPILSLLLPLVGVWTPTTLSFVGVLLPIHAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 Scaffold_14 AUGUSTUS gene 994317 995278 0.68 + . g176 Scaffold_14 AUGUSTUS transcript 994317 995278 0.68 + . g176.t1 Scaffold_14 AUGUSTUS start_codon 994317 994319 . + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_14 AUGUSTUS CDS 994317 994653 0.75 + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_14 AUGUSTUS CDS 994704 995278 0.9 + 2 transcript_id "g176.t1"; gene_id "g176"; Scaffold_14 AUGUSTUS stop_codon 995276 995278 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MRAVEGKMVGYGERGVYMLYLQNGTVITSRDVTFEEGIPRRTLAPGGGEEEEDQGNYEHVPILPPDAIDTSDTTNTSE # TTLPTKPDQSLQIPNQIQTRRTRTKFQPDPNVPLPSDKSTYPTPALLASVVQGFNEVSSKYNTALTAIGITPVPRSYSQAMEDPDRWSPAIEKEIQHM # REFGVFRPLQDPPAGATILVPLWVLAHKFNGDGKIIEEKARLVVNGRTQEEGRDYHHTFAAVLRFVSNPSEYLLRSGLLLATIYGRSTSPWPISMLIS # MKKYTRGPSKDFPGEILGKSCEFRNLSTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 Scaffold_14 AUGUSTUS gene 995395 996399 0.91 + . g177 Scaffold_14 AUGUSTUS transcript 995395 996399 0.91 + . g177.t1 Scaffold_14 AUGUSTUS start_codon 995395 995397 . + 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_14 AUGUSTUS CDS 995395 996399 0.91 + 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_14 AUGUSTUS stop_codon 996397 996399 . + 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MTGTYTDDTLGGSSSIQEMEKAKMEIGLKYRIKETDSVQFALGMKLTHDRDLGIATLSMPAYWNNLLSHRSLRDVKPK # STPLPNGAILLIGTSPPSTDDIEFMREKPYREILGAVQFGAATCHPDIAHAANVLSRFAYEPRKVHWQYLMHLVRYISGTQDLGITYTRMAPGGLSPI # VYADADYASCVDSRRSTSGVLTMMAGGPTFWMSKRQDVVALSTTEAEYIALAKAVQQAKWVHSFLSELGHGVPRPFPIRCDNQGAIVISENPKFHSRV # KHIDIRYHFLRDAVESGDIAIEYIPSEENPADILTKSLGAAIHSRQVSLLGLRKLVPDRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 Scaffold_14 AUGUSTUS gene 997517 997906 0.93 + . g178 Scaffold_14 AUGUSTUS transcript 997517 997906 0.93 + . g178.t1 Scaffold_14 AUGUSTUS start_codon 997517 997519 . + 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_14 AUGUSTUS CDS 997517 997906 0.93 + 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_14 AUGUSTUS stop_codon 997904 997906 . + 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MSFGSIPNIPRLPDTKQLVGEENWRPYKREIQFAVQSKGLTGYLDSTIPRPNSYLGPIYPLMTQAATPLFSPMPCLKE # WEVHNRLIAGAIVLNITDPVGLGVDETKRASEIWLALIRCFKKRDEHNEFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 Scaffold_14 AUGUSTUS gene 1000130 1001079 0.46 + . g179 Scaffold_14 AUGUSTUS transcript 1000130 1001079 0.46 + . g179.t1 Scaffold_14 AUGUSTUS start_codon 1000130 1000132 . + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_14 AUGUSTUS CDS 1000130 1000308 0.47 + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_14 AUGUSTUS CDS 1000414 1000540 0.59 + 1 transcript_id "g179.t1"; gene_id "g179"; Scaffold_14 AUGUSTUS CDS 1000663 1001079 0.6 + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_14 AUGUSTUS stop_codon 1001077 1001079 . + 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MDGMRTLLEDADMPYAFWGEALSTLIYVNNFVPSVWFPDVIPVEAWTRKCHDISHLRPFRLWIPESKRVKESHNVTFE # EGNPHCTQPVRTTEGEDEEEVGEMPPEKDPVPELLEPVQRSERGHIPSQKYLESCEYKARERTAQGQGEAWTRDEPGEGQPLALIVQNPYSFASTIGE # LWVPQSYKQAIKRADLWQEPMRWEYSMLVQKECWELVPLPPDANFTGGSWTYAIKFDAQGNLLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 Scaffold_14 AUGUSTUS gene 1006980 1007411 0.54 - . g180 Scaffold_14 AUGUSTUS transcript 1006980 1007411 0.54 - . g180.t1 Scaffold_14 AUGUSTUS stop_codon 1006980 1006982 . - 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_14 AUGUSTUS CDS 1006980 1007411 0.54 - 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_14 AUGUSTUS start_codon 1007409 1007411 . - 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MLADRRGKELSLEQLDFSGPPLSAMISPGLPDAEFLESDRVPAPKAYAMENGAQQPLTQAAAGREGAETNASSSSATT # PSGEYDAYYGSSSYLSSDADMDGLMEYPKNGSNVKEVVSRPAVSSSSTVPSEQLLNFPVVLLHLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 Scaffold_14 AUGUSTUS gene 1008264 1008773 0.67 - . g181 Scaffold_14 AUGUSTUS transcript 1008264 1008773 0.67 - . g181.t1 Scaffold_14 AUGUSTUS stop_codon 1008264 1008266 . - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_14 AUGUSTUS CDS 1008264 1008773 0.67 - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_14 AUGUSTUS start_codon 1008771 1008773 . - 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MDSPVSSSSASPFSGTTTSPGSTLGSPPQGEAIEPTVNQDAATQTAMGKKVKKPGKATKKDKGKAKEKGKVKEKKEKE # KDSTKTKKTKASASGEKSKVRRKGEGKRRKRPAYSFGGGESNDIVGIVMLEIQKAEDLPKLKNSKSLNFSGLGRGLYIDALVLMYVFCVSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 Scaffold_14 AUGUSTUS gene 1009356 1010084 0.25 - . g182 Scaffold_14 AUGUSTUS transcript 1009356 1010084 0.25 - . g182.t1 Scaffold_14 AUGUSTUS stop_codon 1009356 1009358 . - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_14 AUGUSTUS CDS 1009356 1010084 0.25 - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_14 AUGUSTUS start_codon 1010082 1010084 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MFSFSFHSFFGFSISCFRRTILIPSISEQTEGVGTVRSHATVSARPEDNSNFIDLSNLDTTNEFPNGYQNGYQAGYPY # EDDGGLSSSEEDEVDDADGVRSGDDFIVRNAQYQSEPEEDRSESDSSSCYSNSDAEISEEDEEGSQSETSGSEDGEDPEEGDVRTPTLPTELSPMTTP # TASNTGAYALNASHTPEPPISFSALYTPPASAPCIFAIKFLRGDYITCWKGVLARCNIAHSSSIYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 Scaffold_14 AUGUSTUS gene 1015991 1017163 0.43 + . g183 Scaffold_14 AUGUSTUS transcript 1015991 1017163 0.43 + . g183.t1 Scaffold_14 AUGUSTUS start_codon 1015991 1015993 . + 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_14 AUGUSTUS CDS 1015991 1017163 0.43 + 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_14 AUGUSTUS stop_codon 1017161 1017163 . + 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MTNAENTRSSYSRSHLHHQHLSPEGSSDKTPILLSGDTAADFRSLLWALYALPAEVFAMPSTQAQITRLIGIARIAHK # YAFRTTESWALSVLTMCVCQAPDTPSDHDIHGDVEVDSEAGKSIVSSTELLIQLTEVAVLCAHDELHEAVEPIWADLLFAGQTQDIVSAMGLADRYKS # QLRPLLGLAYYLMMLKGKEEWTKAASGDVEIDSDKTKKPRLTRDQRIRLLSGYYNLSRACEALSNNPPKLTHHPSCFLPAQQAQQAIGLGGAGTAAAH # AHARCGESWDTLWAGLVMSTVSSNAMSNNVAIKIQSVDLLRKMHMVNHVLESLVNGVDGLAGTDAAAAASTFGVMGYGGGFAMAGNMNKNCLRMALKA # SEEKVNDVLYGLADCFVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 Scaffold_14 AUGUSTUS gene 1023180 1023755 0.91 + . g184 Scaffold_14 AUGUSTUS transcript 1023180 1023755 0.91 + . g184.t1 Scaffold_14 AUGUSTUS start_codon 1023180 1023182 . + 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_14 AUGUSTUS CDS 1023180 1023755 0.91 + 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_14 AUGUSTUS stop_codon 1023753 1023755 . + 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MSAPATAPPPDPNRPSLRLGSVAPDFSAETTLGPIKSFHEWLGNSWGILFSHPGDFTPVCTTELGEVARRAKAGDWEK # RNIKVIGISANGLEEHYKWVKDINEYGTKSVSETDVQYPIVSLLNGHLNLHCTNILYLLRSPTVTAAFPTSTTCLITRMPPTSILKLDFPSLSAVSMS # SIQPKRSGSNWTIPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 Scaffold_14 AUGUSTUS gene 1026735 1027103 0.98 + . g185 Scaffold_14 AUGUSTUS transcript 1026735 1027103 0.98 + . g185.t1 Scaffold_14 AUGUSTUS start_codon 1026735 1026737 . + 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_14 AUGUSTUS CDS 1026735 1027103 0.98 + 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_14 AUGUSTUS stop_codon 1027101 1027103 . + 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MDRVEELSAFPEIYEVGTTAVGFTFNNDSAVGVEPLIQIECNFDSGASSGTGVCTEVVQFSGQSTAQTTAWTGSIIPV # STFEVSVSATATGNATNAAGSVKGGHLSTLFAGTCVVVVLAGVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # start gene g186 Scaffold_14 AUGUSTUS gene 1027550 1028971 0.92 + . g186 Scaffold_14 AUGUSTUS transcript 1027550 1028971 0.92 + . g186.t1 Scaffold_14 AUGUSTUS start_codon 1027550 1027552 . + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_14 AUGUSTUS CDS 1027550 1028971 0.92 + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_14 AUGUSTUS stop_codon 1028969 1028971 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MAQFDPLPVHLYRKRQPTIAPKLDKVDDSESLLLQSIKSALRGTGVSSLSTVHSSRVLIGGNDGPEQELTWNDNHVVL # SAGGVVKKKWSFELEGQPVQWACIGWLEESGSFPRKHFSERQDSASRSPFERPTFGPFFYANQKSGPPPGKRDSNVSAVFVFLRSIGKVYFDSGFEHT # FALPFIVRKAWPVTPHGLLIQRVLEPAELYEAELAGEDVLPTIFCLSNPFAEPSAVGLTSGIIGNAGSATLMDEAENSTKPLKPVPPHEVILWTSYSG # PNSPHEIVITLDSSKRRLTVWRYVYIKPKDSPIPLGRTRTQNLAHKKRQSMSSNSRRTSSVFPDMFDKLHPTSPRPPSPKPPFPELADLLPLSKLPGM # APSLSTTTTMASLASGSSNLNHLNSQPQPEPVTKVRRNSLTRNDLSVTMNRMVLGSRGADVDVLTPEEHGRMKTCLWMDKLHEIELDQTESVFRRIKY # FGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 Scaffold_14 AUGUSTUS gene 1031100 1032077 0.84 + . g187 Scaffold_14 AUGUSTUS transcript 1031100 1032077 0.84 + . g187.t1 Scaffold_14 AUGUSTUS start_codon 1031100 1031102 . + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_14 AUGUSTUS CDS 1031100 1032077 0.84 + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_14 AUGUSTUS stop_codon 1032075 1032077 . + 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MPDSVHWGEFHNGVAAALRISSSATSVDSSWIAFNKPSELTPEHAGFLYGLGLTGHLKEMLTWHTFGYLTPKHDLTSI # GVLLGLSAANVGNGNQHVTKLLAVHTPALLPTPTVDLNVPLHTQAAGMSGVGLLYMGTKNRRMAEVCLNQMNRKDLVQPDLSNEYREAYTYSAALAFG # MVMLGKGTAIPADVALLERLNLLIHGDGKFGSPHASFDINLTSPAASIALGLMYLRTERQDVADMLSIPDTILGLNRVQPSFLLIRTLARSLIMWSDI # TPTNDGLQVRFQRRFGRVLRTSTSYHQDQRSPTLGSWHIIISLLDAALLSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 Scaffold_14 AUGUSTUS gene 1043630 1044268 0.72 - . g188 Scaffold_14 AUGUSTUS transcript 1043630 1044268 0.72 - . g188.t1 Scaffold_14 AUGUSTUS stop_codon 1043630 1043632 . - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_14 AUGUSTUS CDS 1043630 1044268 0.72 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_14 AUGUSTUS start_codon 1044266 1044268 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MKGAWVEKGDGGDGGSGARIDEGGDAENASLAASEQVQEDKIPSPRGAVLSEGTPTTLRGRVENEDNITPPLRTCFGN # VEELSTAMAEVFSSEMLIVPVCNGLVRAFGDFAIVVVENLVVRRVTSVGLSFLGKYESALRGLGVGGSGARGKDRFRLGVGAMTSVFEYRSFVGVNRV # ANELASMSERIEGSIDDEYDGCVFLEQEAAATFEVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 Scaffold_14 AUGUSTUS gene 1044894 1045307 0.35 + . g189 Scaffold_14 AUGUSTUS transcript 1044894 1045307 0.35 + . g189.t1 Scaffold_14 AUGUSTUS start_codon 1044894 1044896 . + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_14 AUGUSTUS CDS 1044894 1045307 0.35 + 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_14 AUGUSTUS stop_codon 1045305 1045307 . + 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MCIIPNSTLSLSLPSSSRSSITTSTSTSSSCTINSTSTTSASSITSAIISTSSITSTSASTSTSTSSAATSPFTSSDS # TTCTPFFSAPTTFSPPSTTSTMSFDPPLSLPLPPLPPLVPLILPSPLPAILPVPLVPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 Scaffold_14 AUGUSTUS gene 1050407 1052961 0.55 + . g190 Scaffold_14 AUGUSTUS transcript 1050407 1052961 0.55 + . g190.t1 Scaffold_14 AUGUSTUS start_codon 1050407 1050409 . + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_14 AUGUSTUS CDS 1050407 1050613 0.55 + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_14 AUGUSTUS CDS 1050715 1052961 0.64 + 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_14 AUGUSTUS stop_codon 1052959 1052961 . + 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MTLRLPGPNIKTLLPGFEVAFCRAEDMKITSLDELEDESTSGSVLQSKTKINPSRRTNAHGKRKRQPLKLRTSILNPG # LDFSTQVTNLKVPDAVFTVLDDIIELRSEVASFYHRQGSHPRLIESNHRHRHFIECLRKIRRYLELCPTSRPDNALVKLGEFMSLLGIDDNSAPVSSV # QPPLDEDWLPDNLRRKASTKKENPTTPMHDRPLSEFSIIADGDNGKDESEVLAWMFFHDLARLREHVRGIWGQYCQKEITLVTASFLTTQSIEIVKEM # EEDFFSSHSQLFSGYLDLVKVMFRMHPKLDIRSVVQELIMMDSSTVDFTMSRIFHSLWQFGMTLIAGNVPCPKPGFFPTFHPEDDRSSMDDEQLAAED # LAILMPHLSEVAMQCKLSSTEVGKRAKKSDRTTVDEQALVRDMRAFIIDSSRPKPFHLIFQWAVYKDTVLVTRKQLKRPLEELLQFSRHIMSSFNFWK # QDYDFRFYSDNDVDSLRPAIHEFIQLVQSHVLTDRLGSWKDQNHIANLTPYQLWYYNPWACGAALYSLLLQIHHTMVQVLNGTGYLGSVAHLYHALRV # HGQVEREWPHMDKILEIVKECAFNDHFPEKGKCLMSFSGFLGSDPALSQGHITPGYKSNGYGTGVLPKDFGGSLPGRLSELYHYRLTDNLVAELFPRQ # GELTVARRSRISIPPQPRLRFGGKRCDAFSLLDVLKQRIESDLINTALGLDLFAVQRMSISILRRWSNRTKEEFIGCFGPGYMERPTQIVFLPGYMLK # GIEYFGKYRDGNRGMSRELVDRIVKEAVRSLEEGREDLEKSLDGGAKMFFLSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 Scaffold_14 AUGUSTUS gene 1062982 1066178 0.59 - . g191 Scaffold_14 AUGUSTUS transcript 1062982 1066178 0.59 - . g191.t1 Scaffold_14 AUGUSTUS stop_codon 1062982 1062984 . - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_14 AUGUSTUS CDS 1062982 1064892 0.61 - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_14 AUGUSTUS CDS 1065006 1066178 0.94 - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_14 AUGUSTUS start_codon 1066176 1066178 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MVNYNPETVSTDYDEADRLYFENISLETILDIYDTEQARGVILSMGGQTPNNIALPLYRQNVKIYGTSPEMIDTAENR # FKFSRLLDEIGVDQPLWKELTSFEEAEAFCEKVGYPVLVRPSYVLSGAAMNVVSTGDDLANYLTQATAVSRDHPVVITKYIEQAKEIEMDAVAKDGKL # IMHYISEHVENAGVHSGDATLIHPPQDLDPQTVRQIEEATAKIGNALNVTGPYNIQFIAKNNEIKVIECNLRAARSFPFVSKVTGIDAIEMATKVMLG # IPVEPYPDAGMPSDYVGVKVPQFSFSRLSGADPVLGVEMASTGEVACFGKDKYEAYLKALISTGIVPPKKNILFSIGSYREKLELLPSVQRLSAAGYN # IFATSGTADFLTEHNVSCKHLANNLIDMYINLPSKNHYRRPASYTSKGYHTRRMAVDFAIPLITNVKNAKMLAEALVRKLPLDVSSVDSKSSHRTHTF # PGLVNVAAFVPGLAVPNSQDFIDATRASISAGFTTSIIIPQAQDNGIVDRATLEVAKANVLGSAYCNFALSLSASADNVHVFDEELKADAKALFIPFR # IANKPIPLSAVAAHFSSWPTEKPIITDAKGSDLASLLLLASLHSRSIHVTDVQTIDDVLLISLSKAKNLKVTCDVSVYSLFFTREQFPLAPFLSSLED # QKALWKKLDLIDAFSVGSSPYKMAVEINEVGSAASGMEEALPLLLTAVTEGRLSLQDITTRLHDNPVQIFGLPEQAQTHVEVVLGRQAPFVTRPSCWS # PLGQTLVSGAIHRVIVHGQTSFLDGSLSQTPLGKDISSATISHGLSAVVPPSPALKPSDHLVSTTSVTQSQAGGSLMYGPLTHSQKHFTSIQPHPSFY # RRHILSVKQFTHRDMYDLFSLAHEMRLQVERNGTLDILKGKVLCTAFYEPSTRTSSSFDAAMKRCGGQVVQITADSSSVVKGESLPDTIRTLGCYGDA # IVIRHPDVGSAQTAAKFSPVPIINAGDGVGEHPTQVSSVYSNRYQEVSWSFVRLYLMFTRSVRNLVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 Scaffold_14 AUGUSTUS gene 1066957 1069022 0.4 - . g192 Scaffold_14 AUGUSTUS transcript 1066957 1069022 0.4 - . g192.t1 Scaffold_14 AUGUSTUS stop_codon 1066957 1066959 . - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_14 AUGUSTUS CDS 1066957 1067160 0.99 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_14 AUGUSTUS CDS 1067279 1067401 0.56 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_14 AUGUSTUS CDS 1067460 1069022 0.7 - 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_14 AUGUSTUS start_codon 1069020 1069022 . - 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MLGKLLARNPGAHAGRRLAINPPPSAAPSRASSPNSRSSWREDYLDIPFSDPNRTNLVAAVSITEPRFYKALGTPLLH # PSGRPVRVLVLDVGMKYNQIRCFINRGVELKILPWNYDFLSESEPYDGLFVSNGPGDPTMVKETIARLSRAMERADRPIFGICLGHQLMALAAGATTS # KMKYGNRGHNIPCTDALSGRCYITSQNHGFQVDTDTLPSGWKELFRNANDNSNEGIYCVDKPFFSVQFHPESTPGPRDTEFLFDVFIKNIVDCATTNA # LVPISMPGGKKEENDKRIPRAKVSKVIILGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTIMVNPNIATIATSKGLADKVYFLPVTPEFVRKIIKYEK # PDGIYVTFGGQTALNVGIKLKDEFAELGVQVLGTPIDTIITTEDRQLFASAMEEIGEKCAKSFTATNQDEAITAANAIGFPVIVRAAYALGGLGSGFA # QNAEQLKALCRKAFATSPQVLVEKSMKGWKEIEYEVVRDCRDNCITVCNMENFDPLGIHTGDSIVIAPSQTLSDSDYNMLRTTAVNVIRHLGVNARLS # RSSALASKATGYPLAFIAAKLGLGIPLNEIRNSVTKVTIACFEPSLDYVVVKNTSLGSEKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 Scaffold_14 AUGUSTUS gene 1074398 1074778 0.6 - . g193 Scaffold_14 AUGUSTUS transcript 1074398 1074778 0.6 - . g193.t1 Scaffold_14 AUGUSTUS stop_codon 1074398 1074400 . - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_14 AUGUSTUS CDS 1074398 1074466 0.99 - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_14 AUGUSTUS CDS 1074524 1074778 0.61 - 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_14 AUGUSTUS start_codon 1074776 1074778 . - 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MKEVEEQMQNVQNKNSAYFVEWIPNNVLSAQCEVAPRGLKMAVTFLGNSTAIQELFKRVSDQFTAMFKRKAFLHWYTQ # EGMDEMEFTEAESNMQDLVAEYQQYQDAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 Scaffold_14 AUGUSTUS gene 1077863 1078297 0.73 + . g194 Scaffold_14 AUGUSTUS transcript 1077863 1078297 0.73 + . g194.t1 Scaffold_14 AUGUSTUS start_codon 1077863 1077865 . + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_14 AUGUSTUS CDS 1077863 1077903 0.8 + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_14 AUGUSTUS CDS 1078012 1078297 0.73 + 1 transcript_id "g194.t1"; gene_id "g194"; Scaffold_14 AUGUSTUS stop_codon 1078295 1078297 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MEENNNSIQHLVHCHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGE # PGDPSGPGGPGGPGGPGGPGGPGGPRSHIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 Scaffold_14 AUGUSTUS gene 1098060 1099220 0.67 - . g195 Scaffold_14 AUGUSTUS transcript 1098060 1099220 0.67 - . g195.t1 Scaffold_14 AUGUSTUS stop_codon 1098060 1098062 . - 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_14 AUGUSTUS CDS 1098060 1099220 0.67 - 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_14 AUGUSTUS start_codon 1099218 1099220 . - 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MPFGLTNASSAFQFFINEIFHNMVDVCVVIYLDDILIYLDDEESHVEHVRKVLEQLRATHLHAKLEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVMEWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLLVI # LECDASDLAIAGILSQLDPETGEIHPITFHARSMISVELNYDIYDKELLAIVDCFKQWRAYCEGSRHRIQVYSDHNNLQYFSTTKQLTAQQARWAELL # SGYAFVINYRPGRLGAKPDALTRRSDMYPKKGAPRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTMIEALKRIAHNEEESLVWEDGLL # KRGGRIYVPDTGTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 Scaffold_14 AUGUSTUS gene 1107921 1108688 0.78 - . g196 Scaffold_14 AUGUSTUS transcript 1107921 1108688 0.78 - . g196.t1 Scaffold_14 AUGUSTUS stop_codon 1107921 1107923 . - 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_14 AUGUSTUS CDS 1107921 1108688 0.78 - 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_14 AUGUSTUS start_codon 1108686 1108688 . - 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MPFGLTNAPSVFQFFMNEIFQDMVDVCMVIYLDDILIYSDNEESHVGHVRKVWNDYGPTISIAKPEKCAFHIDTVEYL # GVIISPMGVSMDPEKVKAVMDWPKQRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWTWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVI # LECDASDLAIAGILSQLDPETGEIHPILSKSQSQLLQTIWEPPPTTNWPMTCHALSLKAPLVTLLDIPEPLTSSFAPPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 Scaffold_14 AUGUSTUS gene 1108962 1109345 0.56 - . g197 Scaffold_14 AUGUSTUS transcript 1108962 1109345 0.56 - . g197.t1 Scaffold_14 AUGUSTUS stop_codon 1108962 1108964 . - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_14 AUGUSTUS CDS 1108962 1109345 0.56 - 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_14 AUGUSTUS start_codon 1109343 1109345 . - 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MKEESSTKEMLWASDISSPEEVQQPNDPESGSLSPEQGKVVTEFDEEESKRQEMEELKKSIPVQYQDYLDIFSPGEAR # TLPPHRPYDIQIETEGDAIPPIGKLYNMSEKELKSLKEYINEMLGKGFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 Scaffold_14 AUGUSTUS gene 1117903 1119413 0.71 + . g198 Scaffold_14 AUGUSTUS transcript 1117903 1119413 0.71 + . g198.t1 Scaffold_14 AUGUSTUS start_codon 1117903 1117905 . + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_14 AUGUSTUS CDS 1117903 1118417 0.71 + 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_14 AUGUSTUS CDS 1118510 1119413 0.96 + 1 transcript_id "g198.t1"; gene_id "g198"; Scaffold_14 AUGUSTUS stop_codon 1119411 1119413 . + 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MTEDELDGWFREERRLRREEAIKWQKELEIRRESRRVAWEEEEAQREMEWKDWLRRRRAEPGLHRWFFWRNHLKEPQP # PKRLSVESPGGSSAPPLREVPARHTSGDKCNINPVTTDPRNHHGTCRPTGRAPEEASVTFDEVEGNSVEEKVDTLPEGPRVDSVGGFEVPPRGDTDPL # GPDFFPDALDQSNDVNLFTLNDGKQGAFCPERVKEILRKVKIGPELSDDQRTWVERLLSEYADCFALSVGEVRPVKDAVHRLNIPEGATFPKKVRQRS # LTPPQHEYLHAKVDELLEAGVIERCNPEDVKCVSPLTLVQKAHEGMGLTVEELMHKLNDECVAVGLPTAFDLPTGPQPSGPAERAELTKPAKWRICQN # FMAVNKLTEIAPMLQGNIRSKQQSLSGHNYICLFDFASGFYACEVKQDSRPYTAFYVEGKGYFWCAKLPFGLTGAPSTFANMTAHHLDDLIADGTVMP # CP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 Scaffold_14 AUGUSTUS gene 1122626 1123714 0.91 + . g199 Scaffold_14 AUGUSTUS transcript 1122626 1123714 0.91 + . g199.t1 Scaffold_14 AUGUSTUS start_codon 1122626 1122628 . + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_14 AUGUSTUS CDS 1122626 1123714 0.91 + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_14 AUGUSTUS stop_codon 1123712 1123714 . + 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MIQQQARVIETLQEQLREVRKGFAAGGILTGRPPSKAGNTAGLFGQAPMEMIDNTRGVHLLQFLSQEVGKLWSQFPLP # DELLWELGKETLRRDIQPRYLSPRVWTGGVFRNGELACKRAELGEYVRLEGGRYALEDGGIAASGGDRGGFKPPNRAPPPHLSNHSRDRERPPSQGEQ # DHWGQVGRSGGGAPPPPPSGGPGDNDSEGSNDGEHTGSSREGGRNEDDRGELPTGAPEVPPTRYDPDQPWYYDPRQGWHHKAAPRPPNEDGICGRATR # KKIGLPSSQSSTSVRSKASQVMTGLHGRRGSSVWRGCLEYVLPSMLVKWTSALRQPAISLVQHSPTRHVESATTEGGVHCLEDWTEFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 Scaffold_14 AUGUSTUS gene 1128211 1128723 0.49 + . g200 Scaffold_14 AUGUSTUS transcript 1128211 1128723 0.49 + . g200.t1 Scaffold_14 AUGUSTUS start_codon 1128211 1128213 . + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_14 AUGUSTUS CDS 1128211 1128723 0.49 + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_14 AUGUSTUS stop_codon 1128721 1128723 . + 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MSASRTITTTTSATAGPSRSRPVPPPPPPASDSAAQEEEGLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEAQERAKRARQQEEEVVERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEVCASTFNFASTNLRIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 Scaffold_14 AUGUSTUS gene 1130190 1130852 0.76 - . g201 Scaffold_14 AUGUSTUS transcript 1130190 1130852 0.76 - . g201.t1 Scaffold_14 AUGUSTUS stop_codon 1130190 1130192 . - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_14 AUGUSTUS CDS 1130190 1130852 0.76 - 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_14 AUGUSTUS start_codon 1130850 1130852 . - 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHPDSPQTSVPSAQPRCAKVAVP # LPEPSPSVSPTILETPPGDSLRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAAR # AADRSSTTPTVPPLHPSIPEEYASLQTSSTRLLQIHFLNTDLTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 Scaffold_14 AUGUSTUS gene 1131185 1131832 0.56 - . g202 Scaffold_14 AUGUSTUS transcript 1131185 1131832 0.56 - . g202.t1 Scaffold_14 AUGUSTUS stop_codon 1131185 1131187 . - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_14 AUGUSTUS CDS 1131185 1131832 0.56 - 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_14 AUGUSTUS start_codon 1131830 1131832 . - 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREA # GKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGG # KHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 Scaffold_14 AUGUSTUS gene 1140182 1140548 0.26 - . g203 Scaffold_14 AUGUSTUS transcript 1140182 1140548 0.26 - . g203.t1 Scaffold_14 AUGUSTUS stop_codon 1140182 1140184 . - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_14 AUGUSTUS CDS 1140182 1140375 0.92 - 2 transcript_id "g203.t1"; gene_id "g203"; Scaffold_14 AUGUSTUS CDS 1140434 1140548 0.26 - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_14 AUGUSTUS start_codon 1140546 1140548 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MFTLPEAMEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPPIACRTGKQPQCRAASESPCDPPPHFDLDTGDHGDQDPPV # DPDDPGADNNHDDLDDDSGGFVMP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 Scaffold_14 AUGUSTUS gene 1154101 1154355 0.9 + . g204 Scaffold_14 AUGUSTUS transcript 1154101 1154355 0.9 + . g204.t1 Scaffold_14 AUGUSTUS start_codon 1154101 1154103 . + 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_14 AUGUSTUS CDS 1154101 1154355 0.9 + 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_14 AUGUSTUS stop_codon 1154353 1154355 . + 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MILTDNDKAAGPQIKIPRKGQSDIGGMHRKAMTKHSQENDAEEPPAKCKWTSLSTSKMAIIVPEEDQDKNDDDEENVE # EDELDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 Scaffold_14 AUGUSTUS gene 1156640 1157174 0.46 + . g205 Scaffold_14 AUGUSTUS transcript 1156640 1157174 0.46 + . g205.t1 Scaffold_14 AUGUSTUS start_codon 1156640 1156642 . + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_14 AUGUSTUS CDS 1156640 1157071 0.46 + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_14 AUGUSTUS CDS 1157154 1157174 0.89 + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_14 AUGUSTUS stop_codon 1157172 1157174 . + 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MSPILMEVFQGLKAIYRDDRPDFTKSWVAKGSEMAEENTDGTCRMQSMGVVDVDVVHNLLISRIVTELSRIIVESTLQ # SGCTTVISIKFCFTEAKAIYLIKKRPHVGTQVASAFNSSFNPTQSAATLTDASTDDATRFAGGLFLWEQRLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 Scaffold_14 AUGUSTUS gene 1160181 1162122 0.4 - . g206 Scaffold_14 AUGUSTUS transcript 1160181 1162122 0.4 - . g206.t1 Scaffold_14 AUGUSTUS stop_codon 1160181 1160183 . - 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_14 AUGUSTUS CDS 1160181 1161516 0.51 - 1 transcript_id "g206.t1"; gene_id "g206"; Scaffold_14 AUGUSTUS CDS 1161662 1162122 0.64 - 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_14 AUGUSTUS start_codon 1162120 1162122 . - 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MHGQDSQAAELPSMNIPETTPLPAPVFSVSGRLLAYASSPEGNTSLSVNGVQPRTSSTLSDAAVSTASAFGSTLSAQL # ASIGGAGGASGALGALGGISQADVGNAALKVGGSVLSGMKTLGGLAYKSAVAAATDSGPYSRMNRQGSKGGRRNWRIGQANAPGSNRQPSAPPRTLPI # IENGYHVTVLDLAHLTSDTTSQTRSSKNTSSPAVVMHFVASKTHPLSNMWFSASGTLLSTVSRDGQTAQIYEIRTDPMQRIHEASEDRDITSHSESRG # GDVSRFSPPLPINIPTISPPPVYNLRRGRTPAVIDSADWASDGRWLAIGTRKRTVHVFAVNPYGGPSDIPSHTTGRVNNVTELVKVLRPSFKLILRCF # QPTSPTDMHPLVRLRVTRNPRPDQPQVPLAFTFLEPSVEEERRLPPNLLPPLSSPHLLPTHQHSYGSVSTVMSSSPSMRSDTLSLSPHQQLSPNGRPR # NLQDILVFDPTDGILSLRRIYTDVKFKPNDGASILGTNFGSIGSTGASRSLPGTNAGGRLSVSTSPRISSVATTGLPHSKAENGELIGRENFVTSWRL # RRGRDWPEKKDTLTTDERGSARQDTNHQPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 Scaffold_14 AUGUSTUS gene 1164307 1164696 0.53 - . g207 Scaffold_14 AUGUSTUS transcript 1164307 1164696 0.53 - . g207.t1 Scaffold_14 AUGUSTUS stop_codon 1164307 1164309 . - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_14 AUGUSTUS CDS 1164307 1164696 0.53 - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_14 AUGUSTUS start_codon 1164694 1164696 . - 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MNPSSLPDDSAGSSGDDAVGHLERRISPSPAKARTQRLEPDHNQGYEQESMYERTLVGEDESSESVEPLIDVAPNQET # ERSIPSRSLPTPPLLEPSDTRQPRSEPLLNPLWDESGTSGGVAHSPILSSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 Scaffold_14 AUGUSTUS gene 1170341 1170778 0.67 + . g208 Scaffold_14 AUGUSTUS transcript 1170341 1170778 0.67 + . g208.t1 Scaffold_14 AUGUSTUS start_codon 1170341 1170343 . + 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_14 AUGUSTUS CDS 1170341 1170778 0.67 + 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_14 AUGUSTUS stop_codon 1170776 1170778 . + 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MKIFKEQWMGMGMWFDYGLVTNDMELASAVWRNLLGARGSQGIAYPDSNPPKFRRGVNLVGGAVENPEKIDLEKEQSR # DDGSGVHDYPPDEIDKYVRYPELMLDIVTYMRREILRLEKISDEEIMEGGLEALKFGRIRPNVPKSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 Scaffold_14 AUGUSTUS gene 1171616 1172683 0.26 - . g209 Scaffold_14 AUGUSTUS transcript 1171616 1172683 0.26 - . g209.t1 Scaffold_14 AUGUSTUS stop_codon 1171616 1171618 . - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_14 AUGUSTUS CDS 1171616 1172683 0.26 - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_14 AUGUSTUS start_codon 1172681 1172683 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MLFTLSQQISTFSDGNYAENKAFRYACFNIHPYNPRFLVSILEDHTVNTPSTVVNTLVIIDTQAKTVAPLVSGADFYA # LPKFSPDGGKLAWQHWDHPNMPWDNSQISLAEVTLADSSLTLSNVTTIAKEGSNGFLAWANRNTLCWVCDVSGFGNPWKYDVSTKKAGPIFPSPVKEE # FGAAMWLFCFFPFVIVDDAGKLGVFKAYRDGRAVLYRVDIETGDREQIESPYVVVECMRLVSKSKGQFSFLGTKVDHSEKVVVGTIRDTVSFTAFTSG # TISKGPNFDPSLVSVPRGIPLKAPPNDELLHVIYYPPHNPAYAGTSIEGEKPPCVVNVHGGPTGVYLALLSLRSERNWICV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 Scaffold_14 AUGUSTUS gene 1176893 1179106 0.93 + . g210 Scaffold_14 AUGUSTUS transcript 1176893 1179106 0.93 + . g210.t1 Scaffold_14 AUGUSTUS start_codon 1176893 1176895 . + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_14 AUGUSTUS CDS 1176893 1179106 0.93 + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_14 AUGUSTUS stop_codon 1179104 1179106 . + 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEIL # GDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRILY # RASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMRH # MHQLLVRSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHS # SPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNP # SVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 Scaffold_14 AUGUSTUS gene 1179259 1180337 0.74 + . g211 Scaffold_14 AUGUSTUS transcript 1179259 1180337 0.74 + . g211.t1 Scaffold_14 AUGUSTUS start_codon 1179259 1179261 . + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_14 AUGUSTUS CDS 1179259 1179910 0.77 + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_14 AUGUSTUS CDS 1179991 1180337 0.74 + 2 transcript_id "g211.t1"; gene_id "g211"; Scaffold_14 AUGUSTUS stop_codon 1180335 1180337 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE # GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG # ELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRG # EYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPDRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 Scaffold_14 AUGUSTUS gene 1181401 1183107 0.27 + . g212 Scaffold_14 AUGUSTUS transcript 1181401 1183107 0.27 + . g212.t1 Scaffold_14 AUGUSTUS start_codon 1181401 1181403 . + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_14 AUGUSTUS CDS 1181401 1181421 0.87 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_14 AUGUSTUS CDS 1181508 1181613 0.59 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_14 AUGUSTUS CDS 1181670 1182166 0.48 + 2 transcript_id "g212.t1"; gene_id "g212"; Scaffold_14 AUGUSTUS CDS 1182502 1183107 0.99 + 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_14 AUGUSTUS stop_codon 1183105 1183107 . + 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MRHPENLISFADGTIHKVEFLVTRLHPTAPIVLDAVATHAQPTALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSP # PEAPQRPPEAPQPPPEVLNNSEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKV # TPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKQPTEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPP # HRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLLIGTLVDQLRKA # KIFTKIDLRAGYNNVRVAQGHEWKTHSELGMGPSNTW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 Scaffold_14 AUGUSTUS gene 1184084 1185385 0.43 + . g213 Scaffold_14 AUGUSTUS transcript 1184084 1185385 0.43 + . g213.t1 Scaffold_14 AUGUSTUS start_codon 1184084 1184086 . + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_14 AUGUSTUS CDS 1184084 1185385 0.43 + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_14 AUGUSTUS stop_codon 1185383 1185385 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MNEDLLVNRVREAPKDTSVIEATEKDRTXRNEEESLVWEDGLLKRGGRIYVPDIGTLRREVLQSYHDHKLRGHPGEKR # TKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRAKPYGNLRPLPIGQRPWSSISLDHITQLPVTAGPEKYDAILVVVCRLTKQAIYVPCHTTDNAE # DFANLFVTHVFSKHGMPSDITSDRGSLFVSQFWRELCRVLGIEARLSTAYHPQTDGQTERVNQSVEAYLRIYCAYDQDDWDLLLPIAEFVYNNTPNTT # TGVSPFFANKGYHPKLSITLERVQGAEVNEYASNLKELHTYLQGRIRVANEAYAKYANQKRQDAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGPYS # ILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRRNSPPPPVFIKGRRNTSSKAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 Scaffold_14 AUGUSTUS gene 1193395 1194317 0.5 + . g214 Scaffold_14 AUGUSTUS transcript 1193395 1194317 0.5 + . g214.t1 Scaffold_14 AUGUSTUS start_codon 1193395 1193397 . + 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_14 AUGUSTUS CDS 1193395 1193749 0.5 + 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_14 AUGUSTUS CDS 1193839 1194317 0.56 + 2 transcript_id "g214.t1"; gene_id "g214"; Scaffold_14 AUGUSTUS stop_codon 1194315 1194317 . + 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSATSMIIHFPAISARTA # LSKLYVVNTPGPRSETLFVTTLPLALSVVAISPAVTGLTASILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFF # RALGKALSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFV # VNR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 Scaffold_14 AUGUSTUS gene 1198006 1199162 0.83 + . g215 Scaffold_14 AUGUSTUS transcript 1198006 1199162 0.83 + . g215.t1 Scaffold_14 AUGUSTUS start_codon 1198006 1198008 . + 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_14 AUGUSTUS CDS 1198006 1198790 0.84 + 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_14 AUGUSTUS CDS 1198877 1199162 0.95 + 1 transcript_id "g215.t1"; gene_id "g215"; Scaffold_14 AUGUSTUS stop_codon 1199160 1199162 . + 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MASVTAYSDSLPSDVPKLSNVSINWAIFDLRFTAAVKAKGKWGHFDGTSIKPSPALDKATGSPLPLTDEQLAASVKIH # GERSLRTAFLESKCPEKSNVHTYLDDLRMEREKLAAVGVDISEKDYLSTIIGSLPIHLSNFASNQLTAAQQFSPSKTIDPDVLVSIISTKYEHQKVLR # ARRQGTSAKFSKDEDEAVVVTPWKGGKGGSSSKRTCWNCGEAEHLRDKCPKPRKASTGRNEACSKSGGTANAAEEVDESEDDLPSVEEDAESGGVGED # WFSNVGGDDGDVEDLSDADWSDVYSFVGKESDDGSVRSSEDDLPVFQAINITHETANLSEPLTLTLAELLRLGLHTPYLPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 Scaffold_14 AUGUSTUS gene 1200341 1200859 0.61 + . g216 Scaffold_14 AUGUSTUS transcript 1200341 1200859 0.61 + . g216.t1 Scaffold_14 AUGUSTUS start_codon 1200341 1200343 . + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_14 AUGUSTUS CDS 1200341 1200859 0.61 + 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_14 AUGUSTUS stop_codon 1200857 1200859 . + 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MRSVGVEWNVYHRKESAVADGLEGEDWEFIEDDTTTTPKPSTTTSVSEITPIVAPIPAKPECSVIPDIPPPVPTTAVE # IPAKRTRKPSAHILDIIAGNAVASTRPSDPVIPKGIRLLPTVVEEEPKVLELEGEGTADWMMAMVDEDFVEEYALAMEMSEIEALEPRNLAEAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 Scaffold_14 AUGUSTUS gene 1210321 1211124 0.73 + . g217 Scaffold_14 AUGUSTUS transcript 1210321 1211124 0.73 + . g217.t1 Scaffold_14 AUGUSTUS start_codon 1210321 1210323 . + 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_14 AUGUSTUS CDS 1210321 1211124 0.73 + 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_14 AUGUSTUS stop_codon 1211122 1211124 . + 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MTSESRGTGSKRTGRKERGRGTTSASPPPPPSGGPGDSNSEGSDEGEHNQSSRNGGRREEDRGELPTGAPEAPPTRYD # PDQPWYYDPRQGWHRKTAPRNPNEGRNTWESNEEKNRITIESKLDVGKIESFAGNNYSAWKTWVLSLERMFGVCPTIYAREKDKCASAASHLTGAVLS # HFDTLNRQRLRGEHTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFTNFFICFNKYAPLTGFNDEALVTYLKKGVAPWLXLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 Scaffold_14 AUGUSTUS gene 1213878 1216106 0.47 + . g218 Scaffold_14 AUGUSTUS transcript 1213878 1216106 0.47 + . g218.t1 Scaffold_14 AUGUSTUS start_codon 1213878 1213880 . + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_14 AUGUSTUS CDS 1213878 1216106 0.47 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_14 AUGUSTUS stop_codon 1216104 1216106 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDEESHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLG # VSMDPEKVKAVIDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDL # AIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVIN # YRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDELIKRGGRIYV # PDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEK # YDAILVVVCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRI # YCSYDQDDWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGD # QVWLNMENVRTRRPMKKLDHKWTGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPQSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 Scaffold_14 AUGUSTUS gene 1216535 1219226 0.58 - . g219 Scaffold_14 AUGUSTUS transcript 1216535 1219226 0.58 - . g219.t1 Scaffold_14 AUGUSTUS stop_codon 1216535 1216537 . - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_14 AUGUSTUS CDS 1216535 1217750 0.68 - 1 transcript_id "g219.t1"; gene_id "g219"; Scaffold_14 AUGUSTUS CDS 1217914 1219226 0.67 - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_14 AUGUSTUS start_codon 1219224 1219226 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCSKSPAKCKVLPNSPRCTNCSVKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHQSTWGIPMVTWRQYDAALHERTSSTST # LLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPL # PPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDS # QRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRA # RGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGL # DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAGFAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPA # LPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPLL # FGSVASLSIDLTGDDDELYETERRRSLMPEGLLWRGKVPSWRWVRESSRRSHCSIHFVVFVHSVLLNILLACSFLFVE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # # ----- prediction on sequence number 2 (length = 934971, name = Scaffold_15) ----- # # Predicted genes for sequence number 2 on both strands # start gene g220 Scaffold_15 AUGUSTUS gene 88438 88686 0.44 - . g220 Scaffold_15 AUGUSTUS transcript 88438 88686 0.44 - . g220.t1 Scaffold_15 AUGUSTUS stop_codon 88438 88440 . - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_15 AUGUSTUS CDS 88438 88686 0.44 - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_15 AUGUSTUS start_codon 88684 88686 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MKSAFRNNLCHWLLPILQDPDMLYEAYKANEQTELEEEEDDDSTDGGIEDDTLEENWDQDWEETWEEEEERWDGGELW # EDEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 Scaffold_15 AUGUSTUS gene 90526 91002 0.7 - . g221 Scaffold_15 AUGUSTUS transcript 90526 91002 0.7 - . g221.t1 Scaffold_15 AUGUSTUS stop_codon 90526 90528 . - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_15 AUGUSTUS CDS 90526 91002 0.7 - 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_15 AUGUSTUS start_codon 91000 91002 . - 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MLAQTYHTASAALGLVDDIPTSIRFAQQMAAFITDNQDAIGDTLDTSHQATDQEIRLYNDTIYMEADRASDGLWVGTE # SFDIEEKAFLKTRAVDLAVGWKKKEVKTTKNYRKRARPSSDSEEEDSNEDTGMDVDDDDDVEDRGEASSKGPRTKKLRKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 Scaffold_15 AUGUSTUS gene 91152 93029 0.78 - . g222 Scaffold_15 AUGUSTUS transcript 91152 93029 0.78 - . g222.t1 Scaffold_15 AUGUSTUS stop_codon 91152 91154 . - 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_15 AUGUSTUS CDS 91152 93029 0.78 - 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_15 AUGUSTUS start_codon 93027 93029 . - 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MNDKAAGHTILFQISDNNAMPQKPETDEELFEKLVDFLRQAQSPDDFKGLLKTALALTNKAPKIRALLQNHSKVMASY # ALHTSLPSLRSVNFTLDSLAAAAPIKWAYLAPVLNHSLISLRFLFDSNLSLKDIPMSHFYPASQHSHGKSSLSPEEEDHLDAVNDSISQYQRYFGDFK # SLYGDALMYWKPQGNFGKFISRFVTEVAEPAYSLTFEDNGGLKDWNGLYGTSTINDPFQEYMEENNLSFDKLLLPNHHQWDTLYSIYQAHVLKLFTQL # TRDWKSQGLLLSSQEKAIINSLPVRFSFLCRHSPVPPASGLNLIATPILCPSVFHALAEQLDDLTPGLQMISHLFVPGVHLSLSKTNVGSDSEPNPIR # TYQDAVVHTLAYNYKRSLATWKMDTEPLNYDAVLYYWYRLVDITLIFRHTLRCYANDIGKILQILKTPEPHPAYGSNHFIFRSHQEAFYHFMDTLRKH # VKKDASAAFKIPQNRVPPNPERFVDVIQLHDHAMKLDSPSQSLVEFLPFLPWNYCLSNNKRHLDSKLFELTAELYIMDSHWKPLLQHRSLAHFLEQIP # IHLAFGQVPLIAMQLWCSPIDPRDVVDDKRSAEQLQAGVTILRQAILLTDNQHGVWH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 Scaffold_15 AUGUSTUS gene 93119 93604 0.74 - . g223 Scaffold_15 AUGUSTUS transcript 93119 93604 0.74 - . g223.t1 Scaffold_15 AUGUSTUS stop_codon 93119 93121 . - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_15 AUGUSTUS CDS 93119 93604 0.74 - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_15 AUGUSTUS start_codon 93602 93604 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MADAPILFDDFDGTGPQLKPLNKQRQLNPTTIQLISSSPTLYIHEYPLAVMIYPEAIHLSSLIQSYVPNQPVPLVQFT # GENSAGPALLAAGNHRRASLGPFLDLQDPVNRPWATYKQAMEKLQHCSEEEDTAEFSKQVNLLQGKLRTVGIWGVKFYDYSKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 Scaffold_15 AUGUSTUS gene 94689 95264 0.49 - . g224 Scaffold_15 AUGUSTUS transcript 94689 95264 0.49 - . g224.t1 Scaffold_15 AUGUSTUS stop_codon 94689 94691 . - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_15 AUGUSTUS CDS 94689 95264 0.49 - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_15 AUGUSTUS start_codon 95262 95264 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MSIKSLAVNLFDQNSSQVVDGRLQHLTPLSPTQQFLQRRKAIGKGSQNKNNNKDGDEDEEEEDEEEVEEEYEDESESK # GKDKGDDEDEDEDEEEDDDGADADADTDDDDELDEVVVEVEVQHVVENKGKDAHKKHDEAEDLREERRMRLRSLISQSLGPLATVSQILIQLSAIFHI # NICLLFHLPGSRHLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 Scaffold_15 AUGUSTUS gene 96345 97004 0.51 - . g225 Scaffold_15 AUGUSTUS transcript 96345 97004 0.51 - . g225.t1 Scaffold_15 AUGUSTUS stop_codon 96345 96347 . - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_15 AUGUSTUS CDS 96345 97004 0.51 - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_15 AUGUSTUS start_codon 97002 97004 . - 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MEIRCVNAPVIVATGTAPPIAVPIIAERFGLVEPYLVVRGPTDRPEIKLVIEEQRSMGAITQRTLELVQKYISTFATK # DRALIFVQNIQYGKDLAKALTCELYSGSQQDTPDRLGTYTRWIEGNNIVMVATSAFYAGNDYPHIRLAIFAGTPGDMTGTIQGATRIARDHQLGTCIL # LPQKNAKGHLTKVGEVDYAGAKSILQLCNNSPKVCLQPIHWLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 Scaffold_15 AUGUSTUS gene 97735 98940 0.16 - . g226 Scaffold_15 AUGUSTUS transcript 97735 98940 0.16 - . g226.t1 Scaffold_15 AUGUSTUS stop_codon 97735 97737 . - 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_15 AUGUSTUS CDS 97735 98940 0.16 - 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_15 AUGUSTUS start_codon 98938 98940 . - 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MYHKAGALTQSDKLLPHASDALTADLTIQDLGLARPFAQFAALECFPQSTMVHEAYRDLLFVQIGRPFEADEISEAMG # KVTLQTIGVHLGMNAYRHVSIAFRRMLVDKATEAEAQAAVMRQIEAEQASHTEKVEHSRYAVSLDAIGGQSDQVLSLFCEASVRWQIKCKVVPGHIHK # PYSQVDSAHFHQLKAAKVFQLVDIPDIPDDDDDDNDNDDNDDNHDDDHHHLENDHLVHSVVDKLKPVLEEVVNRAVANLEHSLLSKLGSVGTLTSSHV # LDQQSVHSSFASSKHSLQANPAASNVGNGRPIKKQRQLVSFSLAAQEKEEEEKGEKKKQTNYNWPNSSTDDDDDDDDYIPSSESSPGTSTFASSATLT # NNSTGEYIFYRYLFEHIFISTSSRVQFTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 Scaffold_15 AUGUSTUS gene 99339 100414 0.24 - . g227 Scaffold_15 AUGUSTUS transcript 99339 100414 0.24 - . g227.t1 Scaffold_15 AUGUSTUS stop_codon 99339 99341 . - 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_15 AUGUSTUS CDS 99339 100029 0.28 - 1 transcript_id "g227.t1"; gene_id "g227"; Scaffold_15 AUGUSTUS CDS 100149 100414 0.83 - 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_15 AUGUSTUS start_codon 100412 100414 . - 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MPSTVGVGEYTLNTRLITPWLLKTKWPLIIGSHSIPQLRTLSSQATADDDLLTKASSVIHSLTAQAVVMIDLIPELIL # QKLNTPEPSKGLSHLPFKKHAQDQVTMRTYTAELTRLVCLLLRADEGVYPFNFPPTVQSSIEAFRQGLNNADCTEETLILSARDMLFTIWSYKWPQNN # STKVTSDPTLLWLSFRMLLSHGGFRDPVQTTPVIARLEYNMRLVGVLILGDAIMAGLDVEQVWETIAPCFSEEEPFTFHSLRQIQHYATSLVHNQISL # PRIIWSDHRFYRTMIYLGDQIHFSKLLGLFDILRQSVLPSGRTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 Scaffold_15 AUGUSTUS gene 118101 119399 0.46 + . g228 Scaffold_15 AUGUSTUS transcript 118101 119399 0.46 + . g228.t1 Scaffold_15 AUGUSTUS start_codon 118101 118103 . + 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_15 AUGUSTUS CDS 118101 119399 0.46 + 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_15 AUGUSTUS stop_codon 119397 119399 . + 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MIITITDYKFDSIDEPPPPAVDDEIRRREEEELQRVLEMSMQDRGGYNGNSTYSSSSWSQPSGAGSSSSSTNAYGLTA # TNSTSTPAGAGSATGPGAVSHNGYVPSTNPSAVSSYARSTSPKVATPTITSGIGTMSLGSTTSLNSSTSSTKRKHLSNRVRALHAFTPTEPGELAFSA # GDIITVVDRGYKDWWRGQLRGRTGIFPVNYVEVLPPPDEEELKREMQQEAAVFSEATNVERLLELLRDMDREQQEYLQSQTQSTNTSAPAPPPPSRLA # DNDELQELYRSCMALRPKIVKLIEKYSQKRADLVSMNETFVRARTIFERLMEESLAGYGAAGGYSNAYGAPGYTGNPAGYPVVSPSYSGPVQPGYFPT # PTPVPAGGPAGYPTGTYPQQPYTGGTVVQGPAQRPVQGWYSHQPLVRLRLSDYPDKEISL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 Scaffold_15 AUGUSTUS gene 119456 120248 0.28 + . g229 Scaffold_15 AUGUSTUS transcript 119456 120248 0.28 + . g229.t1 Scaffold_15 AUGUSTUS start_codon 119456 119458 . + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_15 AUGUSTUS CDS 119456 119881 0.28 + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_15 AUGUSTUS CDS 119940 120248 0.47 + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_15 AUGUSTUS stop_codon 120246 120248 . + 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MYGAQRAATQNQQATQGGLQQERHQIQGPVQLQQQQQVYGKQSGQADQAGQMPRQQQQQSSPQQQHPMQQPQLQPQNQ # THSHSQSTQSQSSSRSQATSSESSSQPSQSAPPYIYSPTTTYTDPNVQAWAQYYAQGGTDPTGAEVLHTEQGRGGSSQGQGQSATRIATQYSKVSQSS # IDNSHPHASAAQNQTQGQVQQGYGNSPYGASPYNVGSIVGGSASTGSLPYPGPASDSGHPNQQTDWTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 Scaffold_15 AUGUSTUS gene 120293 120598 0.82 - . g230 Scaffold_15 AUGUSTUS transcript 120293 120598 0.82 - . g230.t1 Scaffold_15 AUGUSTUS stop_codon 120293 120295 . - 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_15 AUGUSTUS CDS 120293 120598 0.82 - 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_15 AUGUSTUS start_codon 120596 120598 . - 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MFIEGDGPSVSVTHGTTKSAAAGSAVADTAVSVDPGDPATYSEMYVENEANEAKSGYSIRSDSNPQYKASVTLQDKVN # SNSVVDHQCSQRLQNMDSGNSRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 Scaffold_15 AUGUSTUS gene 131702 131971 0.47 - . g231 Scaffold_15 AUGUSTUS transcript 131702 131971 0.47 - . g231.t1 Scaffold_15 AUGUSTUS stop_codon 131702 131704 . - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_15 AUGUSTUS CDS 131702 131971 0.47 - 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_15 AUGUSTUS start_codon 131969 131971 . - 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MESSRIKTVKLCMRPNSELRFAFIYVSFIVNGIKYYLLSLNFQVDHNKDAADATKDLSSGTPTKAEGPSATKPSTSTS # SSIVITTSSKA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 Scaffold_15 AUGUSTUS gene 132739 134153 0.17 + . g232 Scaffold_15 AUGUSTUS transcript 132739 134153 0.17 + . g232.t1 Scaffold_15 AUGUSTUS start_codon 132739 132741 . + 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_15 AUGUSTUS CDS 132739 132984 0.21 + 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_15 AUGUSTUS CDS 133083 134153 0.6 + 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_15 AUGUSTUS stop_codon 134151 134153 . + 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MGVITGSPVSPNLFNLVVADFKVTEHPTDVVLHDKHVNHMLQADDTGMASTTPSSIQSKLRQFEQYASLTGFEVSVPK # CMITTGQGGIYKDNYQKLADKAKNAAGAVLHAKTFVGNDMPIKDMITMYWARVDPYLKSGSEFIMDVVVSHREQLEEVQHYFLRRALSIQKRSSLEVL # FTETGVMPIRYRRIILFFKNMQYLISLPHHHLAWKAMREAYSLAQKGHTSIILEACRVLESLPIPVTWNIPEFEDITAAHLNGLIEHIQDSMERTLQN # ALMTCPRTADTLKDRKEYDRKNKKMVFKALAFRHYLTVPTGKHRKALIHMVTGNHQLAVERLRWNERNRPRIIREHRICRNCKCSVEDPAHVLFECKG # STELIKLRDSFMQKVISELPQYAKSYSNAWMLFRILLAETRITELFAKLTYDVLEVVYNTEMFVPA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 Scaffold_15 AUGUSTUS gene 136263 136649 0.95 + . g233 Scaffold_15 AUGUSTUS transcript 136263 136649 0.95 + . g233.t1 Scaffold_15 AUGUSTUS start_codon 136263 136265 . + 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_15 AUGUSTUS CDS 136263 136649 0.95 + 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_15 AUGUSTUS stop_codon 136647 136649 . + 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MSSTTKPESRISPQIQSQQSNSLQFSNANTPTSTIVEDPELRSEVMNAKKAKETEKSKLEAKEVIDEDGESERTIVVD # WDGPDDPSNPKKYVQVTSVHPLPNSDKKFSQLDFPSQMGCNCYRLSVHLH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 Scaffold_15 AUGUSTUS gene 147697 148635 0.45 - . g234 Scaffold_15 AUGUSTUS transcript 147697 148635 0.45 - . g234.t1 Scaffold_15 AUGUSTUS stop_codon 147697 147699 . - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_15 AUGUSTUS CDS 147697 148635 0.45 - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_15 AUGUSTUS start_codon 148633 148635 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MSRAQLVAVAQSLNAKLPAAMQIDVTDIRTDFFIRKSIEVLVGISKPVVPSESIIAVPEPPGAPRAVKSRKMHSMAIV # EDRNTSRLERVGEGRNAVNDGDIDMNTWPPSSPGILSSPLAKRAVIRSTKVARAFELGTLATTGTPKLARLEEEDESMASANEDPEGYGDKRVKKRRK # FSDSEFRARGRGFRRWSGSLVKRATAKPSSFSSPMDVDTDVAAVQLPSQIQSYRLRPISSLKPLSRPNSSSLHSSHAYISSSNLTPTRHSSFSPGGLS # DQSRGSKKRSRSVYVKSQLPDALKKMAIASEATSPNRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 Scaffold_15 AUGUSTUS gene 149743 150375 0.58 - . g235 Scaffold_15 AUGUSTUS transcript 149743 150375 0.58 - . g235.t1 Scaffold_15 AUGUSTUS stop_codon 149743 149745 . - 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_15 AUGUSTUS CDS 149743 150375 0.58 - 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_15 AUGUSTUS start_codon 150373 150375 . - 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MFGLLSFNADLPWVTTIYLQLYMRWPHYCFWKMNTTEFSCVNWDDPSQTAVQFRRLLRAYIQHDASIVDILDTLETIA # FFLLPVPHEDLENFVSNVFSDDDVSKALPLDIDKFNKTVEASKVRMHEAMRLAAYEIHELFATQPPQWLRSDLGYGSEVTEEVGKLFQEAMRVLFEVC # YADELAIQKVLTIMAVNLKDIETDKEKEYREIGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 Scaffold_15 AUGUSTUS gene 163182 163538 0.55 - . g236 Scaffold_15 AUGUSTUS transcript 163182 163538 0.55 - . g236.t1 Scaffold_15 AUGUSTUS stop_codon 163182 163184 . - 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_15 AUGUSTUS CDS 163182 163538 0.55 - 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_15 AUGUSTUS start_codon 163536 163538 . - 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MPSNANVVAMAGVNPRSFGFPQGPNAPPLGPLHNTSNDSMITSPPSSAGPVLPHGGQPITSVVSSRKAGRVFDLARGV # ELFKPGSEEVLARFLKMSSWEEESSPQWRFGAVIVIVSHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 Scaffold_15 AUGUSTUS gene 164901 166717 0.89 + . g237 Scaffold_15 AUGUSTUS transcript 164901 166717 0.89 + . g237.t1 Scaffold_15 AUGUSTUS start_codon 164901 164903 . + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_15 AUGUSTUS CDS 164901 165197 0.89 + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_15 AUGUSTUS CDS 165251 166717 0.91 + 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_15 AUGUSTUS stop_codon 166715 166717 . + 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MADLSLSVTQLQALHTLLLLQGSNLPDDLKSLPASLQAQLALNSTAPSFPTPSPSPERLPRAGSIFLARARLRPHWLF # SQPRATCEVGTQVEDPALALESFSRPSSSASGAGYGAGSEVEEDLDGVSAHSPSRDSAHNPTRDPSCDFACNPIYDSAHASDPDSIHDSIQDSDHDSI # HNCDRDSIQDRNCNSIQDRDSIHDRDRYSIHNHAHRTPSRNSALDPSHDYAHGTPSRNPAHGSIHAATHCSAQDPAHSSAQDYSQETACNAAHDCRGH # ISAPNCSHNSNRESDSELAHHPRNSSQASVYGSAHAQYHCDSRDTAQDPTLKINKAFHDDQGEVEEGPLLANTIYSAPSKADNESLLDHNTLLADSHQ # PDADDPNPLLDELLDELFNDYNHNNYYNEKKILGSDLDAAILSLLEDECSRPLVNSPTRQTDSSTSHFATSNEDPGSRKRRHLQDSFGEEVPVEVVRP # RAAQANPFDPRPDCNCNGASASQKRPRVNHLLNLDFGEEEQQLGREEENMGPQFLYEASDRPHAPPKEVTLLLTPSQSLIPLLALAIPDKGFYLQVTL # YCTFSSSIIEPTGLYTVHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 Scaffold_15 AUGUSTUS gene 171370 172994 0.55 - . g238 Scaffold_15 AUGUSTUS transcript 171370 172994 0.55 - . g238.t1 Scaffold_15 AUGUSTUS stop_codon 171370 171372 . - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_15 AUGUSTUS CDS 171370 172170 0.81 - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_15 AUGUSTUS CDS 172287 172994 0.55 - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_15 AUGUSTUS start_codon 172992 172994 . - 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MRRHLQQQSDLNLLVFAGGGRGGRFAAFPVKKRVPTSTDRSVAQSAYVATSGFETRIANPVNARPTTAIYTGPDTSIS # DSVEGDRNVEKEEKEFAATPRFSALIEAGIPLLSSDLESSTPVSLGYEPPPLELKAQTLEGLELNIPPTPRHHLPSPRFSSHFTTKAYFEVLSQRKAQ # DSLPPLPPLPVSAPSNVGVDFSTSFASAEEEELDERNTVWVKSETSSDPSTPRAVLTPAFPHEPSESPSISSSSPLEPSTALDLEPTLDSSPQPTLSP # EIILAPALIHPNRVRFASNPVEIPLMRPRDSWDSLFTEDDEDLSSSKNVDLGQQLALDGIANASSSVRILLSSDLSSYNSVQFDAARASPQSSSMVEH # LSEKNSGSLTSGVSPVSSDIFDLLNAATTNASSVIATLESDFPSTSSSPSPLALPESTQSLKKESLALPSSSSTSRSPPPKRLTEENPASVSTSMSSA # THEITSSSLEDISTIREPPPHTLRMYLGAIGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 Scaffold_15 AUGUSTUS gene 176458 177507 0.69 - . g239 Scaffold_15 AUGUSTUS transcript 176458 177507 0.69 - . g239.t1 Scaffold_15 AUGUSTUS stop_codon 176458 176460 . - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_15 AUGUSTUS CDS 176458 177507 0.69 - 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_15 AUGUSTUS start_codon 177505 177507 . - 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MRSPTLFSSQTSSLGTDHRCLFPRLRNLTLRGVHVNWSSLAHSPPPLTSLELSSHAPDVRPTQSDFRELLSSCPKLKS # LTVNGSGFISDDEELSLKTGVHNIDKSAKPIALPLLEKLKIGYRSAPEGFDILELVHAPNILQLSLDDATHPGEIDEVEADDMLLYVAGLRPMINPES # SFSTPKHSSPFPTIQKLALKGLRAQTDTFRKLLVSTPTLQSLELYMMPRPMNVIHAMSPITTIAVTTPARTRTTYQRLLISRPASPASSRSYSCPCPR # LQELCLWTVNLSRDDIHFIAKDLLLGRSEAGAGSLERLDIHLFEGTESASEDLEGTGVHIFKVPLDKRQQCRGYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 Scaffold_15 AUGUSTUS gene 179248 179925 0.94 - . g240 Scaffold_15 AUGUSTUS transcript 179248 179925 0.94 - . g240.t1 Scaffold_15 AUGUSTUS stop_codon 179248 179250 . - 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_15 AUGUSTUS CDS 179248 179925 0.94 - 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_15 AUGUSTUS start_codon 179923 179925 . - 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MSVEYALEIFWKSFVDVGLHVMSSYFKVNKAFHALVTEIPLEPTRQGSPQNDSRPAWIRPVRKKTLSSATRSSQSGDS # PSQLDNSSPEAFSPSDFFMDPPKPATFQAGPQALPLNGVVPISTTTNSFGNNGPDQQQQQRSPSSQSFLDPSAMDLSSQLYLSHVDMMNMFGDNGVGG # VDVAQMFTPEFIRAQQISTPTPGQNGIDIGQANGGSLHSGFSKLSVPSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 Scaffold_15 AUGUSTUS gene 180006 181954 0.76 - . g241 Scaffold_15 AUGUSTUS transcript 180006 181954 0.76 - . g241.t1 Scaffold_15 AUGUSTUS stop_codon 180006 180008 . - 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_15 AUGUSTUS CDS 180006 181148 0.81 - 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_15 AUGUSTUS CDS 181370 181954 0.76 - 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_15 AUGUSTUS start_codon 181952 181954 . - 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MHHLETLIQAIPPAVFAAGGNPAPNPLNPPQSDTPNAATAVPFMYPSFPSGIPPPSLHVFPLTNPSTHFTPELKPDDM # QQSSPLSSFQTFMGSFYNTQNASNSEQLAEEASRLSLTASYLYFDDEGYTRWQGETSGLPLLDLLIERKAPESATVTSIPSEASPTDAPTANSDWFPN # RSLRRTDVNPQTLWRMITSDYGNPQKWGEPGFATFIVAICCLASRHMDDPRVRANPTDGISAGTHWFELLGRLRTLPIADQPTLYTIQADLVAAVYAV # GLGRLSRAAALLSEAVTVSIDAGLHRSADTYDLFDPIEDEIRKRTFWCVYIWDKQLSAHFGRPPIIRLRDCDVAEPAAVDDEFITKDGLGVPPLGTEC # RMTAFISAIRIMTVLESVTDVPPIKQSSSPFLARATAMLTGMKIFNDLRDEEALLDEIHNSIPAYWAHSTETLASDDTIRVTQAQRIHSAEQFVRMLI # YRHRFTKRVAERMNGDEDQKQKQSNEERDAMMSAHASALKIIAAHVHIAGKGLMTYCESFSSAHIFLFRICTHAESSRSHSWCPCNSSVNPSGKDIGC # HPAQLQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 Scaffold_15 AUGUSTUS gene 183111 184381 0.31 - . g242 Scaffold_15 AUGUSTUS transcript 183111 184381 0.31 - . g242.t1 Scaffold_15 AUGUSTUS stop_codon 183111 183113 . - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_15 AUGUSTUS CDS 183111 184192 0.67 - 2 transcript_id "g242.t1"; gene_id "g242"; Scaffold_15 AUGUSTUS CDS 184249 184381 0.33 - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_15 AUGUSTUS start_codon 184379 184381 . - 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MLWITVYSFFFSSDFINEVIILFGELTFWTTVIFSAAVALGERHSPRFIIKFINSAYFPLDKDIIRESWVRGDLKDQL # GIGHRKGNRQKDISVSALEAAPMFHDAHNRSASEISQNPYEPTLTSSPGTGGIPLRPTYLDTPPLTDIIEETTMASPVQYAYATSDDLMPPSTMLPDG # PSRASYYSASDLPPPSPLPSPKYKYSDGTITSTPPSRRSSVATMRTVPPQTPPANVPLPPPPLQQRSPNTTLMLPGAMGDLTRRLSGGGGGGSYQPPL # SPQSYEMRIRSPPLGSPGTSEFSHAQRSASAASYATANDDYFTAEGEAVVSMPHHHPQHQMFNSYGPGQGQTLSPYYNQQYPVQTPGVEEDFDAQTVR # QSQYSQYSQYDDRRASAISGVSEFSWQGGRAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 Scaffold_15 AUGUSTUS gene 185837 186859 0.78 - . g243 Scaffold_15 AUGUSTUS transcript 185837 186859 0.78 - . g243.t1 Scaffold_15 AUGUSTUS stop_codon 185837 185839 . - 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_15 AUGUSTUS CDS 185837 186859 0.78 - 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_15 AUGUSTUS start_codon 186857 186859 . - 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MYYKPYDTPCVPKTWNISDDLGQIEYIFSDKTGTLTQNIMEFQKCSINGVIYGEGVTEAQRGAATRDGNTADMLNPEE # LNEKLASLKQQMISVMERSFKNRYLQPEKLTLVAPKLAQDLTDRQGSSPQRAHIISFFRALAVCHTVLSDKPDPERDPFHLEYKAESPDEAALVAAAR # DVGFPFINKGKDGIDIEVMGQKERYEVLKVLEFNSTRKRMSVVVRNPEGKLVLYTKGADSVIYARLASDHNAMVKDQTSKDMEVFANGGLRTLCIAYR # ELEEDEYLGWARRYDAAVNAVEGRDEEIDKANEEIERGLRILGATALEDKLQEGVPEAIETLHRAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 Scaffold_15 AUGUSTUS gene 187492 188851 0.96 - . g244 Scaffold_15 AUGUSTUS transcript 187492 188851 0.96 - . g244.t1 Scaffold_15 AUGUSTUS stop_codon 187492 187494 . - 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_15 AUGUSTUS CDS 187492 188234 1 - 2 transcript_id "g244.t1"; gene_id "g244"; Scaffold_15 AUGUSTUS CDS 188516 188535 0.96 - 1 transcript_id "g244.t1"; gene_id "g244"; Scaffold_15 AUGUSTUS CDS 188667 188851 0.96 - 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_15 AUGUSTUS start_codon 188849 188851 . - 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MSFLKRPSTARHSDSDEEEDDNIDPELRLRTVRTAASALEESIRTEEKAQRRKLDEEDGCSGMENLSPVFPVFGAAAG # AISVLPLVFILVVTALKDAIEDYSRARLDDQVNNSAVTRIGGSWRNVNLAKDPRSWFDKLRGVPPPGQVTKGVRKLREREASEAGAVMRTALIRSNTS # QTAFTDYPSSFDIPNQGAGGRKLEDIQSVDSHSYPPAGEPMSNRSFSESSTRIGLGSMSNYAQSHYSRSSIGVVDYRKHVAGAATWERTLWKKLEVGD # IVLLRDNEQVPADVVVLATSDPDGMCYLETKNLDGENQSQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 Scaffold_15 AUGUSTUS gene 194649 195572 0.72 + . g245 Scaffold_15 AUGUSTUS transcript 194649 195572 0.72 + . g245.t1 Scaffold_15 AUGUSTUS start_codon 194649 194651 . + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_15 AUGUSTUS CDS 194649 195572 0.72 + 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_15 AUGUSTUS stop_codon 195570 195572 . + 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MLKSLFVTDDEIHTGSFGSVPLAVHEAGEILSRYIERNPDRYIRQEYNAQIDAARAVVADHIGVDRDTCVFVPGVSAG # IATVLRNFKWTSQDIIVSSLYPSSHISFLRLMLVKKTADTIYDTILSIIEEICAGENRPQHSTFALNLPLSHSSILDQFRLHLRLLNAQVHATAGTSA # AARGATTAPAGKIVVVIESITSSPGILMPWKDMVKICRAEEAWSVVDAAHSLGQELNTDLKALDPDFWVSVCMDWHYPSFTNLSLHIIFGWGIRTEPS # GVMLNVDAPFYMCLFGQYAHTPGYLSPMMNILY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 Scaffold_15 AUGUSTUS gene 204529 207194 0.66 + . g246 Scaffold_15 AUGUSTUS transcript 204529 207194 0.66 + . g246.t1 Scaffold_15 AUGUSTUS start_codon 204529 204531 . + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_15 AUGUSTUS CDS 204529 205435 0.66 + 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_15 AUGUSTUS CDS 205519 207194 1 + 2 transcript_id "g246.t1"; gene_id "g246"; Scaffold_15 AUGUSTUS stop_codon 207192 207194 . + 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MASSPISSPPLASPNPLSSPNVPLPIPNSPIPSSPSFSPRPTPPVRRASTSSVTIPIPGKSILKKPPPPPTGLLSRIT # SGISVNGIGGMSMGGLGKFFGSGTGGNATSSVNSNLATIPEPPIDTVPSSTPPLNPALKRAHFILPHMAVVYPISSSAPPRTPTTQMEKKAVENRERE # RRRKVVSGDSIGSGGSAVSTTNQSESSGYTTPVNEDYRYGLSTDSPPTPIGVSGAGWWSMDKVGAFYKECCAASDEFPDPAISKALLRYSTSAAASTS # LTTLSTNPNSTNNALTPITANPNPSLLCHVLSIEWGLRTLILCESNLDVIILKPILHALLLNNTLIYLSVASNSGLGRSSKNSVAGGGGGLNFSGGFG # SLKGAVSGGAVTGWVVLEAYLSKSRLKVLDLSMNVLDKKAMESVVRGALGSLGDDSTSSSSRSPSTESLSAIPEPHNSHSHSYSPSPSVISLTLDSTT # IKSSAALDVLARAVRTSPSLRTLSLRNCRIGAMGSRGGIAVSLMVRDWPDSVPGGTGPSGNGSGNASGSNSSSASVSMLNPSSLTPVNTSHPQSTTSI # QRLRRPAALTNLFDSVTSPPVTSTPTTNPAFQSLSFSKTPLSAKPSPSAPLQKPLLPPPRHPVNSNMELTSKPNSLPPPAAHPLSHSSNLPPPPPIHP # TKIPPQTTYTPYVPRSKRAVLGAAPGTESGPPTPTTPSGPLTPMKSATPFTHTPITPTLTTVSRGGVTALTSTNDSNNLSSSDIASNHAIDSNSNSLN # PNVINAITHNHGGATLGAQPMPPSVAALNSASAALLTQVRALDALPRIGSLRVLDLRGNELRVSGVSLDLCFSGILVFLFYLSGSSFSDSEFFLHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 Scaffold_15 AUGUSTUS gene 214184 215275 0.66 - . g247 Scaffold_15 AUGUSTUS transcript 214184 215275 0.66 - . g247.t1 Scaffold_15 AUGUSTUS stop_codon 214184 214186 . - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_15 AUGUSTUS CDS 214184 215275 0.66 - 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_15 AUGUSTUS start_codon 215273 215275 . - 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MCFQSTLFHPRGRQTFIHNEVLRHVDANRLGKDVKQLLILVHGSASSGKTLLLCGLFDFISDHHSPTLAFKGAAMEHG # AALIGGVPMESIPHAATMDCGQEYFFVDVGSALEMGVLTGWSEQLNKRYGCEGATTYFGHRNVVIFADIHQLAPLKNRNQAFWLHDNPITHKFLSNVH # WLDTEPIHDRTSNTFLDTIRLATIGRDHIQLLNAGVANMASFVKRHARCNAVVVSNSRERCKQLNQFLLIEVAKALNATLYMFNSFNDITFSIGATVT # KAELKLLQDNICDCGAIPGRMPVYIGMPCSVIIDSTPVWGTIFDIELDPRESAEIPRSAVVELRYPPATVVINVLAALLQNNPDLRPVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 Scaffold_15 AUGUSTUS gene 215923 216372 0.56 - . g248 Scaffold_15 AUGUSTUS transcript 215923 216372 0.56 - . g248.t1 Scaffold_15 AUGUSTUS stop_codon 215923 215925 . - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_15 AUGUSTUS CDS 215923 216372 0.56 - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_15 AUGUSTUS start_codon 216370 216372 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MILQALRAGEDPDCVYLLNVHIRRCLTNFFHKVTIVTITPEGQQNTPFWVEARQAHAIVDFPVFDSLGSKVAANCVQG # AIKGAMVAVDVVIQGWKFKSDPNWGFALDLKRLTILEDAHEAAEDVDLPPLQIHLPGGELIFLLKAILSVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 Scaffold_15 AUGUSTUS gene 216447 216779 0.21 - . g249 Scaffold_15 AUGUSTUS transcript 216447 216779 0.21 - . g249.t1 Scaffold_15 AUGUSTUS stop_codon 216447 216449 . - 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_15 AUGUSTUS CDS 216447 216779 0.21 - 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_15 AUGUSTUS start_codon 216777 216779 . - 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MSSGTFFRDDKTFLFSNVRVPGGGKPKAKVVTFVSSVLNNNNFTGMTGNWVPSKKAAKHGKRTAMLGPAFNGKFELDW # DQSIQTLKDIMCLLTKDRNHDVKFLWYEEDRQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 Scaffold_15 AUGUSTUS gene 217927 218565 0.61 + . g250 Scaffold_15 AUGUSTUS transcript 217927 218565 0.61 + . g250.t1 Scaffold_15 AUGUSTUS start_codon 217927 217929 . + 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_15 AUGUSTUS CDS 217927 218565 0.61 + 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_15 AUGUSTUS stop_codon 218563 218565 . + 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MWIGETPFELYILTLPELIPLSRFHAAAYVVKMYPKKRSACWIPKDQLTSALKGNISSYFMNSEEITHLVDDSHLPPR # QGILAAMIAITFIGKQNISMNTLKTLFTVQHVKVVNALHWLIANNKCYSHIQMSSININALPENGVLQELLTTVKYSEDKFHFEEERQGYVPDGEEDE # EYWAEDQNNPYEPLCEGSESEEEENTASDTPGKYKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 Scaffold_15 AUGUSTUS gene 219026 220012 0.72 + . g251 Scaffold_15 AUGUSTUS transcript 219026 220012 0.72 + . g251.t1 Scaffold_15 AUGUSTUS start_codon 219026 219028 . + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_15 AUGUSTUS CDS 219026 220012 0.72 + 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_15 AUGUSTUS stop_codon 220010 220012 . + 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MSRADFVRNQYAIERLKPGNFATAAEEERNSSRFSNPVMRSLMNHLRSVLSSVPGTDSSRTSVRSQIWSMSTMINAPN # LWVTLNPSNINNPIAQVFAGEQIDLDNFDATVEAYVGMVETQGRGMLHVHLIMWLHGSPSPSKMRTFLLSEEFRKKIVAFIKTNVQADVGLSQPDFLK # LTPKPGIYFNRPIPPSDPKYSEKRDSRTKLVARTVQLQSCEVGRCLIVKNKRLVCKNRAPFQLSDTDWVTENGEWGMRRVIPFLNGFNPTISELLICN # HDVKLVTNGNETQDMTMYATNYSLKQQPKTWNESVLLAKQHAFHVEQELQSHDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 Scaffold_15 AUGUSTUS gene 220640 221188 0.8 + . g252 Scaffold_15 AUGUSTUS transcript 220640 221188 0.8 + . g252.t1 Scaffold_15 AUGUSTUS start_codon 220640 220642 . + 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_15 AUGUSTUS CDS 220640 221188 0.8 + 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_15 AUGUSTUS stop_codon 221186 221188 . + 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MPQSIGKWFPCNDRKETRLQYILTMLTIWKPWRQLTDITSAHVSANAAWYTFENATSGKYNSFLENVQYFYRCSDHSS # ARRAKEYSTYEALPDTGEASHGDDDDSSQTPQQISMDDIEWTDEEILKLQDNESARDQEFGLSAMECAYEAGIFQQEYVVQGPVNLCSSAKPRTKQRS # KCGQPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 Scaffold_15 AUGUSTUS gene 227709 228488 0.39 + . g253 Scaffold_15 AUGUSTUS transcript 227709 228488 0.39 + . g253.t1 Scaffold_15 AUGUSTUS start_codon 227709 227711 . + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_15 AUGUSTUS CDS 227709 228488 0.39 + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_15 AUGUSTUS stop_codon 228486 228488 . + 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKR # AISVDVYLHDPTMTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFM # GLSRDRGRRQQPRRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 Scaffold_15 AUGUSTUS gene 228539 232246 1 + . g254 Scaffold_15 AUGUSTUS transcript 228539 232246 1 + . g254.t1 Scaffold_15 AUGUSTUS start_codon 228539 228541 . + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_15 AUGUSTUS CDS 228539 232246 1 + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_15 AUGUSTUS stop_codon 232244 232246 . + 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP # INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 Scaffold_15 AUGUSTUS gene 235884 236672 0.71 + . g255 Scaffold_15 AUGUSTUS transcript 235884 236672 0.71 + . g255.t1 Scaffold_15 AUGUSTUS start_codon 235884 235886 . + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_15 AUGUSTUS CDS 235884 236672 0.71 + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_15 AUGUSTUS stop_codon 236670 236672 . + 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MSQSQSDFPKDQTIDPNSTVQTEGEYDLEPLKSLDIGHGIHRYVLNPKRDEIKKALTLLPTLRPFYKIANNQNIRQRR # DNALRIAAVGLKRAELSRLMPPPRKLFKSVFPKELSALDTLLFQHITGTPASGQFVSESAVESDPVQTVHTLDSQGYIQLNYALLQLQQAAKSSFRLT # GKRLPDLPYWGDFGKVGLEFYTENDFEIIAIAYRAQVEHFLTRLVDVHDFKTNELRNDSELAEEHIRLLEKLSKLPTRTFLFLWNQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 Scaffold_15 AUGUSTUS gene 239135 241115 0.55 + . g256 Scaffold_15 AUGUSTUS transcript 239135 241115 0.55 + . g256.t1 Scaffold_15 AUGUSTUS start_codon 239135 239137 . + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_15 AUGUSTUS CDS 239135 239241 0.63 + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_15 AUGUSTUS CDS 240197 241115 0.67 + 1 transcript_id "g256.t1"; gene_id "g256"; Scaffold_15 AUGUSTUS stop_codon 241113 241115 . + 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MVHSEAQISSKAQRNATEEDDPLAEEPLEEDRRRLSLLQKKTPWAWNEVHREAFDLCKQVLTNTPVCGYAQPGNPYRL # YTDACDYGLAGILQQVQPIRVRDLKGTRMYDRLLKAHQADESVPSLITRMSKDFDDVPTNSEWDSVFDDTIVYIEQVIGYWLRVLKSAERNYSATERE # ALALREALIKFQSYIEGEQILAVTDHVALTWSTTFQNVNRRLLTWGTVFAAYPDLHIIHCAGKVHSNVDPISRLRRRVPPQDSPDLEHITPIPIKPLE # EDPLHNMYEELGEQFEEKLLTVAANFAIVVINTMDILRAVLPSQMWAPMMTQFINRMLTQLQLLIIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # start gene g257 Scaffold_15 AUGUSTUS gene 242352 243476 0.48 - . g257 Scaffold_15 AUGUSTUS transcript 242352 243476 0.48 - . g257.t1 Scaffold_15 AUGUSTUS stop_codon 242352 242354 . - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_15 AUGUSTUS CDS 242352 243476 0.48 - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_15 AUGUSTUS start_codon 243474 243476 . - 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MIGELPESGGYNTISVFVDHFTKRLRLFAMHTMITSEGMARVYHDKVFPVHGMPRKIVHDRRPQYHARFMKELYKLLG # IESNYTTAYHPQTNGQTERINQEIEHYICLFVNHHQSDWHEWLPMMEFAYNDQVHSATKVSPFYADNGRHPYKGTTPEMTSQNPTAQEFANNMKRIRE # EVGSALKKAAEDMKRQYEKHRNAAIEYKAGDKVWLEGTNITTDRPMKKLGDKRFGPFKVLEKIGPSSYKLDIPRTWKRIHNVFNETHLSPYHEPQFPT # QPRNTEPPPEVVGEEEEYEVEEVVDSCKYRNGIQYKVKWKGYGPHEMTWEPAANMTNAKEAVQDFHKKYPNKPGLKSLNGSRFRLLSFPLNCSDQSLH # QT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 Scaffold_15 AUGUSTUS gene 245135 245443 0.96 - . g258 Scaffold_15 AUGUSTUS transcript 245135 245443 0.96 - . g258.t1 Scaffold_15 AUGUSTUS stop_codon 245135 245137 . - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_15 AUGUSTUS CDS 245135 245443 0.96 - 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_15 AUGUSTUS start_codon 245441 245443 . - 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MRYLPHYESPEDDGTEEKAFDGERIFWFDWDGYLSDQGHIKVQTATTDAAAPYLAEYADVFSKKDFDQMPERRPWDHA # IELMPGSKPVIVKSIPSAHRNRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 Scaffold_15 AUGUSTUS gene 245544 246044 0.87 - . g259 Scaffold_15 AUGUSTUS transcript 245544 246044 0.87 - . g259.t1 Scaffold_15 AUGUSTUS stop_codon 245544 245546 . - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_15 AUGUSTUS CDS 245544 246044 0.87 - 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_15 AUGUSTUS start_codon 246042 246044 . - 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MTTRAEEKPVRYEPNTPEWVAQRLQMDKLPMAIGILRAWMPESRVREASEETVLAIRNLSHATATEAVTNLKSRKRFV # RGTRGRELKLRTTIENIDNGVQIETEALLDSGATGSCINKDFVEQHQLTVKELPVKMPVYNADGTLNKNGSIEGYVQVRMVIGDHAEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 Scaffold_15 AUGUSTUS gene 246170 246601 0.83 - . g260 Scaffold_15 AUGUSTUS transcript 246170 246601 0.83 - . g260.t1 Scaffold_15 AUGUSTUS stop_codon 246170 246172 . - 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_15 AUGUSTUS CDS 246170 246601 0.83 - 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_15 AUGUSTUS start_codon 246599 246601 . - 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MSESRIDELKQKIISIDDMWWAVRKCDEIGQTDTSGMLGKDLVARDGNHKRHRLPTKAPTPAVPTQDRKDGTGTTFKG # AGRPMDIDAARRNKECFHCGKQGHIAKFCPEKAPKPQFVRGMWSRMTQEDQEAMAKELGFVLPQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 Scaffold_15 AUGUSTUS gene 246644 247117 0.94 - . g261 Scaffold_15 AUGUSTUS transcript 246644 247117 0.94 - . g261.t1 Scaffold_15 AUGUSTUS stop_codon 246644 246646 . - 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_15 AUGUSTUS CDS 246644 247117 0.94 - 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_15 AUGUSTUS start_codon 247115 247117 . - 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 Scaffold_15 AUGUSTUS gene 249792 250193 0.77 + . g262 Scaffold_15 AUGUSTUS transcript 249792 250193 0.77 + . g262.t1 Scaffold_15 AUGUSTUS start_codon 249792 249794 . + 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_15 AUGUSTUS CDS 249792 250193 0.77 + 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_15 AUGUSTUS stop_codon 250191 250193 . + 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MNGIKSVVGSFNMLVLFYVKWVREMIKISIFKGLGSEVNWGKYFGMTQEEFSIQVSWGTMQFGHSSLINKLTGDYEQD # LALILHPTHSSMALTWFLDPYDLTNSSINKFIPKAYITEEEEDSNIIANFIAESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 Scaffold_15 AUGUSTUS gene 261899 262297 0.89 + . g263 Scaffold_15 AUGUSTUS transcript 261899 262297 0.89 + . g263.t1 Scaffold_15 AUGUSTUS start_codon 261899 261901 . + 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_15 AUGUSTUS CDS 261899 262297 0.89 + 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_15 AUGUSTUS stop_codon 262295 262297 . + 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MARLPEPAMLTDYCQEVLHIDNRYWKCEETRKREAGKPFIAWNPKKGSSDFKAGPTNQQNNSQPSGSLAPFTPKPKPF # FGGKPNNGKPQNSLNSGQSGGQRPAFNHLGADGKVLPSERERRMKNDLCLFCDC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 Scaffold_15 AUGUSTUS gene 262663 263385 0.52 + . g264 Scaffold_15 AUGUSTUS transcript 262663 263385 0.52 + . g264.t1 Scaffold_15 AUGUSTUS start_codon 262663 262665 . + 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_15 AUGUSTUS CDS 262663 263385 0.52 + 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_15 AUGUSTUS stop_codon 263383 263385 . + 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MTKISPVNLHLFDGSLSFKLITDMANIAVRFPSGEQLLLPFYVTHLDPSCKAVLGYSFLSRYNPLIDWASRNIMFCNT # PHFDSPQTSVPSATNTVNVKVAVPLPEPLPLVSPTILETPPGDSPRSRSRTLRAKPLSSKFPFEPIYSYPMVSQFAAQLETPEVDIALVSPAVFNRAC # KDAGMEPILLRAIHSEVAAAPPTAPPPLLLSLHFIILFQKSMLSLQMSLTRLLQIPYLNTDLMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 Scaffold_15 AUGUSTUS gene 271379 272267 0.62 - . g265 Scaffold_15 AUGUSTUS transcript 271379 272267 0.62 - . g265.t1 Scaffold_15 AUGUSTUS stop_codon 271379 271381 . - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_15 AUGUSTUS CDS 271379 271802 0.62 - 1 transcript_id "g265.t1"; gene_id "g265"; Scaffold_15 AUGUSTUS CDS 271990 272267 0.84 - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_15 AUGUSTUS start_codon 272265 272267 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MADITVQFPSGELLLLPFYVTHLDPSCKAVLGDSFLSRYNPLNHWASPNIRNTSHSDSPQTSVPSVINTVDAKVSLTI # LETPPGDSPRSHSRISRGRAANCSSTTPTVPPLHHSIPEEYAEFADVFDKIAADSLSEHRPYDLKIDLEEGASLPLGRTYPLSEKELVALKDFINKQL # ATGAITPSSLPHSTPVLFVPKKDGKLRLCVDFCSLNRITKKDRYPLPLISDLLDTQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 Scaffold_15 AUGUSTUS gene 277688 278788 0.92 - . g266 Scaffold_15 AUGUSTUS transcript 277688 278788 0.92 - . g266.t1 Scaffold_15 AUGUSTUS stop_codon 277688 277690 . - 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_15 AUGUSTUS CDS 277688 278788 0.92 - 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_15 AUGUSTUS start_codon 278786 278788 . - 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAPSIYCSYDQDDWDLLLPMAEFVYNTP # NTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKWTG # PYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGQPEEVEYLVKWEGYNDEFNSWVGWEG # MVGSIELLRSWHKHHPRKRQPSRLQWASLEQEAREDEEEDREGEGSRGGNEDNEDTTGTTNPCLRLSTTTCIGGLTRPECTTISLLLIFHTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 Scaffold_15 AUGUSTUS gene 280710 281702 0.61 - . g267 Scaffold_15 AUGUSTUS transcript 280710 281702 0.61 - . g267.t1 Scaffold_15 AUGUSTUS stop_codon 280710 280712 . - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_15 AUGUSTUS CDS 280710 281702 0.61 - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_15 AUGUSTUS start_codon 281700 281702 . - 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPPYKGNPSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 Scaffold_15 AUGUSTUS gene 292811 293509 0.45 + . g268 Scaffold_15 AUGUSTUS transcript 292811 293509 0.45 + . g268.t1 Scaffold_15 AUGUSTUS start_codon 292811 292813 . + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_15 AUGUSTUS CDS 292811 293509 0.45 + 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_15 AUGUSTUS stop_codon 293507 293509 . + 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MRTVVELALEYLSQGRLTHGELHLRSTSSLLYYYSNAADRVDGLYQDMFTHSRFSTDAAFLTAAQHAGYVEARPDSLE # PPLHRQLFSFDHPIPLPQSPISDHIPAVPMMDSVMLMWEDMIRTYVREVLGYPASPDRASSPVDVPGSNDPLPTASPLVAPDAPPALDASESVSQDAP # LFLPESLSPTSPRPPSPIPSSSRVPHVPREIVDLTMDDAEDLYESQEEFLARTVGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 Scaffold_15 AUGUSTUS gene 295800 296363 0.84 + . g269 Scaffold_15 AUGUSTUS transcript 295800 296363 0.84 + . g269.t1 Scaffold_15 AUGUSTUS start_codon 295800 295802 . + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_15 AUGUSTUS CDS 295800 296363 0.84 + 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_15 AUGUSTUS stop_codon 296361 296363 . + 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRHTSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 Scaffold_15 AUGUSTUS gene 297015 299627 0.92 + . g270 Scaffold_15 AUGUSTUS transcript 297015 299627 0.92 + . g270.t1 Scaffold_15 AUGUSTUS start_codon 297015 297017 . + 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_15 AUGUSTUS CDS 297015 299627 0.92 + 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_15 AUGUSTUS stop_codon 299625 299627 . + 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEETMGWSTTEVEYTYQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVR # RSSDTHGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 Scaffold_15 AUGUSTUS gene 301306 301695 0.56 + . g271 Scaffold_15 AUGUSTUS transcript 301306 301695 0.56 + . g271.t1 Scaffold_15 AUGUSTUS start_codon 301306 301308 . + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_15 AUGUSTUS CDS 301306 301695 0.56 + 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_15 AUGUSTUS stop_codon 301693 301695 . + 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MLQYIHHITDTPLPGTDSQGPMSSVEPATESLPKVLVQQSPEAPAALESTSSVGLHPLVPLFLPEQESLTSPSPTLPP # LFGSVANLVIDLTGDDDELYETEEVSAGRFSMAREVIDSAPGQDVVKDESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 Scaffold_15 AUGUSTUS gene 301910 302875 0.86 - . g272 Scaffold_15 AUGUSTUS transcript 301910 302875 0.86 - . g272.t1 Scaffold_15 AUGUSTUS stop_codon 301910 301912 . - 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_15 AUGUSTUS CDS 301910 302875 0.86 - 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_15 AUGUSTUS start_codon 302873 302875 . - 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MPSDIVSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIRVANEVYAQYANQKRQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKW # TGPYSILAKIGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSKPKKGRPEEVEYLVKWEGYSEEFNSWVGW # EGMAGSLELLRSWHKKHPRKRQPSQRHWARLLKDAQEDEEDEREDRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 Scaffold_15 AUGUSTUS gene 305544 306147 0.76 - . g273 Scaffold_15 AUGUSTUS transcript 305544 306147 0.76 - . g273.t1 Scaffold_15 AUGUSTUS stop_codon 305544 305546 . - 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_15 AUGUSTUS CDS 305544 305873 0.94 - 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_15 AUGUSTUS CDS 306007 306039 0.76 - 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_15 AUGUSTUS CDS 306127 306147 0.84 - 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_15 AUGUSTUS start_codon 306145 306147 . - 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MRHPENLISCGWNNTQGGQPLCRKIVQPGAEGDTEELGRGVNGEEIHTGTLQSPPEAPQQPPDAPQPPPEVPQQTPEA # PLRAPRTRVKLEEVKDEEYEASQPGPHKLFPSDKDLGPDDPILMGINDG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 Scaffold_15 AUGUSTUS gene 309904 310626 0.85 - . g274 Scaffold_15 AUGUSTUS transcript 309904 310626 0.85 - . g274.t1 Scaffold_15 AUGUSTUS stop_codon 309904 309906 . - 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_15 AUGUSTUS CDS 309904 310626 0.85 - 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_15 AUGUSTUS start_codon 310624 310626 . - 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPYNPCPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 Scaffold_15 AUGUSTUS gene 318132 319516 0.35 - . g275 Scaffold_15 AUGUSTUS transcript 318132 319516 0.35 - . g275.t1 Scaffold_15 AUGUSTUS stop_codon 318132 318134 . - 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_15 AUGUSTUS CDS 318132 319115 0.39 - 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_15 AUGUSTUS CDS 319208 319516 0.35 - 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_15 AUGUSTUS start_codon 319514 319516 . - 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MATSKASTTDSLLDSLPSVTLAESRPRREGLRSSVKASGPDLQPRSSPSPTSEPASLIQTPIPIIPPDSPTSSDEDTM # SARLNESGNIELCHGKYGPRVKPGAIIADAFPARVHRDWFCAEKPTHLTMALEVKDPKDVDSPPTFPFLDALRRKFCGHDWAQIHSGRRDDLRMSVGG # VGSFDEYLSQVEGCNNRLKGVGNYLTPAQLLTILARGISSTLTAILSEQGIVIDETTKYKDWITSCRDLEVRFKTRLMSADRTGRRGNFPANNSSNNI # PPHKRTATSEPTGHPNKRSTADGTSSGTGPFYMRAFSKMPEAMQKEQRELLSRISACVKCRTAWGSCASNLDKCTGATLSVPWRPLTKEMVDWAIAAH # KSTGRPILYNAILKQANSHLFTLEPRTRFDSFGNRHFARKVQSKEKGDTRRKSLSYLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 Scaffold_15 AUGUSTUS gene 328820 329197 0.99 + . g276 Scaffold_15 AUGUSTUS transcript 328820 329197 0.99 + . g276.t1 Scaffold_15 AUGUSTUS start_codon 328820 328822 . + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_15 AUGUSTUS CDS 328820 329197 0.99 + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_15 AUGUSTUS stop_codon 329195 329197 . + 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MSSTNSVPSTTASTTTGNTSPTLTRDAHPSTTPSSTTAATTDSTDSTNSTTNSSSSESYPTQHHAGAVGYGPNYRQGP # SLTDKLSGLKEELKGKVTKNPQMVEHGKEMKTGEVKRREQQEDVSFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 Scaffold_15 AUGUSTUS gene 341651 342175 0.63 - . g277 Scaffold_15 AUGUSTUS transcript 341651 342175 0.63 - . g277.t1 Scaffold_15 AUGUSTUS stop_codon 341651 341653 . - 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_15 AUGUSTUS CDS 341651 342175 0.63 - 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_15 AUGUSTUS start_codon 342173 342175 . - 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MLDSEEWGFEEADIVLYCDACPTGMGFWFHYDDKTLGYQCMIPDDHEKPIFYFEVLTVVSAILHTIKLLFVHGVFVFT # DTTNTVDMFHSLKAKQLYNPLLLTMVDHAICSNIQFRVAHICGEENGIADALSWFDYTRLMRLAPSMNIYNFTPPHSCWGQNSYEFTASLLQTAGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 Scaffold_15 AUGUSTUS gene 350091 350615 0.98 - . g278 Scaffold_15 AUGUSTUS transcript 350091 350615 0.98 - . g278.t1 Scaffold_15 AUGUSTUS stop_codon 350091 350093 . - 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_15 AUGUSTUS CDS 350091 350615 0.98 - 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_15 AUGUSTUS start_codon 350613 350615 . - 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MDRLLREGTPAYFLHISPTKEESPTEEILRASGSNDPEGVQQPKDPENGNPSSEQGGVVKELDEEVSKRQETEELKKS # IPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVCLPRKRMVLYDSASTIEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 Scaffold_15 AUGUSTUS gene 362716 363543 0.92 - . g279 Scaffold_15 AUGUSTUS transcript 362716 363543 0.92 - . g279.t1 Scaffold_15 AUGUSTUS stop_codon 362716 362718 . - 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_15 AUGUSTUS CDS 362716 363543 0.92 - 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_15 AUGUSTUS start_codon 363541 363543 . - 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLAREFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPELPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFGVISQPGTLSYELKLPDYLRR # IHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRCAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPG # P] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 Scaffold_15 AUGUSTUS gene 366169 367677 0.79 - . g280 Scaffold_15 AUGUSTUS transcript 366169 367677 0.79 - . g280.t1 Scaffold_15 AUGUSTUS stop_codon 366169 366171 . - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_15 AUGUSTUS CDS 366169 366979 0.98 - 1 transcript_id "g280.t1"; gene_id "g280"; Scaffold_15 AUGUSTUS CDS 367355 367677 0.82 - 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_15 AUGUSTUS start_codon 367675 367677 . - 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPWSLRLGAGLLLELILQSPSHSPPYGKQPQRRAASESPRDPPPHFDLD # TGDHDDQDPPVDPDDPGADNNMTIWMTIRRGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRF # NTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSA # PFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVE # EESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 Scaffold_15 AUGUSTUS gene 373357 373635 0.62 - . g281 Scaffold_15 AUGUSTUS transcript 373357 373635 0.62 - . g281.t1 Scaffold_15 AUGUSTUS stop_codon 373357 373359 . - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_15 AUGUSTUS CDS 373357 373635 0.62 - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_15 AUGUSTUS start_codon 373633 373635 . - 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MVSQFTAQLETPEVDISLVSAAVLNRACKDAGMEPILLCAIHSEVAARAADCSSIAPTVPPLPHSIPAEYTEFADVFN # EIAADSLPETDLTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 Scaffold_15 AUGUSTUS gene 390384 390956 0.93 - . g282 Scaffold_15 AUGUSTUS transcript 390384 390956 0.93 - . g282.t1 Scaffold_15 AUGUSTUS stop_codon 390384 390386 . - 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_15 AUGUSTUS CDS 390384 390768 0.93 - 1 transcript_id "g282.t1"; gene_id "g282"; Scaffold_15 AUGUSTUS CDS 390835 390956 0.96 - 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_15 AUGUSTUS start_codon 390954 390956 . - 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MKLSSAFLLFALSITAWGQDTSSFTEATPSSSSALVTTESASSSVQTTSSFFSESTSISSFLPTSSSASSINGSSSSA # ILSTTESVVNGTTSATAILNSTSTGTFVSATNTPTSGLNASSAGTGSSANETGATSAASTSGNGANMAQAPMMMIVAVGGLIAAGVAGIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 Scaffold_15 AUGUSTUS gene 395606 397098 0.66 - . g283 Scaffold_15 AUGUSTUS transcript 395606 397098 0.66 - . g283.t1 Scaffold_15 AUGUSTUS stop_codon 395606 395608 . - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_15 AUGUSTUS CDS 395606 396314 1 - 1 transcript_id "g283.t1"; gene_id "g283"; Scaffold_15 AUGUSTUS CDS 396368 397098 0.66 - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_15 AUGUSTUS start_codon 397096 397098 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MSSARYLYAGRTGARDISPTPPMAAYTVLYPYARPKFAIASLSLGTNAHHDLPTKIRVASNLGYDGIEIFIPDFEGFV # NQVREGKHTELFTEPIPTSSSTELDLACAAAVYNLCNSFGLEIPLYQPLRNFENFRSQGHIDTSLAEAERWLRIMPAMKCDLLLVCSNYIPPPSPIGE # KYTMDMYIDAQVDAFRQLGALAEKYGVRIGYEPLSWGTVIDNWMQVWEIVERVDLENVGVLLDSFNTLGNQYADPGQASTICKGQTLAAMLFNLEELA # ISIPVEKIFFYQVADAVRPAEICYDDDDTPRRMKWSRACRVFPCEPQTPCPMEDTTSDPENPPSGYLGFLPVTQMTSLLHRMGYRGWWSLEVFNTSLQ # ESDNGCPERHGSRGINGLNILWDVVQTDMQSRSLDIELETFFDRKRATSSPTLSTPPLSTGSDASDSFTPSSDNEFELDLPEALHRIGGCGRPTLAID # IEGLKTKDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 Scaffold_15 AUGUSTUS gene 405231 405973 0.53 + . g284 Scaffold_15 AUGUSTUS transcript 405231 405973 0.53 + . g284.t1 Scaffold_15 AUGUSTUS start_codon 405231 405233 . + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_15 AUGUSTUS CDS 405231 405388 0.53 + 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_15 AUGUSTUS CDS 405457 405973 0.87 + 1 transcript_id "g284.t1"; gene_id "g284"; Scaffold_15 AUGUSTUS stop_codon 405971 405973 . + 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MVKFSILAGGYNTFIATYLFDSSAGTLDVSAKFPAGTNTSWITPHPTNSSIFYATNELSPMGALQSYTTTSDGVVSGP # HDTVPSGGSDPAFTVALSTGQVAIMNYDSGNGRIFPTDSTSLKFDNDSAPIITFPPPVGGVSHPHMAYEYEGEVIVPDLVRSYSHFWYCQSDQNLLIL # KGGDKLWRITRDDGPAHPGDWNITGLIPQPLGSGPRHMKIFGIISVFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 Scaffold_15 AUGUSTUS gene 415772 417742 0.29 - . g285 Scaffold_15 AUGUSTUS transcript 415772 417742 0.29 - . g285.t1 Scaffold_15 AUGUSTUS stop_codon 415772 415774 . - 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_15 AUGUSTUS CDS 415772 416019 0.91 - 2 transcript_id "g285.t1"; gene_id "g285"; Scaffold_15 AUGUSTUS CDS 416531 416857 0.5 - 2 transcript_id "g285.t1"; gene_id "g285"; Scaffold_15 AUGUSTUS CDS 417415 417742 0.48 - 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_15 AUGUSTUS start_codon 417740 417742 . - 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MNLPSLSTDYVPNATAIDSASASNTFVATPVPLDVTPDDESDDKFHGEVRTYLDYTSEILSAQAEEVKLLRREVASVR # EENAVSRNDTQLQVPLMIYYYIGPENAIRSRLNCGEACSSATFTNKTSMDHPMDDAPAIHESELPPAANDSEVPTAIPRTRRRLMPRQTMNDTPGNDD # LETLSAISSNRRRKLSSSSDDDDESSSQVEDVREKPQKVTDVNRLKEELEELKGIHSSAKAEAIDEAHKRDEEIARLQKEFEDHRKAASQDSVANDPE # VESLTTKLSTAESEIKEKTVSHAQKM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 Scaffold_15 AUGUSTUS gene 428209 428550 0.32 + . g286 Scaffold_15 AUGUSTUS transcript 428209 428550 0.32 + . g286.t1 Scaffold_15 AUGUSTUS start_codon 428209 428211 . + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_15 AUGUSTUS CDS 428209 428550 0.32 + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_15 AUGUSTUS stop_codon 428548 428550 . + 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MHPATPVSNSAISSTTSSLSNTILNESASAASTITSSAKTPIDIDSIHEFPMIPSGREEYLKRQGGTDELVKGLDNLH # AASESIFKAQKDEILLRKHQINVLKEQCRVSEWRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 Scaffold_15 AUGUSTUS gene 433436 433822 1 + . g287 Scaffold_15 AUGUSTUS transcript 433436 433822 1 + . g287.t1 Scaffold_15 AUGUSTUS start_codon 433436 433438 . + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_15 AUGUSTUS CDS 433436 433822 1 + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_15 AUGUSTUS stop_codon 433820 433822 . + 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MPPCSNTTPESSVTEVAHTRIPAIEIDDQNSIPGYLAALNANLDPSFPVDMTVFESFFLPQLDHQSKGKVISILAKAF # VDLQSVGSEDVILKPMNRNKGHVQKYMVALVGVGSALLGAVAMFLVLAFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 Scaffold_15 AUGUSTUS gene 438263 438763 0.98 - . g288 Scaffold_15 AUGUSTUS transcript 438263 438763 0.98 - . g288.t1 Scaffold_15 AUGUSTUS stop_codon 438263 438265 . - 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_15 AUGUSTUS CDS 438263 438763 0.98 - 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_15 AUGUSTUS start_codon 438761 438763 . - 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MVFEAFHYLNVALGPQYLDLLQKWMDYERKNNWLNPHKLAGFSPENRPSVLLAWMKNRPRPLPKVDKRGFFTPEFVQE # VWAWWANLQPDWRSLDENGLPMPFEEFGDDCRRSTSMAETRGLAYLLASNVGKVGLGYHIADDNEAPVNEWLAIIADMTRMLDRLVAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 Scaffold_15 AUGUSTUS gene 441777 443432 0.64 - . g289 Scaffold_15 AUGUSTUS transcript 441777 443432 0.64 - . g289.t1 Scaffold_15 AUGUSTUS stop_codon 441777 441779 . - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_15 AUGUSTUS CDS 441777 443432 0.64 - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_15 AUGUSTUS start_codon 443430 443432 . - 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MSYGLLQPEGTTDLQSKTLSDIPEDIRQLERKFNLDVETTVYAVCPQCSYTHPPIFSDDSPKPTYPSKCTHRPMALAE # PCSESLLLDTGHPIKTFEVYSFLNWFGRFIALPGIAQYSDAFCAQISDEQPPEDKESAYDGRFYFELRGPDGKFFVREREKEGRWFFKLHADFFNIEG # NLHGGKHNSTGIMSMSCLNLPLAIREDQAYVYVPGVIQGPREPDARAGAYNHYLRPIVDEMLVAYTRGIQCASSDNQETPYERTHRVVLANISMDAKA # SHPFAGLIDIGSHTYCATCQTWHKAYLNSVDYEDWEAIDDEYLREGAEKWRDAESRAERERIEHLYGVRFSEFWRLPYYSPSKQVSIDPMHALKNIFG # NFFCDALRLDNPRSTREPKNKNTTPVSSIAHYYQFTPPPPLSLVNSVPIMPIDTAEEDLVTAVLEWEHLSNDLQHFRHQRMSNLLVEIDTYKRELIEI # HHLLSSLRPSTDLLQAQLRSRLKSKKWGVLLYVCNDLMVFPIQISGGIVRKELITKSDITKDDMIEALVEWVAIGWVSILT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 Scaffold_15 AUGUSTUS gene 444027 444620 0.45 - . g290 Scaffold_15 AUGUSTUS transcript 444027 444620 0.45 - . g290.t1 Scaffold_15 AUGUSTUS stop_codon 444027 444029 . - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_15 AUGUSTUS CDS 444027 444620 0.45 - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_15 AUGUSTUS start_codon 444618 444620 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MEKRRQMPPANTRTSPNPADTDPGPACPSPAAPSVTPRPDTFHSIDSEPSVFSTPSAKRVQSRNGQRLAFRNFLQQNS # SNDGSFDSGASTSSTIQVASAYPDSGTADGCVNRQNDSEIDLPGPGVDHESSSISVPTSVNVLNSTSQNSLSHSTTDRSNFGLSVMAQVILNRDSLEF # TPLDPSALETIVETVQATVRD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 Scaffold_15 AUGUSTUS gene 451010 451764 0.13 + . g291 Scaffold_15 AUGUSTUS transcript 451010 451764 0.13 + . g291.t1 Scaffold_15 AUGUSTUS start_codon 451010 451012 . + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_15 AUGUSTUS CDS 451010 451325 0.13 + 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_15 AUGUSTUS CDS 451421 451764 0.84 + 2 transcript_id "g291.t1"; gene_id "g291"; Scaffold_15 AUGUSTUS stop_codon 451762 451764 . + 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MSYANGAQMPKGTTSMDSFVDFDFNNGEQRPPNHRKGFSSPLNLFRNRKKSTGDSRENSPAKKLSTVRSADSLNTLDH # NSFKVSRSRALPPLPQSEPTSASHIASTPLRMSPQPDEWSTNLDTSKAQVASNSSYEGLPNHHDQISSLPLHATHGLPIIYPQQRQPLNTFDAALQEN # GQSVIDESSMLDRNVAPALFVAEGLKTDTPHPHHKHSIEVMSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 Scaffold_15 AUGUSTUS gene 452651 452968 0.81 + . g292 Scaffold_15 AUGUSTUS transcript 452651 452968 0.81 + . g292.t1 Scaffold_15 AUGUSTUS start_codon 452651 452653 . + 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_15 AUGUSTUS CDS 452651 452968 0.81 + 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_15 AUGUSTUS stop_codon 452966 452968 . + 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MKSGAYKIQITDFIDTFKDFQNQLQQLLTQVSALTINTVNEKTDALNQKLDVVIAAINSLTPAESRVQAKIDDFGGEE # KAFQASQIFFYHILIKFFIICLRAPAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 Scaffold_15 AUGUSTUS gene 455616 456443 0.6 - . g293 Scaffold_15 AUGUSTUS transcript 455616 456443 0.6 - . g293.t1 Scaffold_15 AUGUSTUS stop_codon 455616 455618 . - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_15 AUGUSTUS CDS 455616 456443 0.6 - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_15 AUGUSTUS start_codon 456441 456443 . - 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MQSSLNENTFSLYYRLRCKSTQERRKTLQQLKEVDQMREMFQKALGLEGSALPEFAPSIASRGPEIQRWTEMFAWTWI # RAAHRALSHNYGSKQFDYEDTALLIRCKSRPKSETAGNPALFADVESAEFVSFSGLPRPKWDGIFNSMKVMASKRKRAEQISRASLGNSHRGVLWMIF # LFDNAVPLLDVHSVSISPSQIFEKKLDHSDWIEELQKFAHNGWIMRRTSDRNDANSAVGTLSKRGTTWHWTKLSASECQKHQLAKEYRSVFQGDYLKR # R] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 Scaffold_15 AUGUSTUS gene 460662 463031 0.86 + . g294 Scaffold_15 AUGUSTUS transcript 460662 463031 0.86 + . g294.t1 Scaffold_15 AUGUSTUS start_codon 460662 460664 . + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_15 AUGUSTUS CDS 460662 463031 0.86 + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_15 AUGUSTUS stop_codon 463029 463031 . + 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MLSETDSTSSDEDLGREISVTFFPALFLQRRIWVLDILRRENVSDVRFFSMIFIVSQVSRTVMQVLDIGCGEGQLLSV # LSVPSPWLPAPPQFMLYPNSQPKEPIASPLNLYNTSSDPIPNLHITRLVGLDISSRDLEFAAQAIAPPANAENTEDSSIDPWRYRGSKDTVRWEEMTA # KLWEGGLETINEEFVGTECIVSSEVYVSQFYFNLHILIDLLESNTFHLPSYLFSPQSFSVSTNPNSYSSQHHHIPSTPYSLLPTLTHLSVFAQATPIP # LAELTEFSDTMTTNLNGLQRNSMNTAKGGGRMGYTVDVSDIGRAQDADEWKRYRGGWGVIGGDIYEKHVVDRDAIEEKARAVVQGMLPQLQQSSPSPL # TTPPQSPKLFSPIAHRLLTTFIHPAHASAYQPLPLHSIGDIVKSRMEDLRESFLRVEELWYEPEVAQACGGWIELLIAAVEQYDGSVIKLVKDADSPE # ERRSAQGFLLHSPIDPPVSSPEPHLSSSSSTSTSSSSLSSSPPTPNSLDPPKINRTIQRERDLWKICLVNAQNHPRPLWPTTEILINEEGVGDKSVEY # MSSDWNPEEEYAFEYGNVSGYSKDVEKEEEEDDQDEEEHSIDSSAITEDDENFDFSRIDFARTVSGEGTSAEWSLDEEEKEDVNPVNYSTNTEDDSVT # WGESDITTTSATWGHTIGDWGEAMDSSTDWGEGTKSDWGGGSVEDGEKVAASMTTVEPVDSDWEVRGQDFETPMVDMNPEKLNVQRNILKRGRSSSMP # LTPSSHNSLTGWEVDGDVDDTDGAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 Scaffold_15 AUGUSTUS gene 465217 466149 0.99 + . g295 Scaffold_15 AUGUSTUS transcript 465217 466149 0.99 + . g295.t1 Scaffold_15 AUGUSTUS start_codon 465217 465219 . + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_15 AUGUSTUS CDS 465217 466149 0.99 + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_15 AUGUSTUS stop_codon 466147 466149 . + 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MFIGERCQNKVILFPSKIIIFQHVGRVDDLLFFDSQPSGELPLNVPGNQDDTIDKLESYFTWSYLPIQAEDGKVGGIL # NKCALSINLYLRQITYPLRSLSCMETTEKVLSERRMSTVRIFAELTASIRTTVEFWQAVADSLALNEHDFPYFLCYSATNTVHSDFNSDSAETISNVS # CDTRSEYSSSGSSIASVHNVRLDLVKFCGVQPGHPAAPSQVEFNSMTILEPNQSWPFSKACFGRTSIRAKNPHPEGFQARGWGDEPGDAILIPIHGTD # DMLVGLVLFGLNTRCDALYHKFLSLINPPYAFQETL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 Scaffold_15 AUGUSTUS gene 471554 473731 1 + . g296 Scaffold_15 AUGUSTUS transcript 471554 473731 1 + . g296.t1 Scaffold_15 AUGUSTUS start_codon 471554 471556 . + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_15 AUGUSTUS CDS 471554 473731 1 + 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_15 AUGUSTUS stop_codon 473729 473731 . + 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MSSSTGNQTATLPTFPESSQLSGQDTWKAFKDRVELNVEFRGLKGYLHGTIPKPSPATYIYTSITPSFPSSLHPSPEE # WNQRERLVAAMIYLNCTDPIGVGIDQDNLAHVTYAFLINKYESRDEELILLADTALREQKYDPTTTTMEDHEKKMNNLLKRLRNLGGAVDDFQYRLII # IKSMPKEWKENVLNVPGRTSSEAFTYLKHLYINKVELVDDEDQRIQKKVAALVAQHIAAHPVVASAVQCRNRPVCTNPSCPRKLGHSIENCWAKGGGG # EGNAPKSWKDKYENRTAAPSSTTASSATILTDPDPADLYIHTNHVNVSTKPGMSIHPTSTTLSPDDSNRPERTTVLNCKSQKRESVSVSDNVPSYALV # SNPIECTVCNGNIPLYSPPEPTEPETFLDSAASEHCWVKWLDFIRYETVSGQSGNSAIAGDSGRFRIPGIGDVNVPTLVDGLECNVKLKGVKHTPEFA # HNLISVSTLDREGYNGEWGERKLTVRTSSGKVVMVGIQAGNSKMYRVDRKIYANSAKSHEKPTNIHTWHRRFGHVGVARILRMAHQKLVDGLQVTSKE # TRGMCEPCLYGKATRRPFDEILTHETKVLERVHIDLWGPSRTQSRGGANYMMLCSDGASSIRVPYFISNKRAETTLKHFHEFRIMAENQTGERLRMIR # IDGGGELNNKLMQSYCKEHGIVVEKIPPYSSAANGMAERANRTVIEGTRTLLEDSGLPP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 Scaffold_15 AUGUSTUS gene 474299 476569 0.07 + . g297 Scaffold_15 AUGUSTUS transcript 474299 476569 0.07 + . g297.t1 Scaffold_15 AUGUSTUS start_codon 474299 474301 . + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_15 AUGUSTUS CDS 474299 474952 0.1 + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_15 AUGUSTUS CDS 476125 476160 0.52 + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_15 AUGUSTUS CDS 476252 476569 0.73 + 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_15 AUGUSTUS stop_codon 476567 476569 . + 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MNIDQLVWKEMGWNRPDTAFTLVAHEPWAFASTHDERWTPRNFKEAKLRWDLWGPPAQAEYDALMEKGVWELVPLPQG # ANLMDAMWIFTSKWGSQGELLKRKARYVAKGYTQVYGMDYDETFGAVARMESFRIVLAIIVVLGLSLFQVDFKSAFLNSPIKHNVYMKQPEGFVEPGT # EHLVCKLKKSIYGTMQGSHDWQETLAAGYKEDGYTSSQADPCLSLSCYLLSQLRLLSTITTEVFVTLHTRGKDPQLSQGPAHEKDDLHHNDPQSQSAH # AGKLQKNSNSPLDAASSKGSSQQKAQGGSGNPESIGMIDQVGSQSGTAKITEKGDGEEKAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 Scaffold_15 AUGUSTUS gene 481192 481686 0.76 + . g298 Scaffold_15 AUGUSTUS transcript 481192 481686 0.76 + . g298.t1 Scaffold_15 AUGUSTUS start_codon 481192 481194 . + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_15 AUGUSTUS CDS 481192 481686 0.76 + 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_15 AUGUSTUS stop_codon 481684 481686 . + 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MSAAVSLRSVLAATNRDFESYTHNALLPLALPPLTVQQVSSMSLYEFALIHRKAIEDMRNIPYIQGYEKWVPSIGGAA # IPARRKGTDSWLLSNQVVGGVDKLDLGSEPLGFWHWMLPFMPDHVFTVNKLRGGYILDGFSGVRPQRLKAIEKALEGIRRGEPLVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 Scaffold_15 AUGUSTUS gene 485305 485493 0.62 + . g299 Scaffold_15 AUGUSTUS transcript 485305 485493 0.62 + . g299.t1 Scaffold_15 AUGUSTUS start_codon 485305 485307 . + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_15 AUGUSTUS CDS 485305 485493 0.62 + 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_15 AUGUSTUS stop_codon 485491 485493 . + 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MEKAKDLAELGTTAAGTAGAVASTYKGIKGDGGATPAPDGSPTGGVGDASNGPTVPAAGKTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 Scaffold_15 AUGUSTUS gene 495789 497948 0.25 - . g300 Scaffold_15 AUGUSTUS transcript 495789 497948 0.25 - . g300.t1 Scaffold_15 AUGUSTUS stop_codon 495789 495791 . - 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_15 AUGUSTUS CDS 495789 496856 0.36 - 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_15 AUGUSTUS CDS 497022 497140 0.82 - 2 transcript_id "g300.t1"; gene_id "g300"; Scaffold_15 AUGUSTUS CDS 497795 497948 0.57 - 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_15 AUGUSTUS start_codon 497946 497948 . - 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MFGGILESWNQYGPNKDMKIQIKWYLTECRSFLAVPNVYCIKLIVLCDSISXASRRALQDVAADRLEYSRVLAQFRAI # EAELPEAPLEVGVKRSFEAHEELDAANARAIRMRDRLEDLEETVHRYRARAHVAEELIRKYPEDEGLYEVDLPSLSSLQNQLTASEAMVRRLATFAHR # LYSADPANLLHHHNTYVGGLIEAIIALLSRSLLHPPERMRTVVELALEYLSQGRLTHGELHLRSTSSLLYYYSNAADRVDGLYQDMFTHSRFSTDAAF # LTAAQHAGYVEARPDSLEPPLHRQLFSFDHPIPLPQSPISDHIPAVPMMDSVMLMWEDMIRTYVREVLGYPASPDRASSPVDVPGSNDPLPTASPLVA # PDAPPALDASESVSQDAPLFLPESLSPTSPRPPSPIPSSSRVPHVPREIVDLTMDDAEDLYESQEEFLARTVGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 Scaffold_15 AUGUSTUS gene 504611 506382 0.28 - . g301 Scaffold_15 AUGUSTUS transcript 504611 506382 0.28 - . g301.t1 Scaffold_15 AUGUSTUS stop_codon 504611 504613 . - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_15 AUGUSTUS CDS 504611 505518 0.91 - 2 transcript_id "g301.t1"; gene_id "g301"; Scaffold_15 AUGUSTUS CDS 505719 506382 0.3 - 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_15 AUGUSTUS start_codon 506380 506382 . - 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP # RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA # PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLRAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALEN # EGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPD # VPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASH # LTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 Scaffold_15 AUGUSTUS gene 507347 507976 0.94 - . g302 Scaffold_15 AUGUSTUS transcript 507347 507976 0.94 - . g302.t1 Scaffold_15 AUGUSTUS stop_codon 507347 507349 . - 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_15 AUGUSTUS CDS 507347 507976 0.94 - 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_15 AUGUSTUS start_codon 507974 507976 . - 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 Scaffold_15 AUGUSTUS gene 516545 516886 0.64 - . g303 Scaffold_15 AUGUSTUS transcript 516545 516886 0.64 - . g303.t1 Scaffold_15 AUGUSTUS stop_codon 516545 516547 . - 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_15 AUGUSTUS CDS 516545 516886 0.64 - 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_15 AUGUSTUS start_codon 516884 516886 . - 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MDVSCNGWSFLYQGPDISTNKRKETILTAIHNWRMMAERQTDLNVLIFRIDGGGEFDNGWFRDYCLENGIAIEMIPPR # SSSPNGVAERANRTFLVDAGFPPQCGLKQHLPSAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 Scaffold_15 AUGUSTUS gene 536457 536840 0.5 - . g304 Scaffold_15 AUGUSTUS transcript 536457 536840 0.5 - . g304.t1 Scaffold_15 AUGUSTUS stop_codon 536457 536459 . - 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_15 AUGUSTUS CDS 536457 536840 0.5 - 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_15 AUGUSTUS start_codon 536838 536840 . - 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MVEFETDNGIANNKVKMEFDGVLLPLPYRKRVKLESESALYVLRVNDSCMKEVLTATVFMPPTPKILQSNSSDPGDTE # SESEESKEMVVIKAEQNDDDVTFVSKATDLEYLVGEFSIFSVYFPHIVH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 Scaffold_15 AUGUSTUS gene 544692 548059 0.65 + . g305 Scaffold_15 AUGUSTUS transcript 544692 548059 0.65 + . g305.t1 Scaffold_15 AUGUSTUS start_codon 544692 544694 . + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_15 AUGUSTUS CDS 544692 546063 0.7 + 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_15 AUGUSTUS CDS 546159 546263 0.87 + 2 transcript_id "g305.t1"; gene_id "g305"; Scaffold_15 AUGUSTUS CDS 546390 548059 0.86 + 2 transcript_id "g305.t1"; gene_id "g305"; Scaffold_15 AUGUSTUS stop_codon 548057 548059 . + 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRLPPWVTPNLPVVPWEVSHTPLPGEREDLPLDRYRQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVREPPSRVNIPTTYRTGIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRDPTSDATSGIRH # SDAVGGTFWIESRKSFGIPSQTETFIAQEYEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPPRVNLQTKPLTPVSTQRYQFGEVRMDGAQHSS # RISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGAPFGTPFVTGAQMNRPGMAFESARSQESVAMI # QQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGARDGNPQVEQAGQIPD # TPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGP # GDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGD # DRSAWKTWVLSLERMFGRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTVSKTGQNSNESSVPNSDPSTRRTRQGGGWPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 Scaffold_15 AUGUSTUS gene 577351 578172 0.88 + . g306 Scaffold_15 AUGUSTUS transcript 577351 578172 0.88 + . g306.t1 Scaffold_15 AUGUSTUS start_codon 577351 577353 . + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_15 AUGUSTUS CDS 577351 578172 0.88 + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_15 AUGUSTUS stop_codon 578170 578172 . + 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MKKNKELFFFFTIVNSTLFRSQLGSGILPLITPTSQLLAVDTQPTTAVNIAFSQRGLNALGITDDLGDTAFTNGQIDN # VATILGDETSNWEPAFAGTGIHGVFLLASDTIDNVNATLSQVQNILNGSITEAYSLQGQARPGDEQGHERKMKFVSFIYFFHQIKHFLSPLLHFETDF # GFMDGISNPAVTGFSTPLPGQQVLDPGLFLLGESGDLVSRPSWAKDGSFLAFRQLQQRVPEFNAFLVDNALSNPNLTADQNAELLGARMMGRWKSVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 Scaffold_15 AUGUSTUS gene 579864 580469 0.15 - . g307 Scaffold_15 AUGUSTUS transcript 579864 580469 0.15 - . g307.t1 Scaffold_15 AUGUSTUS stop_codon 579864 579866 . - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_15 AUGUSTUS CDS 579864 580151 0.57 - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_15 AUGUSTUS CDS 580239 580469 0.17 - 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_15 AUGUSTUS start_codon 580467 580469 . - 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MCELIVEDLCESSVLTGALPFVPTGFNIHSNGIGSTTPFQAISLRYFNPAGAHPSGYIGEHPRGRPENLLPLLAHMAV # FGKDYPTPDGTCVRDYLHILDLAAGHVIALQALEEGSELNNRVFASTTETGKGSKGRFKAYNLGKGHGMSVMQIVGAMREATEFDFKTEVVGRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 Scaffold_15 AUGUSTUS gene 583301 583753 0.89 - . g308 Scaffold_15 AUGUSTUS transcript 583301 583753 0.89 - . g308.t1 Scaffold_15 AUGUSTUS stop_codon 583301 583303 . - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_15 AUGUSTUS CDS 583301 583753 0.89 - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_15 AUGUSTUS start_codon 583751 583753 . - 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MTKKATVSSVDADADQNMEEHHPVTDALPSNGEDDDDIMIDDDENSASLPKVSAAPAFAPVSADALQTTLKSETRRIP # IPPHRMTPLKKDWINIFGPLTEILGLQVRMNVQRRTVEARVRFSFKASYWGINSQSLDFQTHKRYRCFAERC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 Scaffold_15 AUGUSTUS gene 589785 591659 0.25 - . g309 Scaffold_15 AUGUSTUS transcript 589785 591659 0.25 - . g309.t1 Scaffold_15 AUGUSTUS stop_codon 589785 589787 . - 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_15 AUGUSTUS CDS 589785 591037 0.44 - 2 transcript_id "g309.t1"; gene_id "g309"; Scaffold_15 AUGUSTUS CDS 591107 591659 0.37 - 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_15 AUGUSTUS start_codon 591657 591659 . - 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MFQVCDILLRGTDCYMVYFQNVNPGLSRRFAIDDPFKFDDFTEDELMEVLDMKLRESDLEASDDAKTVARECLGRARN # RPNFGNGGDVENLINKAKMRYQSRQASLPLHQRSADIILQPTDFDPEHDRQNHASANMAKLFEDLVGCDDIVQKLGKYQETAANYKRFGKDARTNIPT # CFVFKGPPGKTTVARKMGQVFYDMGFLSSKEVIECSASDLVGQYVGHTGPKVQKKFQQALGRVLFIDEAYRLGEGHFAHEAVDEVVGLLTKEEFMSKL # VVILAGYDDDMNRLMAVNTGLSSRFPETIVFKNMGHTHCLEVLNKALRAEDVVIEESSRIYLEMASILDQISALPGWGNVRDVMTLAKQMIREAYSDH # GTSLPLRLPNDRAIAVMKDMLAERQKRSASRLSPTKMSAAQNDSPSLSPLPFTPSISTSTAPPSAKPEIVPGHKIIQDPVTNTKRDLGVSDSIWHQLQ # IDQRVAGERAKQIILLEHKAKEAKEQEAKEAAQAALLIKQAKTNAHDAAKLMEFKRQQEEMRLRALKVQTERRKLEDELEARKEEEKKEARAQQKLRT # LGLCVAGFRWIKQDGGYRCAGGAHFVDNAALGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 Scaffold_15 AUGUSTUS gene 591965 593915 0.3 - . g310 Scaffold_15 AUGUSTUS transcript 591965 593915 0.3 - . g310.t1 Scaffold_15 AUGUSTUS stop_codon 591965 591967 . - 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_15 AUGUSTUS CDS 591965 592905 1 - 2 transcript_id "g310.t1"; gene_id "g310"; Scaffold_15 AUGUSTUS CDS 593760 593791 0.3 - 1 transcript_id "g310.t1"; gene_id "g310"; Scaffold_15 AUGUSTUS CDS 593863 593915 0.35 - 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_15 AUGUSTUS start_codon 593913 593915 . - 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MSLLREAIDFDMKTPDGGGTMLKCGLHCSRIYAQFLSSVGILPGNEFIETTGSRIANDGVPGIKAHIEAVLNAGGGAI # FIDEAYQLVSESSIQGSQVLDFILAEMENNIGKLVFILAGYNKQMEKFFEHNPGLSSRVPYNLNFKDYTDGELLKMLRRLIEKKYQGKMEVEGGLEGL # YARIVAQRLGRGRNRAGFGNARALENVFNKVLERQARRINEQRKNGARPNDFLLVREDLIGPEPSGALERSTAWTKLQKLIGLSSVKETAHNLIDMLR # TNYLRELKESKPIEVSLNRVFTGSPGTGKTTVAKLYGQVLADLGLLSNGEGNNSSCLNNFSLTLYAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 Scaffold_15 AUGUSTUS gene 598882 600135 0.98 + . g311 Scaffold_15 AUGUSTUS transcript 598882 600135 0.98 + . g311.t1 Scaffold_15 AUGUSTUS start_codon 598882 598884 . + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_15 AUGUSTUS CDS 598882 600135 0.98 + 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_15 AUGUSTUS stop_codon 600133 600135 . + 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MKLQVVERAPGDGSTSFQSISLAENKQPSTSKIQILDSSAGDSDDESDMDSNTLSDDDNVPQNSDTEHSDAESGSLDL # DEETDWDFAQHQREIALEYHQKRGKIGKETAAALTSHTHEPYEDPSFPELASNKPKSSSSMSQFRANRLASSYAVANTDATSSVPSPLGSSTLPTLLP # AGAAQTLQHAVRLGKLDEQKRLVGGDAGDSGSEPDDEVAREILELLQKGEVYNLGPNGEDIYVVPPNTITSGSGDSTKQSTRAQPPRSDPLPPFTPPI # EPLPQKPKTSRFKLAKTQSDRLPSPSTSVDLSGSSTPVSNARRSSPKLAMESSVVERAVPQLSTSKRSESPSADYTNVPKPPIFNSMVIESPSFPRSA # ESQRRPERPPTIMSSHVVESSSRRNDNPTMDEVPKRVSRFRAERM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 Scaffold_15 AUGUSTUS gene 600391 600717 0.7 - . g312 Scaffold_15 AUGUSTUS transcript 600391 600717 0.7 - . g312.t1 Scaffold_15 AUGUSTUS stop_codon 600391 600393 . - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_15 AUGUSTUS CDS 600391 600717 0.7 - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_15 AUGUSTUS start_codon 600715 600717 . - 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MLTYPYHNDKLIPEYDILREKALAGAGSLHGNQPGDPVKAVELVVDVVRGEGKAKGRKFPRYLPLGSNAGQAIKEKTD # MMKSVLEEWGDVIGSELDYETVGGTKMWFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 Scaffold_15 AUGUSTUS gene 602474 603229 0.73 + . g313 Scaffold_15 AUGUSTUS transcript 602474 603229 0.73 + . g313.t1 Scaffold_15 AUGUSTUS start_codon 602474 602476 . + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_15 AUGUSTUS CDS 602474 603229 0.73 + 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_15 AUGUSTUS stop_codon 603227 603229 . + 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MTLTSLDVVVSGSSESQTDHTAFAGSAESNALCVEPIIHIERSEELRAQARDKNLSLSKLTEQLASIDLCPRSLKVPS # SCSSLPPQLPPLPLFLMPPDLTTFKVDPLIIRVNELKHWLKAFKESPTFTSTSNSDRPGAVAPLTVDSAFLSATGLAPSSGTFQSSLSLGHNYGYSTP # AEETAIAESDYGFASVSLEDTTQNRFPDSGTTHVGDSTEDDKYKVEAMYVQLKSIENRMKIISHKKHARGKLHLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 Scaffold_15 AUGUSTUS gene 614497 614825 0.5 + . g314 Scaffold_15 AUGUSTUS transcript 614497 614825 0.5 + . g314.t1 Scaffold_15 AUGUSTUS start_codon 614497 614499 . + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_15 AUGUSTUS CDS 614497 614499 0.5 + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_15 AUGUSTUS CDS 614574 614825 0.82 + 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_15 AUGUSTUS stop_codon 614823 614825 . + 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MFSGYAILPGERPSVEDRRLYYPPHVENLAATLTSLFAPRIDHRAAQYSPRYRLSFTLLNEDGSAGQVITSWDIQQAF # ARESKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 Scaffold_15 AUGUSTUS gene 620468 620749 0.61 + . g315 Scaffold_15 AUGUSTUS transcript 620468 620749 0.61 + . g315.t1 Scaffold_15 AUGUSTUS start_codon 620468 620470 . + 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_15 AUGUSTUS CDS 620468 620749 0.61 + 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_15 AUGUSTUS stop_codon 620747 620749 . + 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MSAYGNLHIALEQMRVKALANMHGSPVPESVHLAQSKPQAEISAEPPRVLILGPENSGKTSICKILVNYAVRAGQGWA # PILANVDPNEVKATS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 Scaffold_15 AUGUSTUS gene 622678 623645 0.22 - . g316 Scaffold_15 AUGUSTUS transcript 622678 623645 0.22 - . g316.t1 Scaffold_15 AUGUSTUS stop_codon 622678 622680 . - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_15 AUGUSTUS CDS 622678 622887 0.31 - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_15 AUGUSTUS CDS 622994 623121 0.26 - 2 transcript_id "g316.t1"; gene_id "g316"; Scaffold_15 AUGUSTUS CDS 623180 623509 0.96 - 2 transcript_id "g316.t1"; gene_id "g316"; Scaffold_15 AUGUSTUS CDS 623627 623645 0.98 - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_15 AUGUSTUS start_codon 623643 623645 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MSGTSFFSISVVATLETIPTSTQRLWRTATIFSREQAIDPVVALERLKAQDETAKKDRKGKGKALFFLASDSGSSESS # NELEPESPAALSSTQKLKRKRSSVDDEALEERNSKRPKTKEYIEISDLDENSAKVRFTDSEDEEESSEGVNDHGTVHFSFGALRKLKVKLFDSGKSET # RELISYVVSLKDESRRSSSSSGSSTASSEQDAGKDRVDEDDDEEEDSWDNWT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 Scaffold_15 AUGUSTUS gene 627912 629437 0.59 + . g317 Scaffold_15 AUGUSTUS transcript 627912 629437 0.59 + . g317.t1 Scaffold_15 AUGUSTUS start_codon 627912 627914 . + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_15 AUGUSTUS CDS 627912 628522 0.61 + 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_15 AUGUSTUS CDS 628633 629437 0.98 + 1 transcript_id "g317.t1"; gene_id "g317"; Scaffold_15 AUGUSTUS stop_codon 629435 629437 . + 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPLRLTNRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIR # AVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDS # KRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGK # K] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 Scaffold_15 AUGUSTUS gene 629787 630238 0.25 + . g318 Scaffold_15 AUGUSTUS transcript 629787 630238 0.25 + . g318.t1 Scaffold_15 AUGUSTUS start_codon 629787 629789 . + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_15 AUGUSTUS CDS 629787 629813 0.27 + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_15 AUGUSTUS CDS 629858 630238 0.37 + 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_15 AUGUSTUS stop_codon 630236 630238 . + 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MIMFNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTK # TNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 Scaffold_15 AUGUSTUS gene 630520 630897 0.89 + . g319 Scaffold_15 AUGUSTUS transcript 630520 630897 0.89 + . g319.t1 Scaffold_15 AUGUSTUS start_codon 630520 630522 . + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_15 AUGUSTUS CDS 630520 630897 0.89 + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_15 AUGUSTUS stop_codon 630895 630897 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQKKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV # GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 Scaffold_15 AUGUSTUS gene 630967 631506 1 + . g320 Scaffold_15 AUGUSTUS transcript 630967 631506 1 + . g320.t1 Scaffold_15 AUGUSTUS start_codon 630967 630969 . + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_15 AUGUSTUS CDS 630967 631506 1 + 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_15 AUGUSTUS stop_codon 631504 631506 . + 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MDTNDVNKKLFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNP # IKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVDMKYSKEELNHSKDLNRV # LRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 Scaffold_15 AUGUSTUS gene 632403 633785 0.47 + . g321 Scaffold_15 AUGUSTUS transcript 632403 633785 0.47 + . g321.t1 Scaffold_15 AUGUSTUS start_codon 632403 632405 . + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_15 AUGUSTUS CDS 632403 633785 0.47 + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_15 AUGUSTUS stop_codon 633783 633785 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN # VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV # YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP # YQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPKHIDLLRVID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 Scaffold_15 AUGUSTUS gene 633831 635240 0.39 + . g322 Scaffold_15 AUGUSTUS transcript 633831 635240 0.39 + . g322.t1 Scaffold_15 AUGUSTUS start_codon 633831 633833 . + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_15 AUGUSTUS CDS 633831 635240 0.39 + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_15 AUGUSTUS stop_codon 635238 635240 . + 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MNPGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWW # PDIYKDVEWYVRSCKECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPE # EVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFD # IVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVI # RRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 Scaffold_15 AUGUSTUS gene 635497 636167 0.49 - . g323 Scaffold_15 AUGUSTUS transcript 635497 636167 0.49 - . g323.t1 Scaffold_15 AUGUSTUS stop_codon 635497 635499 . - 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_15 AUGUSTUS CDS 635497 635882 0.53 - 2 transcript_id "g323.t1"; gene_id "g323"; Scaffold_15 AUGUSTUS CDS 636002 636167 0.58 - 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_15 AUGUSTUS start_codon 636165 636167 . - 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MFCIHDSFHVVESSQHSYPTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNFVSSNLDTPPAPLESQSTKFIAA # TLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGQTLLLLTQVSLLLRVFPLLVLRTPRHSYRDAVPVPKTVERATTPFTRGVTPMME # DKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 Scaffold_15 AUGUSTUS gene 637979 638636 0.39 - . g324 Scaffold_15 AUGUSTUS transcript 637979 638636 0.39 - . g324.t1 Scaffold_15 AUGUSTUS stop_codon 637979 637981 . - 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_15 AUGUSTUS CDS 637979 638526 0.65 - 2 transcript_id "g324.t1"; gene_id "g324"; Scaffold_15 AUGUSTUS CDS 638588 638636 0.4 - 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_15 AUGUSTUS start_codon 638634 638636 . - 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN # LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDKHGHLVEASPPPDSATEALEGLKEVERGSADEGASSPVGGSVPMELDLP # TIESLAERTLSPEKGAESAQIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 Scaffold_15 AUGUSTUS gene 639254 640320 0.32 - . g325 Scaffold_15 AUGUSTUS transcript 639254 640320 0.32 - . g325.t1 Scaffold_15 AUGUSTUS stop_codon 639254 639256 . - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_15 AUGUSTUS CDS 639254 639920 0.87 - 1 transcript_id "g325.t1"; gene_id "g325"; Scaffold_15 AUGUSTUS CDS 640292 640320 0.38 - 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_15 AUGUSTUS start_codon 640318 640320 . - 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MFLRRLHHFXPICLTSRPNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRIGKSKASRLTLPRFVSIFLISSF # LFDYSFCLSSVASPQSIHSKDSDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSR # QVVVSEDDSASNEVESEDEEEDEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 Scaffold_15 AUGUSTUS gene 643725 644708 0.36 + . g326 Scaffold_15 AUGUSTUS transcript 643725 644708 0.36 + . g326.t1 Scaffold_15 AUGUSTUS start_codon 643725 643727 . + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_15 AUGUSTUS CDS 643725 643874 0.36 + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_15 AUGUSTUS CDS 643941 644708 0.37 + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_15 AUGUSTUS stop_codon 644706 644708 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MSTLKLTETQALALQALLYREEQLPPALQEVLAALPLSRDLDTGIHSSSETSIKRKESESLPTSTHTFPSPPPTLTSL # LTPTSVSASTSTSTKSLTFLSLSPTATATVTGTTTATPTATATATGTTTATPSPTATATPSPTGTTTVTPTTTATATGTGTGTTTATPSPTATATPSA # TATFTATPSATATFTATPSTTATVTTTATTTITVTATATTTATPSATPSATTTAMSPLSLLSPFPSTFPSTSTSSSSLLTSSSSLLMSKSTTTARCRH # CTHCGVSTYPLPGPRIPGQKSSQVPRSKCGC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 Scaffold_15 AUGUSTUS gene 657474 658774 0.99 - . g327 Scaffold_15 AUGUSTUS transcript 657474 658774 0.99 - . g327.t1 Scaffold_15 AUGUSTUS stop_codon 657474 657476 . - 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_15 AUGUSTUS CDS 657474 658671 1 - 1 transcript_id "g327.t1"; gene_id "g327"; Scaffold_15 AUGUSTUS CDS 658752 658774 0.99 - 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_15 AUGUSTUS start_codon 658772 658774 . - 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MEVSHFHFQSSSPSSAPSISPSTSPVPNFASTAYVGPPPLIPTVISSSNTSISRPGTPIRRPPLPTTLPSSPGSGTSS # PSVKTPLASPNLATYRAPEELVNSDNEDYFAGPSTSALAPVSEQAVEADDEDDDTETLDGHEVDEGEDSTSPLIPDHGEMDEEIRTYFREEATDGSDE # GESDTEPELVIDLPEPEARNAEQHEEPHVVDLQDGNEVAGAEVDEDEEDDEEEDEEEDEEGEDEIAEEFQVRPQLREGAAVAFNAGVRRAVQLDANAP # PPLALAPIPGFPARPQPQQGPLVLNADDALLDELEAGVDDDMDGAMEGQSIFTSEVCDVLLRRFSPVLSYWAKRSNIWSGTKCCSDDFHHGFCYWLSN # VDTLYAWQINGLPHGKCHLSTFSPLIKHKLLDHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 Scaffold_15 AUGUSTUS gene 667093 667281 0.39 + . g328 Scaffold_15 AUGUSTUS transcript 667093 667281 0.39 + . g328.t1 Scaffold_15 AUGUSTUS start_codon 667093 667095 . + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_15 AUGUSTUS CDS 667093 667281 0.39 + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_15 AUGUSTUS stop_codon 667279 667281 . + 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MARSASLVSDSEGKPEDAPAPDDDDVVKSVDMNGDEGENDEEEEEFEIEEILKHNKGQFPEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 Scaffold_15 AUGUSTUS gene 669831 670295 0.82 - . g329 Scaffold_15 AUGUSTUS transcript 669831 670295 0.82 - . g329.t1 Scaffold_15 AUGUSTUS stop_codon 669831 669833 . - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_15 AUGUSTUS CDS 669831 670295 0.82 - 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_15 AUGUSTUS start_codon 670293 670295 . - 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MIQNGTHPSPPIDPLVPALDKLQLELEDAKNGFDTRVRTLSAQIHHVLSPPQKEEQEGEASSEEPVSGEGEKFSILPI # DPVPTSPVMDGQEELEAANIIIGKARNRLKRLYVLLRNLYTKSYRISGVSGSRGIYWYSGDVFIKQLVLPGSAVID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 Scaffold_15 AUGUSTUS gene 670671 672602 0.56 - . g330 Scaffold_15 AUGUSTUS transcript 670671 672602 0.56 - . g330.t1 Scaffold_15 AUGUSTUS stop_codon 670671 670673 . - 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_15 AUGUSTUS CDS 670671 672602 0.56 - 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_15 AUGUSTUS start_codon 672600 672602 . - 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MVVNKKQNFPVAPTMGSRTNSTQPLPRAKATSNSKSLSTAGPPQKKTKPKKPSKTPKLRTKSSIMDRFLVIMLAIFST # YALWTCPSDIHLSNPICRSLSQYRTHVLDPYVLPPVQKALLHPYVAPAVTKFYAVEHAVAPIVIRAHAVAQPYITKATQLTQATALTAYAKLVTPMYN # KHIQPLYQKYVDPLYMGYVYPRLHLLRSRVLDPYLRPLMLKTHLYANKLFWTLHRIYLAAAPRIHSAYVRARPLMDRAWVAKPYVVQSVDTGLKLFGL # LLEKTAEARRQFVDPHVIKIWEKVVELSGSSGTTTSSTAFSVPTPVSETKATSAEAEVETVQSGSSSVSSASISTSLSVPLEPSEASPVPEESSLPLE # TLTSEDPTLSSIITELEASTISEIFSASTSSLTSSEHESTTASYDSALTPDIASPVETLLAVTEPESEFEVPIEAEQGTSGEENLDSEYASSTSEDDL # DNFFADLGLLENEENETGDSTEASVVETEQDTAISPEESAAARRVATAKKRAELEARMEKWHADLDGLMKRRTKEFRKELVRVRKGAVRSLFPDPEKD # NGDLEEALTHIRGEDVAGILERFDKESEKLLKGLESYLKKEEKLVSGMFNSLSFGDRSSTEMYVEIPLMWMLMIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 Scaffold_15 AUGUSTUS gene 673317 674458 0.4 + . g331 Scaffold_15 AUGUSTUS transcript 673317 674458 0.4 + . g331.t1 Scaffold_15 AUGUSTUS start_codon 673317 673319 . + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_15 AUGUSTUS CDS 673317 673656 0.43 + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_15 AUGUSTUS CDS 673749 674458 0.7 + 2 transcript_id "g331.t1"; gene_id "g331"; Scaffold_15 AUGUSTUS stop_codon 674456 674458 . + 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MNIDTRQKLKRNISLDAQQDPPIKKPKMRKPLETRYETPYPSSLSESQVYKLPSSIGPYLSPSKFSPIPKAHLQRNHR # RTSSTNLKENASVLCSPFPKGKNPQKLKKYGKAAKRAYIGGKDSQFQHSRSRASQSTTNSPAETTTRVRRPSAPTPPKKFDWKDLVPTHPVDLRAPIS # GYPQSHFDPDANEFIRPSPNHSQIDFNRPPSQLSLYDYNRSVTYHDMDVDDVASTDQDAFFTDVQGTSTPFKNLSSLSVADRRFGGTVDPAALSGSAL # LLLQSNTDGQETDTDNDSCGFDSDEAIDDPGPHRSFRALKLASRNKSKSGSGYITPSCDSGDRRWVDVLRGSATR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 Scaffold_15 AUGUSTUS gene 674678 675274 1 + . g332 Scaffold_15 AUGUSTUS transcript 674678 675274 1 + . g332.t1 Scaffold_15 AUGUSTUS start_codon 674678 674680 . + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_15 AUGUSTUS CDS 674678 675274 1 + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_15 AUGUSTUS stop_codon 675272 675274 . + 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MDAHSSPPDDTESYCVRLPLRTRSLDTAHPLSTDQEEESFNPVAPGARRTRSGTIIPGTSAVPVVTSNVPPALPRRTR # SGTVVPGNFGTLYPAPLDDEKQNTLGAALSVYGRRARSGTIVYSSSLAPSLPIVEEKNTTESSSAIPVMSQARRARSGSIMAASSIPEGVVANSTVGP # LLLLQCLVLELGVEALSHLGTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 Scaffold_15 AUGUSTUS gene 679638 681209 0.1 + . g333 Scaffold_15 AUGUSTUS transcript 679638 681209 0.1 + . g333.t1 Scaffold_15 AUGUSTUS start_codon 679638 679640 . + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_15 AUGUSTUS CDS 679638 679660 0.1 + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_15 AUGUSTUS CDS 679709 681209 0.22 + 1 transcript_id "g333.t1"; gene_id "g333"; Scaffold_15 AUGUSTUS stop_codon 681207 681209 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MNFKLVTAQFCPPLDSSLVAAFLLDLEPHLEPTEQQINTLRSTLSELASQADVLQSAEDFSYVGVTDDLSTPSFTHGD # TSTSRSGSETSQQPFSTPLGFLQAAFPELQTQKLDRALLDAKMDDDADLDMWDIVSRLLSEELIKEMEERGLDGLDDVDGYPAEIEASWETVGKKRSV # NNERRKKKQGNSRHKIALVDIRQQHHSKSTDYTSPNHPQSFPAPDPWTQIYSLSTHLETLLAPYDASFFTSYFHSPKYSTPYIALVEALQEISKKRST # DVDLEPLIISLLDILLPLYEDLDPEQRSRLVSDIELSLSATQGHADEALDVVKLLRDLDEDSSSGYLEMGIYHQPIASEPPSNGIRPSGTPLSRASSR # KSQLPSGPPEIPSPPLLKNNATPTRSGNQASPYQWQVVPKRKTRKTPHPLAPFIPAYSRDVNGIKVRGSGNGFGKGGKGDVGELRKRIGDSVRKRDEM # LREASRMWQKGTAKSRGGEVALYFADRVRRRLSMVRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 Scaffold_15 AUGUSTUS gene 684219 685187 0.99 - . g334 Scaffold_15 AUGUSTUS transcript 684219 685187 0.99 - . g334.t1 Scaffold_15 AUGUSTUS stop_codon 684219 684221 . - 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_15 AUGUSTUS CDS 684219 685187 0.99 - 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_15 AUGUSTUS start_codon 685185 685187 . - 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MSTAPKNAEFAHLFELFEKLASRRTRATDVGESLVTDDTHILSIPLDLQPVFRNLATLVTPRTISASGRRGRRNTVAV # PSGSSDIDADTDTESVAKFPMGKQYPFKFKMMLHKLYELDDWGKKVREVLERSQKEYKPLAETVSHPESGDNAMGENGGVEGVHIGIKSGVNAPPKRT # GRPRGHTVASSSGGKWKEAVPRSVGVQSRDDERAVKKRCVGRRKSMSGMIGDCPNWVFNATVASSEINERVDPTGPATVTFYSSSHQHDRNKVPPRRR # VSSTATAAPATALQVPSFHRYGALQARRSQKSASTSPGEISCDSSSGH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 Scaffold_15 AUGUSTUS gene 689881 691187 0.79 - . g335 Scaffold_15 AUGUSTUS transcript 689881 691187 0.79 - . g335.t1 Scaffold_15 AUGUSTUS stop_codon 689881 689883 . - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_15 AUGUSTUS CDS 689881 690139 0.83 - 1 transcript_id "g335.t1"; gene_id "g335"; Scaffold_15 AUGUSTUS CDS 690198 690448 0.96 - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_15 AUGUSTUS CDS 690498 691187 0.96 - 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_15 AUGUSTUS start_codon 691185 691187 . - 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MFFPSAVFALLPLTVLATPLSSRSVVYADFATKHSWGDSTPSSTWVHHSTPDPSTLLKLRFGLRPSNFDTLLEHLSET # SDPFHERYGKHLSKAQVDEFMKPTDETLQEVKEWLNWHGIEDDALISTSDRVITVAIPVSLAETLLNTKYHVYAHTDSDEKIIRTLEYSLPRHLHDHI # DLVSPTTYFGTTRSMKVTSHLEPDRPVLSLGSDVTPSSSCKTTITPTCLKDLYNTINYTPTETAVNKIGITGYLEQFASNSDLATFVKSFLPQATNAT # FTLTEINGGLNTQNDPGVEANLDVQYATGMSWPTPMIFYSTGGEPPFIADSNEPTNTNEPYLNWLDFIATVADNDLPNTFSTSYGDDEQTVPADFATE # VCNAFATLGARGASVMFALEMLGEYSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 Scaffold_15 AUGUSTUS gene 696263 696664 0.57 - . g336 Scaffold_15 AUGUSTUS transcript 696263 696664 0.57 - . g336.t1 Scaffold_15 AUGUSTUS stop_codon 696263 696265 . - 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_15 AUGUSTUS CDS 696263 696664 0.57 - 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_15 AUGUSTUS start_codon 696662 696664 . - 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MKSSAPYTVHTHELNPPLPQPISGPSTASPMDLLILQVKAFLDAAEDVEVGPETIQELLQLIADRQTTNVVDLEPTPD # VEDEDDEWLPGQEHNDVELDISALFTNAHDGTGIHQLIYQAVAYCADRNLDKGGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 Scaffold_15 AUGUSTUS gene 697146 698015 0.4 + . g337 Scaffold_15 AUGUSTUS transcript 697146 698015 0.4 + . g337.t1 Scaffold_15 AUGUSTUS start_codon 697146 697148 . + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_15 AUGUSTUS CDS 697146 697189 0.4 + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_15 AUGUSTUS CDS 697652 698015 0.96 + 1 transcript_id "g337.t1"; gene_id "g337"; Scaffold_15 AUGUSTUS stop_codon 698013 698015 . + 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MTKSTGLVRLALSVISATASANASASAGADNGSTSASASSSSEADTSSASSSASSSLSADAGSASASASASSSGDVDS # VSASASVSSANNDNGNSTAAASASTSSTAGAETGSSAASASVKSLSSADSDSNSTSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 Scaffold_15 AUGUSTUS gene 702244 702723 0.93 + . g338 Scaffold_15 AUGUSTUS transcript 702244 702723 0.93 + . g338.t1 Scaffold_15 AUGUSTUS start_codon 702244 702246 . + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_15 AUGUSTUS CDS 702244 702723 0.93 + 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_15 AUGUSTUS stop_codon 702721 702723 . + 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MDRFLDESYDWWDPLSDLIGILEGRGDVIERVCEELGADWKEVCAAWGIFVDTRLRRQDLPYVSPPVIILLNVLTPSR # DVVADVLEIMPPDPTNLEDMMLSSLFSGHADQVLKHASDFDLWLSAHLADIMEPLGLLDAELDFEYHFILPHFVSFDCPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 Scaffold_15 AUGUSTUS gene 706973 708139 0.9 + . g339 Scaffold_15 AUGUSTUS transcript 706973 708139 0.9 + . g339.t1 Scaffold_15 AUGUSTUS start_codon 706973 706975 . + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_15 AUGUSTUS CDS 706973 708139 0.9 + 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_15 AUGUSTUS stop_codon 708137 708139 . + 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 Scaffold_15 AUGUSTUS gene 708190 709989 0.8 + . g340 Scaffold_15 AUGUSTUS transcript 708190 709989 0.8 + . g340.t1 Scaffold_15 AUGUSTUS start_codon 708190 708192 . + 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_15 AUGUSTUS CDS 708190 709989 0.8 + 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_15 AUGUSTUS stop_codon 709987 709989 . + 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRERGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTD # TRQKAFDTLREAFISAPILALWTPTGLLESR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 Scaffold_15 AUGUSTUS gene 711259 711900 0.57 + . g341 Scaffold_15 AUGUSTUS transcript 711259 711900 0.57 + . g341.t1 Scaffold_15 AUGUSTUS start_codon 711259 711261 . + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_15 AUGUSTUS CDS 711259 711900 0.57 + 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_15 AUGUSTUS stop_codon 711898 711900 . + 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAED # INLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSWESAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 Scaffold_15 AUGUSTUS gene 717495 717971 0.45 - . g342 Scaffold_15 AUGUSTUS transcript 717495 717971 0.45 - . g342.t1 Scaffold_15 AUGUSTUS stop_codon 717495 717497 . - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_15 AUGUSTUS CDS 717495 717971 0.45 - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_15 AUGUSTUS start_codon 717969 717971 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MFMNSLHAAISKSTPDTLPVLTTQPIRSREAPMAEQTTSSQRLLSHTTSQASSLTTTNLTPQLNAASTALLNALLMNL # NRSDPSHGHPMTNGTPKKKGAYLPPLRTLGSRPATSNYPTAISLPVNTVATRSVRPYPVNLTPIISALRPHCAARERLIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 Scaffold_15 AUGUSTUS gene 719494 720084 0.99 - . g343 Scaffold_15 AUGUSTUS transcript 719494 720084 0.99 - . g343.t1 Scaffold_15 AUGUSTUS stop_codon 719494 719496 . - 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_15 AUGUSTUS CDS 719494 720084 0.99 - 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_15 AUGUSTUS start_codon 720082 720084 . - 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MEARVAARPPQTLSRTHGNPPIECAKLPIPPHPPAKLADKLITVNQTPLASNVPFGTQTNHRSHNVTDVSDGTNMTYA # AAPEHQSGTENAMSPATGTSMDISKSLKEPMRVWNSVRTGRDQTDAPVVPTLKSIFAQDALTADTELAAALTENKIAVRTPLQAKEWKLAITSLNLTH # TNTPPLLNPYNTASMSESPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 Scaffold_15 AUGUSTUS gene 720888 721298 0.9 - . g344 Scaffold_15 AUGUSTUS transcript 720888 721298 0.9 - . g344.t1 Scaffold_15 AUGUSTUS stop_codon 720888 720890 . - 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_15 AUGUSTUS CDS 720888 721298 0.9 - 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_15 AUGUSTUS start_codon 721296 721298 . - 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MAERMDFDPAKIPAPDFASEAYAFMRAALVADVNTPEITTNELAAQRLKDQWEGHIEGLRAQYQVQLQQAETLREQRR # QEEAEGERLAEAERQEKERELTKEAEKKRLPIYDFQKGLGVDSIPLQLHPYARKMMMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 Scaffold_15 AUGUSTUS gene 722237 722739 0.51 + . g345 Scaffold_15 AUGUSTUS transcript 722237 722739 0.51 + . g345.t1 Scaffold_15 AUGUSTUS start_codon 722237 722239 . + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_15 AUGUSTUS CDS 722237 722388 0.51 + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_15 AUGUSTUS CDS 722454 722739 0.53 + 1 transcript_id "g345.t1"; gene_id "g345"; Scaffold_15 AUGUSTUS stop_codon 722737 722739 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MEEHSSSKSSMNKPEVFKGKGGSEARRFMAQFQNWASEQPDLAKSQVKLINAENWDMFLKEFGQWFEPMDPGMEARSE # IKNLRQSKRQTVAEFAQKFKDIGDQTEMSDIDLQECFFTALLLEIQQHLIIINIAQGIAPTLKEAIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 Scaffold_15 AUGUSTUS gene 731045 731371 0.7 + . g346 Scaffold_15 AUGUSTUS transcript 731045 731371 0.7 + . g346.t1 Scaffold_15 AUGUSTUS start_codon 731045 731047 . + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_15 AUGUSTUS CDS 731045 731371 0.7 + 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_15 AUGUSTUS stop_codon 731369 731371 . + 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MLYSSAAFSSPSPFLHKSDFVATLSTGGTCGGCRQSRSQAVHAEIAGEWGFQVHVEDSAAVHLEAGKLAQELGDTVRA # LWEQPGSEPKLVFETRVLHEQDENPKDRSH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 Scaffold_15 AUGUSTUS gene 738730 739371 0.39 + . g347 Scaffold_15 AUGUSTUS transcript 738730 739371 0.39 + . g347.t1 Scaffold_15 AUGUSTUS start_codon 738730 738732 . + 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_15 AUGUSTUS CDS 738730 739371 0.39 + 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_15 AUGUSTUS stop_codon 739369 739371 . + 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MSPLELTYGYLPLFNIPVGQCSSIPAVDDCIRILREVRQDAGAALHLGKKQQKEGYEHGKQKAHQFKVGDLVWLSAED # INLQLSSEKLGDWQLGPYCILEKIGPLNYRLDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPKPVYLEDEAELEYEVEEILDSRVRWKKLEYLVK # WKGYDAGHNSWEPAPNLSWAPKIVQAFHKKYLSAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 Scaffold_15 AUGUSTUS gene 748983 751275 0.4 - . g348 Scaffold_15 AUGUSTUS transcript 748983 751275 0.4 - . g348.t1 Scaffold_15 AUGUSTUS stop_codon 748983 748985 . - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_15 AUGUSTUS CDS 748983 749941 0.44 - 2 transcript_id "g348.t1"; gene_id "g348"; Scaffold_15 AUGUSTUS CDS 750027 751275 0.67 - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_15 AUGUSTUS start_codon 751273 751275 . - 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAENP # HIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLP # AHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRL # QGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRL # EKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRLATRPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASG # FATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMI # HRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEETMGWSTTEVE # YTYQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVRRSSDTHGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 Scaffold_15 AUGUSTUS gene 751643 752809 0.91 - . g349 Scaffold_15 AUGUSTUS transcript 751643 752809 0.91 - . g349.t1 Scaffold_15 AUGUSTUS stop_codon 751643 751645 . - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_15 AUGUSTUS CDS 751643 752809 0.91 - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_15 AUGUSTUS start_codon 752807 752809 . - 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 Scaffold_15 AUGUSTUS gene 761104 762767 0.1 - . g350 Scaffold_15 AUGUSTUS transcript 761104 762767 0.1 - . g350.t1 Scaffold_15 AUGUSTUS stop_codon 761104 761106 . - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_15 AUGUSTUS CDS 761104 761430 0.41 - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_15 AUGUSTUS CDS 761690 761909 0.87 - 1 transcript_id "g350.t1"; gene_id "g350"; Scaffold_15 AUGUSTUS CDS 762035 762390 0.45 - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_15 AUGUSTUS CDS 762567 762767 0.5 - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_15 AUGUSTUS start_codon 762765 762767 . - 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MPPRTQAQFRANSKENTFFTTAQSFAPFSESISAIGQPCCHNRGFGPATVPTTSTLPETMEEETTIRNLLVTRPHFDL # DTGDHDDQDPPVNPDDPGADNDNLDDDSGGLPHGESGDPSGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGSRVPLRPLVPPPSRPLLTAL # NPRARSRSQSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETEKSGNTTSGSTPWLLPSGSSAPFTPKPKPF # SGGKPNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 Scaffold_15 AUGUSTUS gene 767806 768135 0.58 + . g351 Scaffold_15 AUGUSTUS transcript 767806 768135 0.58 + . g351.t1 Scaffold_15 AUGUSTUS start_codon 767806 767808 . + 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_15 AUGUSTUS CDS 767806 768135 0.58 + 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_15 AUGUSTUS stop_codon 768133 768135 . + 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MHEEGYSSSAWHSSEPSDPISPSSYRRPSLTSHDDSTESTGHGHPLHSGSPQPRISSDSGGISSGSRWRDTPTALSDS # QEIPPPTPELVETAFDENVLRALCEMDVCFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 Scaffold_15 AUGUSTUS gene 788355 789203 0.62 + . g352 Scaffold_15 AUGUSTUS transcript 788355 789203 0.62 + . g352.t1 Scaffold_15 AUGUSTUS start_codon 788355 788357 . + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_15 AUGUSTUS CDS 788355 789203 0.62 + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_15 AUGUSTUS stop_codon 789201 789203 . + 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MPSPASEISSRKRSNSSSFVKRKRLRVDQNLVEHPLPTVGRTVAVTASPIQTRNLSTSFTRPHHIIANIGRKQSQKAQ # ITYRPPLAELPLKNYRASPYSSSNLPEQTNILEHVPRPETPVIIPQTPFIKSSDLISQFRQGYVQPPLKQVTERSPTVSIADASSSHLPSSPYVSTNS # VQIGPRVQARRTIGSKSKFKPAINVLAHASRLQNAVAVHTPSRPTTFSKTNTALAAAPILFTPTPLAIASTTDVEPISTNTNLELDITPLAPPTLRQR # RSPFVSEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 Scaffold_15 AUGUSTUS gene 790280 791863 0.18 - . g353 Scaffold_15 AUGUSTUS transcript 790280 791863 0.18 - . g353.t1 Scaffold_15 AUGUSTUS stop_codon 790280 790282 . - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_15 AUGUSTUS CDS 790280 790747 0.3 - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_15 AUGUSTUS CDS 791329 791452 0.36 - 1 transcript_id "g353.t1"; gene_id "g353"; Scaffold_15 AUGUSTUS CDS 791550 791863 0.58 - 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_15 AUGUSTUS start_codon 791861 791863 . - 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MLDLSEEPKEQNIATCVKYFKRMAPMGIWLEMEIGITGGEEDGVDNTSVDNSRLYTQPEDIWDVYSALSAIAPHFSIA # AGFGNVHGVYKPGNVKLQPTLLGKHQAYLVFHGGSGSTKEEIKTAVESGVVKMNVDTDTQWAYLVGIRVIFYSWLPASNSTFLDATKPVELTTWRQAN # AYKEITVPSPPGIRDGQSWRLILSSMPQRYSINLEDASGPESYLGKTPFPVISMPIKFTRNANQKRAKQEKIERYYSFTVPNAQSFPTSRVDLALRIT # EQTSFDLDKVSLLFSFSVFMLIVLKDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 Scaffold_15 AUGUSTUS gene 796294 796656 0.68 - . g354 Scaffold_15 AUGUSTUS transcript 796294 796656 0.68 - . g354.t1 Scaffold_15 AUGUSTUS stop_codon 796294 796296 . - 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_15 AUGUSTUS CDS 796294 796656 0.68 - 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_15 AUGUSTUS start_codon 796654 796656 . - 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MPTNVQDSSPPENSSVSQSEIASSDSEQPNLLSVGMIELHTNSQNDSNHYMPTNVQDSSLPESPSVPESQIARITANV # LVGTRIVRPHLIELDGQKHLVFVFSVSYKASSMSRPEIQAFY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 Scaffold_15 AUGUSTUS gene 808154 810054 0.28 - . g355 Scaffold_15 AUGUSTUS transcript 808154 810054 0.28 - . g355.t1 Scaffold_15 AUGUSTUS stop_codon 808154 808156 . - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_15 AUGUSTUS CDS 808154 808754 0.28 - 1 transcript_id "g355.t1"; gene_id "g355"; Scaffold_15 AUGUSTUS CDS 808814 810054 0.28 - 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_15 AUGUSTUS start_codon 810052 810054 . - 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MIHSSFCRLSPTHTCTYTLSEEEALKQYYGDFYYANDPVTVYTDGSCLGGGTDSAQAGAGICYGLNSRRNQSVRVPGP # GRQTNNRAESYSVYLVLFEMDPKRPLIIYTDSEYIIRQCCYWAGRHLATGWNIPNGDILKDIALLLKERAASTRFVWVKGHSGNQNNDEADNLAKKGA # TMDLPGNYRPLKEVPWKCNTSCLVPLEGDKVSSALPKDVGGERKAGVEDVRQGEVSHRGRSKVAKIQEDNLKKLQNCKTIAQFWSLYINWMDGKAKEM # EVTMEQLLREFRSRMQSPVIIPPNLDAKYLALWKQWEAMIPEKNVDTTEQKFFSRAIQEEEIEEAKAHIAMKNLDSSVGVDQVDYKLIMKIPNENCVK # LLNHCIENRTAPSAWLVALVVGILKRGKEADDPSSYRLVVLEAPGFTAINPEWVSAGYRTTNNPFILKTMVDTAKAIGKPLYVAYMDWTHAFPLTNRP # MMWMKLNKMGIRGPLIDWLRLMYQKLGNVVQVADSFSEAFTSNIGAWTGDPGTPMLFNLAIADFRLSEHPGDVVLYDKVVNHTEQADDVLMTTMCPTS # FQSKLNQFGEYSAQTGFIAQFQSVFMQCMERRRQRACHLLCMAKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 Scaffold_15 AUGUSTUS gene 814302 815096 0.94 + . g356 Scaffold_15 AUGUSTUS transcript 814302 815096 0.94 + . g356.t1 Scaffold_15 AUGUSTUS start_codon 814302 814304 . + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_15 AUGUSTUS CDS 814302 815096 0.94 + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_15 AUGUSTUS stop_codon 815094 815096 . + 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MSSPYLPAPPLLSYPIPIDPSLQSVGSSLGNLGRQQFHSRQLAEEYSPSPSLAMSPILSTLPEAFASNAADCVTGSAL # YDGMKPYHMESPRSLMLPPFSAQSVSPSVPGASNKLIPEVQLPPMSTISIPFTSTVLAPMSIRYLFPNPQPPPPPPTKPYLMQADGKAKKSEICQEFV # AVETYTQKLLHDVTVLAKENQIMKEYLGNHELYFDACLRALEENIDLRVKMAVAAEIDKLQKGEGAEPEDNDSDEDELEDDEVEKRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 Scaffold_15 AUGUSTUS gene 815215 816167 0.26 + . g357 Scaffold_15 AUGUSTUS transcript 815215 816167 0.26 + . g357.t1 Scaffold_15 AUGUSTUS start_codon 815215 815217 . + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_15 AUGUSTUS CDS 815215 815589 0.96 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_15 AUGUSTUS CDS 815644 815814 0.35 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_15 AUGUSTUS CDS 815973 816167 0.41 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_15 AUGUSTUS stop_codon 816165 816167 . + 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MFKLFLGVDSLTTKENLLGASVPNGDKLPLIPGMDVHQIRFDWENTAKKSGNGAKLETIAKFAKTHGHDYKSGVKELL # DIIQLGDLKSCVETKFNSLRRIYRRTLTEDINMKKESSGTKANRAKGKLEARIHKWNNLPEDNEYKDMKYDTAMVIQMQSNDEKDPAEPRKFISRAPP # GVHERLLEGRARRWMVSTEWLNDHPEFDTPNRLADNGRLWGDAKDPEDLERLEAENKKAKKEIKEGKRKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 Scaffold_15 AUGUSTUS gene 817072 818031 0.5 - . g358 Scaffold_15 AUGUSTUS transcript 817072 818031 0.5 - . g358.t1 Scaffold_15 AUGUSTUS stop_codon 817072 817074 . - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_15 AUGUSTUS CDS 817072 818031 0.5 - 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_15 AUGUSTUS start_codon 818029 818031 . - 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MDYIECPCARCALKDPLLSQISRNLCWKHVKKHGLPIPIAEAAARPRTRSSARPEGSSDREGNDRRISNGIDIESSSD # DDGHFEVGTGNGDEEPRPHEDRDRDPPPPPLPRPRAVAPDTEFREVKMPEAAELSLDPDFASGVAPTFRLGEIPSVRLAYLQAVYLNAMNNMSVKATT # ENLDMSLNILASTKALDGGPIPVRTLVSAKRRLGIDPDSCIIQYTICTRCWKHHTPTQVSSLDSPDCTVPNCEGKIYEEFQDTNGNTRRRALKILPQV # SLIHNLRRIVRRKGFRKLVRDSRDTAENANDDPNFVMHDMHDGTM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 Scaffold_15 AUGUSTUS gene 828977 829675 0.89 - . g359 Scaffold_15 AUGUSTUS transcript 828977 829675 0.89 - . g359.t1 Scaffold_15 AUGUSTUS stop_codon 828977 828979 . - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_15 AUGUSTUS CDS 828977 829463 0.89 - 1 transcript_id "g359.t1"; gene_id "g359"; Scaffold_15 AUGUSTUS CDS 829542 829675 0.99 - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_15 AUGUSTUS start_codon 829673 829675 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MPTVVFKANSTTELLDIRAREQPNDPAIYTGIPEPDGSLKLRSLTAVDRIAWYYSSLGIAPKVVAGETPPTRTIAVFV # TSSVDETLLELALAKMGLTALLLSVNNSVAAVAHLSKITNATHLIYSPKFVEEVKEAQVLLKRQGVEIGIIEDMRFPLWGPQGAAKSAIKPFFPVLTP # DQEVSRPAIYLHSSGSVGYCVFVFMKTLIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 Scaffold_15 AUGUSTUS gene 835327 835656 0.74 + . g360 Scaffold_15 AUGUSTUS transcript 835327 835656 0.74 + . g360.t1 Scaffold_15 AUGUSTUS start_codon 835327 835329 . + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_15 AUGUSTUS CDS 835327 835656 0.74 + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_15 AUGUSTUS stop_codon 835654 835656 . + 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MSIHGIQNGGPEGHLSATISFRAASVALSTIVTSDFGSDPVARGPNPKNSRNRSTGASQSEGNDSIPSTPSTTSHSRV # DVESQPHPEPTMKSESSTESVKEGKKRVQYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 Scaffold_15 AUGUSTUS gene 845071 846020 0.25 - . g361 Scaffold_15 AUGUSTUS transcript 845071 846020 0.25 - . g361.t1 Scaffold_15 AUGUSTUS stop_codon 845071 845073 . - 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_15 AUGUSTUS CDS 845071 845590 0.35 - 1 transcript_id "g361.t1"; gene_id "g361"; Scaffold_15 AUGUSTUS CDS 845642 845675 0.31 - 2 transcript_id "g361.t1"; gene_id "g361"; Scaffold_15 AUGUSTUS CDS 845744 846020 0.39 - 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_15 AUGUSTUS start_codon 846018 846020 . - 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MSRGPINIVACENLQNATDKLREAIESELSDEQERLYLQDNIGFAICSVDRIVPPFSSENILDVGVEPFFEWTVDSNS # LKKTDPDVVIDGMHDAYVQRKLFTLNTGHAITAYLGFLDKKDTILDAISDDSIHNVVSKALHESGTALIAKHHSFFSKEQHEDYIKKILKRFSNHNLK # DEVSRVGREPLRKLRRGDRLLGPVEMCRERNLEHDTLLLGISAALLFHPTGVHEDEEANELQDRIRREGIEAVVADLTGWEKEDEDLRKVIREYYRMK # KD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 Scaffold_15 AUGUSTUS gene 848673 849263 0.48 + . g362 Scaffold_15 AUGUSTUS transcript 848673 849263 0.48 + . g362.t1 Scaffold_15 AUGUSTUS start_codon 848673 848675 . + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_15 AUGUSTUS CDS 848673 848677 0.48 + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_15 AUGUSTUS CDS 848792 848807 0.48 + 1 transcript_id "g362.t1"; gene_id "g362"; Scaffold_15 AUGUSTUS CDS 848943 849263 0.61 + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_15 AUGUSTUS stop_codon 849261 849263 . + 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MLRYGAQIWADSTNKVIRSSFFDLDTGEEGDPTTDRPLIVQFCGNDPDKLLKSAKALEDRCDAVDINLGCPQEIAKKG # KYGAFLQDDWELIYKLSAFCDPLQPTYNSQKKDFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 Scaffold_15 AUGUSTUS gene 852532 853449 0.98 + . g363 Scaffold_15 AUGUSTUS transcript 852532 853449 0.98 + . g363.t1 Scaffold_15 AUGUSTUS start_codon 852532 852534 . + 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_15 AUGUSTUS CDS 852532 853449 0.98 + 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_15 AUGUSTUS stop_codon 853447 853449 . + 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MTDTIFARSGSTASGSTGSTASSASVAPAAASSAASSSASTSDNDGSGAAVGASASSSSTSTAGTTTSSSTSTSSGFA # LSNGQAAQALNAQFATLTASSTCTDGQNACVNGAFAQCVGGKFETTQCAGGTICAALPLVNSAGTSITCTTTADAEARIAATGATGGITGDGSTAAAS # SAGSDTSATDSAAVSTSTAAASTNQAAAASSSTSSFALSNGQAAQKLNAQFATLTASSSCTEGQNACVNGAFAQCVNGSFETTQCAGGTTCAALPLVN # SAGTSITCTTTADAEARIAATGATGGLTGSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 Scaffold_15 AUGUSTUS gene 855062 857009 0.33 + . g364 Scaffold_15 AUGUSTUS transcript 855062 857009 0.33 + . g364.t1 Scaffold_15 AUGUSTUS start_codon 855062 855064 . + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_15 AUGUSTUS CDS 855062 856358 0.49 + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_15 AUGUSTUS CDS 856480 857009 0.64 + 2 transcript_id "g364.t1"; gene_id "g364"; Scaffold_15 AUGUSTUS stop_codon 857007 857009 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MSHKGTTFDTDQTLRTKKLRGNGQLAQDLGSSGFASKHIKQSHKPSIGSRSSKERVERGSPSGSKHKKRVEDYNEEPD # ELDFLSGMDSENEFDTKSSMPLVSSQLSTHDPEHQLARSNTLKGLKFNKNKSENDNASIPSKPRGPSSSILEPKSPNLSSASRLSPPTKPAAKSSSQS # RKVSQSSHVASRKPSVEKASSRSVLRVVGSSSSSDKDDARSIRRTKGERKGLERSTPAEPLPSKKARPRPKPLPAKSSSSSVSSALLKPPVGKLQPAP # PADLPVSLSPEHMPRMNPKSLLSKPERFPLAASPERENTPKNHKSLLNVRPAAFPLSPSLSGRRKDVQKKSASNQYELMREDSDDDEALSKTKTNAVS # KAAPFPLNSPYPKSMISIPNKSVGKRSSNVSPQEDDSPLKRQRRDDDMYVVLISMAVLSHVNITTVYNPSVDANTLCPYCDEPLPASPTPHLKHLLAT # TAKKSIRAPRPTNPMGRKTAVSVFINVCQRHQFESKILPEAEAKGWPKSIGWDLIHERVMRMKNHLEALMENSMLENERGDVDYDEENDTGEGSGQCK # RARDKCVFWEDVIKEVKQKGTRAAANVKSQFANFQNTQPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 Scaffold_15 AUGUSTUS gene 857293 858378 0.36 + . g365 Scaffold_15 AUGUSTUS transcript 857293 858378 0.36 + . g365.t1 Scaffold_15 AUGUSTUS start_codon 857293 857295 . + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_15 AUGUSTUS CDS 857293 858378 0.36 + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_15 AUGUSTUS stop_codon 858376 858378 . + 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MFPEDAGERVEGASAKLYTKGKRKGKGKEKAKETVRYHSEDTEIETTEMSVADKMVMEKARRRRLELEKETEQEEMIH # QEQTKRHRKGKSKRKNPVVQTPSPQNSKPKPRPKPKAIQKSASSASLAGMDVGSEPEAGWRSTFSDGPAEYSDNNGMYMEASDVDAGNEFVNWALDDS # ANMGAFFLTTENNRSPPNSISGLSFSSKHRDVGFPPPSSSSKPDSAGSTSHTMIISTSEDSDSNIRTRKSRKQTRKMSTRTRSPSIEISSPDTKPISV # LARPPPSSFDMDDTPKASRSQLSLFPVVPSTSFSRRNGGGAVDRNSGETSHTDSDVVLSRWHNDPDSAPLAFIRQSRSRPNVQKAPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 Scaffold_15 AUGUSTUS gene 860584 861180 0.79 + . g366 Scaffold_15 AUGUSTUS transcript 860584 861180 0.79 + . g366.t1 Scaffold_15 AUGUSTUS start_codon 860584 860586 . + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_15 AUGUSTUS CDS 860584 860644 0.79 + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_15 AUGUSTUS CDS 860722 860882 1 + 2 transcript_id "g366.t1"; gene_id "g366"; Scaffold_15 AUGUSTUS CDS 860962 861180 1 + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_15 AUGUSTUS stop_codon 861178 861180 . + 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MEHGMALFFSKNTHGSDYAQDYATDIDTDDFPVSAGDVITVNIDASSNSEGIVTLTNESAGKSFVINLTSPTKLNAEW # IIEDYTQNGGLVPLANWGTVTFVNASASTSANNTLGLEDATIFDIEQYNDIMTFVTIDSDSSVSISYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 Scaffold_15 AUGUSTUS gene 861620 863132 0.93 - . g367 Scaffold_15 AUGUSTUS transcript 861620 863132 0.93 - . g367.t1 Scaffold_15 AUGUSTUS stop_codon 861620 861622 . - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_15 AUGUSTUS CDS 861620 862440 0.96 - 2 transcript_id "g367.t1"; gene_id "g367"; Scaffold_15 AUGUSTUS CDS 863018 863132 0.94 - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_15 AUGUSTUS start_codon 863130 863132 . - 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MHRIRTDTSCILAWLIEQGYEVYAFMADVGQEEVSFKLXFYHRFAGRKDLLAYAAEKSIPVTQTTAKPWSTDENLFHI # SYEAGILEDPNTTPPVDMWKLTTSPENAPQTPEQITIEFKAGLPVKVVVPDSSKTHTDPVDIFLALNTLGRKHGIGRIDIVENRFIGVKSRGCYESPG # ATILRAAHIDLEGLTLDRNVRALRDQFVTIEFSKILYNGHFFTPEREFITAAIPASQRTVNGVVKLKLYKGNVIIEGRESSEVCIVLCKFLNGPVLIC # FLQGLYDERQASMDELGGFEPSDTTGFIAIESIRIKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 Scaffold_15 AUGUSTUS gene 863400 864002 0.61 + . g368 Scaffold_15 AUGUSTUS transcript 863400 864002 0.61 + . g368.t1 Scaffold_15 AUGUSTUS start_codon 863400 863402 . + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_15 AUGUSTUS CDS 863400 864002 0.61 + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_15 AUGUSTUS stop_codon 864000 864002 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MDSARRNPSSSNHSTSRRSRNPHAPRRGPEELLPNSMNAFITSQRSKSRSPSRAVRNDPFAALNASMTTVKGYSSGNR # SSKSSGSASVRQSTSSYDSDMITDSGQRLRSNVTIAAFQRPNGSRPTTPAAPNLQKKDKGKERQSKSHGSTDASFSGPIAVAEFERMRIEIETLKSTL # NDHKKNARKQAKVAFIFIYCTYPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 Scaffold_15 AUGUSTUS gene 864374 865270 0.74 + . g369 Scaffold_15 AUGUSTUS transcript 864374 865270 0.74 + . g369.t1 Scaffold_15 AUGUSTUS start_codon 864374 864376 . + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_15 AUGUSTUS CDS 864374 865270 0.74 + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_15 AUGUSTUS stop_codon 865268 865270 . + 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MDLDIDDPDYVMYRQKSCPACRAVVLGRPLPVYPVRDLISALQKAKVSGNAAATVSTRRSSSPYVSEDPWEGLFPDND # EDEEDEEEDGLEVGAMPFGFLYSESDSEMEMHDDDSEYDSNGEPEEEEDNSAIDEEEEGESGEDVEGEGYSEGDEDYYVSPQWEPPCYPYPGNVAPGP # QSQLVRRGCPPWLSSTYRIRYSHNNGLVGHLNSLDPDDVGAPPRGPTSRMHRLFLGWNIRNIDDQSSELSQRFFMAQILEDFRNEPYKFSIHQRANGC # LDVRVLVPADEVTQYYSTESEGWD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 Scaffold_15 AUGUSTUS gene 869995 870930 0.37 + . g370 Scaffold_15 AUGUSTUS transcript 869995 870930 0.37 + . g370.t1 Scaffold_15 AUGUSTUS start_codon 869995 869997 . + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_15 AUGUSTUS CDS 869995 870930 0.37 + 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_15 AUGUSTUS stop_codon 870928 870930 . + 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MLFRRKCCEDGQQVEEESNGATTRKKQRQADLSKAISRKWKSLSKNDRQYWEDLAKEKKKVHQEKYPGYVFRPQRVRD # KDGRARNKKYTKRNRAAKRKQGEADIERETAYLVPFPGRSTSASGTIPAMSYHTVHIPVISTIPPHPSSASSSSLPMPQISQTFSGTVGNITSNFEYL # PSPNSMLHSERGLQVMSQSTSWTAGAQADALHRQSSELMRNLFNLPAHETPESTTRSVARLQVPSSPLSSAASSPISGPFTPSSDPLDQSSYNNAQLY # PSTFNPAETCGSDHTPWVPMPAAIQAGLIPQPDAVHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 Scaffold_15 AUGUSTUS gene 873101 874438 0.23 + . g371 Scaffold_15 AUGUSTUS transcript 873101 874438 0.23 + . g371.t1 Scaffold_15 AUGUSTUS start_codon 873101 873103 . + 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_15 AUGUSTUS CDS 873101 873685 0.46 + 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_15 AUGUSTUS CDS 874415 874438 0.23 + 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_15 AUGUSTUS stop_codon 874436 874438 . + 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MKIFLGVIETDVLKKDVGLNRIDPRKLANGDWDEVVFVGEILCWIGRESGITNAHDDREEPAWRLTPSTAPDISDNST # SHRSTSSVPTADTSHSLHDLDHLRSFRSLSVPSSPRLSPLVLPRPIRPHCIHKVPSFYALDDVATTTSGSEPSSSSVRYTGHIQPVDEELELSYFENS # RHSRTLGNPEDTGLDVSHQSLVGDLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 Scaffold_15 AUGUSTUS gene 876797 877651 0.42 - . g372 Scaffold_15 AUGUSTUS transcript 876797 877651 0.42 - . g372.t1 Scaffold_15 AUGUSTUS stop_codon 876797 876799 . - 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_15 AUGUSTUS CDS 876797 877651 0.42 - 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_15 AUGUSTUS start_codon 877649 877651 . - 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MTEFQGMFSKTVIIKLEDESEWVVQLRDNEIDTTKVALARSKLGDVVPFVHRASPLKAHFAFIAPFVHGKVWCKKDKE # LSGAERVSIATQLGGMLARCAINEDSSAMIDSYVIPRLRYILDHSFVDGTHPQLRARIEDLANQAPSTHVLPLAVIHEDVNSMNIILDDESNGIAALI # DWEAASLLPLGSNAWCIRFLATVNRNRIDYETDDTLPMTRGFWTGLVDSLPLHLKGRKDVLEALLSAMQIGLVMFIFWPGYDVIDNADMEQSLKRLNW # FEDTLRPMVQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 Scaffold_15 AUGUSTUS gene 878428 879788 0.2 + . g373 Scaffold_15 AUGUSTUS transcript 878428 879788 0.2 + . g373.t1 Scaffold_15 AUGUSTUS start_codon 878428 878430 . + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_15 AUGUSTUS CDS 878428 878926 0.24 + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_15 AUGUSTUS CDS 879076 879788 0.82 + 2 transcript_id "g373.t1"; gene_id "g373"; Scaffold_15 AUGUSTUS stop_codon 879786 879788 . + 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MHSIYMPGSYKSDYLPSELMSVPDELRNVLEQCLAEDATPENLEVYLPNVRLIITGLLQGLRNKQSLYRHLVSDHKHR # SDQSGGDRVQSRSTRSSKSHRKQPSKGPAENERDSISRRSAASSSSRRRDTSSSQAADSEASFVGGFSPMISEAPSIPDPNDLPNPYDIVEPASPDPE # RNGIQQPQPQTNGFPPPPPPPPDSPPLDASQVPAMASSLAALQKSDALERRASKRFSTYNITKMTGAVGRDRSLRNQSNRRSLAVSSALTPGELAVLT # EVDDEEESSPVASLKREGSFRSRAATPETRISTPPVPPLPSTPSRTPEASPSPGSTSAHRSDSNIKRGSDSKMTVFLQLGREVKKASLEPGISSSSLR # MLFVDKFSYNPGQEISPLYTSAILQAVFNMN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 Scaffold_15 AUGUSTUS gene 880171 881142 0.54 + . g374 Scaffold_15 AUGUSTUS transcript 880171 881142 0.54 + . g374.t1 Scaffold_15 AUGUSTUS start_codon 880171 880173 . + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_15 AUGUSTUS CDS 880171 881142 0.54 + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_15 AUGUSTUS stop_codon 881140 881142 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MTGSTLQAQMTGGSIISEYSTRVVSDLKTQFDEVQNLRRDLGIMRQLYIEFMKQTKESLGTLRTQTQSVKQLATANVG # GSRAFIDSGKQKLDVRTQNVLTEVERLQDTVEALKDDVLKRHITPKALQLKAVKKDMDTVAVELESLKEHIKTVKPMWKKTWAEELQNIVEEQQFLTH # QEEFLGDLLEDHKGVLEIYGHVEQVINLRSAGSGRRLNGRGFKPPAPEESTQSLSNVMMEIRTASVDPEKRMKAIEASHKNRQKELANRGDEMLGELT # DFVAGKKLKMTGGAEEAERVRQKRNDMTLKAMFTGSSAADISPMGGDVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 Scaffold_15 AUGUSTUS gene 886074 887807 0.81 - . g375 Scaffold_15 AUGUSTUS transcript 886074 887807 0.81 - . g375.t1 Scaffold_15 AUGUSTUS stop_codon 886074 886076 . - 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_15 AUGUSTUS CDS 886074 887807 0.81 - 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_15 AUGUSTUS start_codon 887805 887807 . - 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MNSVIILKRSISILWTDYVPYPDDSKEQVALQAAENRFAADQLSSTMTILARDDKRQHPVVSEAEERKLPQVPTQLGI # GKERLSIEVCAPVTFASGVRLFSQIGTRPKEEKPSEKVRNMFAGLPLTRDDSDSRSEKMSASDQRSSPRKPHSPSKRFQINIGKATRRTTRVGSTRRR # SSSSSISLSPSKGSKDAEPAFETEVIPRLPPPLSIGASIPPLMSTSSSTESLLPTAFVLPPPSPCASLPPPKPALLLSGASTLPLLMPTFQTSQEQEP # SENNKYISQPSLQSHVPPSATPTDPVDSVPQTPLAGARRAFPYPVAKPLATHMIHAYSPVRPSPLSRILMLGNSPGSPSNVALDPNSNSRGLEVLMET # DELENDFPGDGLLKTELFPPTPQSRASSDDEGGLTLAQQLGVSESPPESPVCARPESLLREKKVQSNVVRRSHSSKTITNKARIPSSKPTFGVSKPRT # SSTVEKGPGMKVKARSMGILPVTKNTTRMSDRLTSVGIGGNEKENSSHASGSAGSNVNNDKGIVERSSTKSVDANSRKVDFGRGVSGPRRVPIDSAEA # PPIGRRRKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 Scaffold_15 AUGUSTUS gene 896473 897349 0.46 - . g376 Scaffold_15 AUGUSTUS transcript 896473 897349 0.46 - . g376.t1 Scaffold_15 AUGUSTUS stop_codon 896473 896475 . - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_15 AUGUSTUS CDS 896473 897093 0.46 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_15 AUGUSTUS CDS 897173 897349 0.52 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_15 AUGUSTUS start_codon 897347 897349 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MTELADHLHAQGKLRILKDGLGYLDHRHQGLYLGIYVVPGGFRADRRKTILDTQVRIGDSSTNSPNGELHSMMMYTLT # ELMFTRGVDFIKLDFITPGSPDNGVHLPLNTSDDVIAYHKAIKNASRPMRLDISWKLARDEKHFHIWSKNADSFRTDQDINERGSNLTLAAWATVQRA # IDNYRQYIVMHTGKDQTLNLFPDMDNLYIGNSLGEDYDGLSKAQRFTIMNHWMGAASNLMLGNDLTKLDGEFPRAALISISFPLRYEQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 Scaffold_15 AUGUSTUS gene 903926 904429 0.71 - . g377 Scaffold_15 AUGUSTUS transcript 903926 904429 0.71 - . g377.t1 Scaffold_15 AUGUSTUS stop_codon 903926 903928 . - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_15 AUGUSTUS CDS 903926 904429 0.71 - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_15 AUGUSTUS start_codon 904427 904429 . - 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MVLNTEKDDFADEWKIYPGKRVGFGAVRDSAEVPFTSSNWPWRSHRFSELRKCKNDPTEVWEKLAEVPLKTWNPLNKT # ELFEHFENRIPVEGRFRYPDAIMQHLWQIKIIQDSDIQKWNQRVGEMLQMEMSEVYVKKMKEIKDEAEKRQKSRLAEEPSQNSLDTFGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 Scaffold_15 AUGUSTUS gene 914632 916163 0.51 - . g378 Scaffold_15 AUGUSTUS transcript 914632 916163 0.51 - . g378.t1 Scaffold_15 AUGUSTUS stop_codon 914632 914634 . - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_15 AUGUSTUS CDS 914632 916069 0.55 - 1 transcript_id "g378.t1"; gene_id "g378"; Scaffold_15 AUGUSTUS CDS 916159 916163 0.51 - 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_15 AUGUSTUS start_codon 916161 916163 . - 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MRVSWPHSNFLISSTPIPSITITHVTAVSVALPSFSGSNFETLIGGLSPSTDVASSATTPEIITNSQDPSHTITHAAL # ATVAETSIGSDTEATSSSTWIFLATSGITLSPTPIVDPTPHSIPLPATSGDSSNSNGHDQSIQQTMSQPGAIAGVTIGAVILAIALSLLIALCLIKHR # RKRRFFDRDARKSLNPFFKYQAVSPPGSLPHSRDRSMTDMLPDLESASVSQTMEADRQSRRGWNLKAQLRKWRSSNGVIEPFITSRYRLDPDMVESGS # RRMNEARRFSDEDIQNVFTRTQEERLLLRSSSVMSVATTMTAQMRSAMLQPSSSDVEYQINRLHGPLSHRRHDRTQSPSGNSSDSHYHQVSRSNGRHG # NASTETGSSSNTSSKADYQVTLPKATSSTHPRSPLPSYNSFNSPLARASSSEPPQLKRMSFQSTWANDPFLSNEEIERLAADEQEADWAMDGFLEPVA # HDDLPPAYAT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 Scaffold_15 AUGUSTUS gene 922895 923194 0.66 - . g379 Scaffold_15 AUGUSTUS transcript 922895 923194 0.66 - . g379.t1 Scaffold_15 AUGUSTUS stop_codon 922895 922897 . - 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_15 AUGUSTUS CDS 922895 923194 0.66 - 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_15 AUGUSTUS start_codon 923192 923194 . - 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MQMDISFGTELTLGISRGLQNKASLEALLTGVTQARDSLPPSYLTSQRPRLVLKIAPDLDQSQIEDIANVIKNTGIDG # VIVSNTTIQRPSHLLSGEAPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # # ----- prediction on sequence number 3 (length = 1205196, name = Scaffold_12) ----- # # Predicted genes for sequence number 3 on both strands # start gene g380 Scaffold_12 AUGUSTUS gene 7436 7921 0.8 + . g380 Scaffold_12 AUGUSTUS transcript 7436 7921 0.8 + . g380.t1 Scaffold_12 AUGUSTUS start_codon 7436 7438 . + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_12 AUGUSTUS CDS 7436 7921 0.8 + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_12 AUGUSTUS stop_codon 7919 7921 . + 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MDIEKFNLKWSSTLTTLRNYGYDIPWDTLISKYISKLPSGPRYVYLKQTLEEEFDQPGIIPNRDLFDKFAIRLENTRN # RELLDLADSGGGAYNRRFQRNGNGGTSDKPSEPQKPKDSPNVSKPNNKPSAYVTTVTSPTSNTTSKIEPVDNVNPVPNVIPDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 Scaffold_12 AUGUSTUS gene 10080 10286 0.76 + . g381 Scaffold_12 AUGUSTUS transcript 10080 10286 0.76 + . g381.t1 Scaffold_12 AUGUSTUS start_codon 10080 10082 . + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_12 AUGUSTUS CDS 10080 10286 0.76 + 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_12 AUGUSTUS stop_codon 10284 10286 . + 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 Scaffold_12 AUGUSTUS gene 10385 10942 1 + . g382 Scaffold_12 AUGUSTUS transcript 10385 10942 1 + . g382.t1 Scaffold_12 AUGUSTUS start_codon 10385 10387 . + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_12 AUGUSTUS CDS 10385 10942 1 + 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_12 AUGUSTUS stop_codon 10940 10942 . + 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLE # TVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGI # KLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 Scaffold_12 AUGUSTUS gene 11334 11603 0.81 + . g383 Scaffold_12 AUGUSTUS transcript 11334 11603 0.81 + . g383.t1 Scaffold_12 AUGUSTUS start_codon 11334 11336 . + 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_12 AUGUSTUS CDS 11334 11603 0.81 + 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_12 AUGUSTUS stop_codon 11601 11603 . + 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 Scaffold_12 AUGUSTUS gene 11633 13942 0.15 + . g384 Scaffold_12 AUGUSTUS transcript 11633 13942 0.15 + . g384.t1 Scaffold_12 AUGUSTUS start_codon 11633 11635 . + 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_12 AUGUSTUS CDS 11633 13022 0.28 + 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_12 AUGUSTUS CDS 13135 13375 0.18 + 2 transcript_id "g384.t1"; gene_id "g384"; Scaffold_12 AUGUSTUS CDS 13465 13942 1 + 1 transcript_id "g384.t1"; gene_id "g384"; Scaffold_12 AUGUSTUS stop_codon 13940 13942 . + 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDD # ERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPF # KFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTDGYKRCE # QETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTS # ETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE # TNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 Scaffold_12 AUGUSTUS gene 15030 16037 0.96 + . g385 Scaffold_12 AUGUSTUS transcript 15030 16037 0.96 + . g385.t1 Scaffold_12 AUGUSTUS start_codon 15030 15032 . + 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_12 AUGUSTUS CDS 15030 16037 0.96 + 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_12 AUGUSTUS stop_codon 16035 16037 . + 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MFIANFAKKAAPLTKLTSVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKK # FFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRI # TPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFS # RNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQNMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 Scaffold_12 AUGUSTUS gene 16359 17398 0.24 + . g386 Scaffold_12 AUGUSTUS transcript 16359 17398 0.24 + . g386.t1 Scaffold_12 AUGUSTUS start_codon 16359 16361 . + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_12 AUGUSTUS CDS 16359 16930 0.24 + 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_12 AUGUSTUS CDS 16981 17398 0.7 + 1 transcript_id "g386.t1"; gene_id "g386"; Scaffold_12 AUGUSTUS stop_codon 17396 17398 . + 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQA # LSKHNSFIEKVRRVEHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNI # HELIDLTAEQLDLMVEDEDEYWMSPENDYIFDAIPHLRLSDTDSDENSVRERINN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 Scaffold_12 AUGUSTUS gene 20172 20516 0.79 - . g387 Scaffold_12 AUGUSTUS transcript 20172 20516 0.79 - . g387.t1 Scaffold_12 AUGUSTUS stop_codon 20172 20174 . - 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_12 AUGUSTUS CDS 20172 20516 0.79 - 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_12 AUGUSTUS start_codon 20514 20516 . - 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDDKGHLVESSPPPDSATEALEGLKEVERGSADEGTS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 Scaffold_12 AUGUSTUS gene 21432 22145 0.53 - . g388 Scaffold_12 AUGUSTUS transcript 21432 22145 0.53 - . g388.t1 Scaffold_12 AUGUSTUS stop_codon 21432 21434 . - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_12 AUGUSTUS CDS 21432 21871 0.98 - 2 transcript_id "g388.t1"; gene_id "g388"; Scaffold_12 AUGUSTUS CDS 21935 22145 0.54 - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_12 AUGUSTUS start_codon 22143 22145 . - 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFFSSPRSTR # SRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKIAPTTAKGKSRQVVVSDDDSASNEVESED # EEEDEDEEEDSAPPPKRLKTTSSLPGKTLFFFLFDFINSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 Scaffold_12 AUGUSTUS gene 27033 28540 0.47 - . g389 Scaffold_12 AUGUSTUS transcript 27033 28540 0.47 - . g389.t1 Scaffold_12 AUGUSTUS stop_codon 27033 27035 . - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_12 AUGUSTUS CDS 27033 27362 1 - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_12 AUGUSTUS CDS 27445 27841 0.63 - 1 transcript_id "g389.t1"; gene_id "g389"; Scaffold_12 AUGUSTUS CDS 28054 28390 0.7 - 2 transcript_id "g389.t1"; gene_id "g389"; Scaffold_12 AUGUSTUS CDS 28462 28540 0.74 - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_12 AUGUSTUS start_codon 28538 28540 . - 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRPIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHD # DLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPVLLSLLTSPTSNVLCWNSLGVQGGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNF # GVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEFFVLTIVIGNARKLESVRLPSG # SSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIE # VVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 Scaffold_12 AUGUSTUS gene 34552 38462 0.22 - . g390 Scaffold_12 AUGUSTUS transcript 34552 38462 0.22 - . g390.t1 Scaffold_12 AUGUSTUS stop_codon 34552 34554 . - 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_12 AUGUSTUS CDS 34552 36707 0.69 - 2 transcript_id "g390.t1"; gene_id "g390"; Scaffold_12 AUGUSTUS CDS 37848 38343 0.22 - 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_12 AUGUSTUS CDS 38457 38462 0.87 - 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_12 AUGUSTUS start_codon 38460 38462 . - 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MFVIVNSVTLFWVSHYGLQHDEHARACSRSQSDDESIRFKSFITTQNSNNLESKSSDVAAEMTASELPLVPLRPLEVP # IIDVNGNQPQIGHIIHHDKDSKDEEFNHHASDFSPVSGSTDPEAAIVAIRTGSVYVDVDADEIDSFTGPESVVFASMPPVTQTNHRDHTQEQLKVVNE # LLLEANEARKSVDEARKSAEDSKKDALSQRDWFKSELDRIRIEWSAKSSESQTLLDQTRVELKDIKFEFNNAKAESKEACNELEAIRLEKDTARNERD # QAVKMLHQAQLQTEEWKREYEKREGEACILSYISMFSDTHKHHQVTHLHTQIAYWKDQAKKWHAFVVDSTHRQSKKIKSESAIAAVAPLTPASASGYS # SRRRGVDDEEQSEEIEDEDDTDPDSPIDSQRRRNPVATTFGNTTTLRQGAGVDTFNATGSEGNFQTPKTLTRTPKTVKPSTSGLTSTARAKAATSTSS # AHPSSSSKPALSRNEVLLSSRARRRDEVGTSHDNRGRQEDEVHSRDLNDPEDSQGEYERDKSLSSLVYPADPDRVLPIPPRTPHNPRIPRIRHDTHQA # SHDDRITHPVIAPTSSTSKAKAPPRSVIHSRLIRPVREYQFVVDIKEEDDEPGVISGSSGGKVNGPVHHTSNREVFEDVYDGEIEDDELEEPSGDDTQ # PTPTRERAKRKGKARATERVLEHRSQSAWNLFDDEQVEDSVGVEAETAPVVGSLTGIGSSSKRRGRECSKKTGRVKSRGKSDIDSSRSRSRLKPKPKH # VDGDNDLDDENDPNSEHGDDGDNKVEYHRPIQRTRHRANPSRLSSPSLASSEDELMITSNGVGGIGDSPKTTRTGASRTPHHDLHHDSYSSHPSSSKK # RPPTPLTSNTSDGGTASRKRRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 Scaffold_12 AUGUSTUS gene 44520 45931 0.59 + . g391 Scaffold_12 AUGUSTUS transcript 44520 45931 0.59 + . g391.t1 Scaffold_12 AUGUSTUS start_codon 44520 44522 . + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_12 AUGUSTUS CDS 44520 44950 0.59 + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_12 AUGUSTUS CDS 45016 45931 1 + 1 transcript_id "g391.t1"; gene_id "g391"; Scaffold_12 AUGUSTUS stop_codon 45929 45931 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MASLCHTIRQNQRDNSGNGSYDSFDDLLRQHAMELGEDEPSSSGIVSSTKLSKRTPNNTSTGAAQFSYSKASLLAGSP # IDFSSGSSSSSDADADGETDEELDAESDDSSSDSSESDSDVDFMILDCNPSPREYSAKPQLPVDVSVEPEDAPFIPQPTQPVHEHDSVAVFASDYPAA # SSPRLAPSDPLQFTSPFHSPTLPHRAFTPGPFTVLSAEIYDKAAVDPTPPMNLSATSMINQLQPVSKRKRVPTSSKRTSKARATTISDDDDEYKNNGS # DDDDEYAPSPPLAPKSRKRGRTVAVSRHRTSRRKQGVSPSSTSSRPTSSRSIPKRRRIAPESRNEQSDSPVLLDAIANTSGEDCDFICPVCGWEQSNK # RMPDYQRHLKTHLRPDREDKTKGWWCKGVRLEDKDEFNVKCEVNGSRKVRDDADPYWFHDHMESGAAARRLVGETR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 Scaffold_12 AUGUSTUS gene 57217 58278 0.93 + . g392 Scaffold_12 AUGUSTUS transcript 57217 58278 0.93 + . g392.t1 Scaffold_12 AUGUSTUS start_codon 57217 57219 . + 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_12 AUGUSTUS CDS 57217 58278 0.93 + 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_12 AUGUSTUS stop_codon 58276 58278 . + 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MSVVSLRTAREMHDVADLLGSAIDAPVDRPRHERAKSDETILDPSVHPPTTDDESDVDKHSSSISSPSRSRLSYASTY # SQPSEFELVTADGQIERVYLPPSPSFSGFNIPRSRTSAISETPSLASSRSRSSYSSTSSHQLPPTPGIITPAEFADGTLLPVIVEKQSEGQEWSSNSS # SEEISVLHVSPPDTLVSSWPKQKSKLRWKVPISPRRDAITEEVRRPDSPGPWSPSFFDTLSPMSQNSPTTPSPTSPSTKTSPFSLFTKREKGSRSSLT # SSISSQASQLPLDNKTMKAEEKRRRKEEAKARTEKLAEQLKAKSKERARMEADNNSNFSAERRKKEPGAMYGGIAGVVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 Scaffold_12 AUGUSTUS gene 71805 74260 0.32 - . g393 Scaffold_12 AUGUSTUS transcript 71805 74260 0.32 - . g393.t1 Scaffold_12 AUGUSTUS stop_codon 71805 71807 . - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_12 AUGUSTUS CDS 71805 72965 0.56 - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_12 AUGUSTUS CDS 73075 73517 0.44 - 2 transcript_id "g393.t1"; gene_id "g393"; Scaffold_12 AUGUSTUS CDS 73672 74260 0.56 - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_12 AUGUSTUS start_codon 74258 74260 . - 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MIGRSITRAAEQGHRGRSKVAKIRDDNLAKLRNCKTNAQFWMLYKSWLDPKAKDFELSLNRLYTEFKTRLNTPVIPSL # QLNHQHLSYLKHLEAMLPEANLDPTEQKFFSLTIHEEEVADAKEHVLECNLNSAIGSDSISYKEIMDIPNENIASFLNFCVKNKTAPSKWLYAIVIGI # LKPGKNASDPNGYRLIVLECYKAKSLGTPLYFAYMDWTNAFPSTDRSVMWIKLFSMGVKGPMIDWLRMLYAKMAYVVRVCGSHSEPFGGDMGVITGSP # VSPNLFNLVVADFKVTEHPTDVVLHDKHVTICYKQMTQEWLVQHLLVSNQNLDNLNNMHPSQASKSLYLNTGQGGIYKDNYQKLADKAKNAAGAVLHA # KTFVGNDMPIKDMITMYWARVDPYLKNGSEFIMDVVVSHREQLEEVQHYFLRRALSIQKRSSLEVLFTETGVMPIRYRRIILFFKNMQYLISLPHHHL # AWKAMREAYSLAQKGHTSIILEACRVLESLPIPVTWNIPEFEDITAAHLNGLIEHIQDSMERTLQNALMTCPRTADTLKDRKEYDRKNKKMVFKALAF # RHYLTVPTGKHRKALIHMVTGNHQLAVERLRWNERNRPRIIREHRICRICKCSVEDPAHVLFECKGSTELIKLRDSFMQKVISELPQYAKSYSNAWML # FRILLAETRITELFAKLTYDVLEVVYNTEMFVPLNAGAAHMHCRDGEDRARFTRFFFLLFPHQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 Scaffold_12 AUGUSTUS gene 74696 75421 0.92 - . g394 Scaffold_12 AUGUSTUS transcript 74696 75421 0.92 - . g394.t1 Scaffold_12 AUGUSTUS stop_codon 74696 74698 . - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_12 AUGUSTUS CDS 74696 75421 0.92 - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_12 AUGUSTUS start_codon 75419 75421 . - 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MLIISQYRYIHFTDVAPEEQLFETIRICALVDSSKKTVVATDANGRTSSRTPKAAHLTRLSQDTEINARGLRILQLCE # EMNLAIVNGTELESPNRGSYTSHQHNGKAVVDYILVSDELCPMIQNLSVEVRPLSKKDQWSDHSKLSLVMSREIYTMTAQRSSQPKVPLTIPIHDEWT # DTLYQEMLQSGKPPHLLLRDFYGPVYYDQNPISVYTDGSCLENGKDYARAGSGICSDYSLTRTLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 Scaffold_12 AUGUSTUS gene 77568 78164 0.77 - . g395 Scaffold_12 AUGUSTUS transcript 77568 78164 0.77 - . g395.t1 Scaffold_12 AUGUSTUS stop_codon 77568 77570 . - 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_12 AUGUSTUS CDS 77568 78164 0.77 - 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_12 AUGUSTUS start_codon 78162 78164 . - 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MTDPSGRSSPGEINNLLIWEQPHPLVFATYEYRAFPSLSTLEKWKDVVKATADWMAVFAWFNASTGVYDLGPPLYVVS # EDTSPNVTVNPAFELAYWRFGLGLAEAWFNELREEVPRDWTTVKNNLAPLPIQNNGTSTVYAVYEGIEPDFWTDPAYINDHPSLVGLHGWLPPTEGLD # LGIAKVTMEEVWARWNFSNSWG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 Scaffold_12 AUGUSTUS gene 80708 81661 0.56 - . g396 Scaffold_12 AUGUSTUS transcript 80708 81661 0.56 - . g396.t1 Scaffold_12 AUGUSTUS stop_codon 80708 80710 . - 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_12 AUGUSTUS CDS 80708 81661 0.56 - 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_12 AUGUSTUS start_codon 81659 81661 . - 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MCDRYMRICGLAAGYLRGECEFQEEFPLETLRNYGRQFSESRSSIGDELPPPPYSQDGSSTSPTSVSIASQNNLIKYD # QASRRPRVRPLPPVPAVAVASGSTAPLLFHEKTVSPLPVPLPEIYRDRTGVPSASSSRRKQVLDVLFIPQSDALADSTTGHSISSGTPVHNTLESDII # TEQRELDLRPLSLSISDTLSPTSSLNSPESPSSSPCLTSPSTIRRRFSLFRKKEKEKRFSLPSSMSSEASQLSLDNKALKAEEKRRKKEESRARTERL # AEQLKARAEEHAQSEVDHNSTISAERRNKEPSAMYGGITGVIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 Scaffold_12 AUGUSTUS gene 91165 91770 0.9 + . g397 Scaffold_12 AUGUSTUS transcript 91165 91770 0.9 + . g397.t1 Scaffold_12 AUGUSTUS start_codon 91165 91167 . + 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_12 AUGUSTUS CDS 91165 91770 0.9 + 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_12 AUGUSTUS stop_codon 91768 91770 . + 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MNQSSNVKENIPLNKERYKAIEAEHDNKKYHTSHPHNNLNPPILSMASSSTTSPAEEAGNTIMSAHYLLSPLETLDES # LNDSHEERIGLHDLTETYNLLATRIKEILLQSSEPDQAASPLTLLAERSHVLLSALRRDVKRVLINPRTTSPKERSQGMDLDEVHYARDLALLGQQAI # RLTSELFAFPQLNATMHGMIHHSMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 Scaffold_12 AUGUSTUS gene 94143 95280 0.43 + . g398 Scaffold_12 AUGUSTUS transcript 94143 95280 0.43 + . g398.t1 Scaffold_12 AUGUSTUS start_codon 94143 94145 . + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_12 AUGUSTUS CDS 94143 94427 0.91 + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_12 AUGUSTUS CDS 94483 95280 0.43 + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_12 AUGUSTUS stop_codon 95278 95280 . + 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MQIFPLYEDILQRLRKEEPNERTLGLLWKLFLSPIERPVPSKEAVKAFEFFWFATYHGKDILFEPELIGYLKGLDMAL # GVGLAAGLTQSDDSQQTTGSLVPETQSLEPVPLTGSQILEKWFDTFTHADKANDPKIVPPSSSPIREPEISLPGGAAESSNLIPMLIDDEIPENQSNS # ASPGGFKRKRRQEDEEIVEETPAPISSVRISQREGAVPDIDELNNGSPDQRTKLKEKSKFKDKGKGRALSASEKQLKTPTKSGQKASETRSWIRESQL # MTPEPSAPPSSHHGHAAAVSVSLDEDEDDEDYGSWENAVVSPETFLHISRELDVDMDAPDTNMVERGEPITATRRHSNTLPHLSSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 Scaffold_12 AUGUSTUS gene 108215 109696 0.24 + . g399 Scaffold_12 AUGUSTUS transcript 108215 109696 0.24 + . g399.t1 Scaffold_12 AUGUSTUS start_codon 108215 108217 . + 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_12 AUGUSTUS CDS 108215 109696 0.24 + 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_12 AUGUSTUS stop_codon 109694 109696 . + 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNG # TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN # LAVWMTRIEELSIDLEFRSTPRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 Scaffold_12 AUGUSTUS gene 109746 110345 0.67 + . g400 Scaffold_12 AUGUSTUS transcript 109746 110345 0.67 + . g400.t1 Scaffold_12 AUGUSTUS start_codon 109746 109748 . + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_12 AUGUSTUS CDS 109746 110345 0.67 + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_12 AUGUSTUS stop_codon 110343 110345 . + 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIKKDYYAQDTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 Scaffold_12 AUGUSTUS gene 110635 112227 0.5 + . g401 Scaffold_12 AUGUSTUS transcript 110635 112227 0.5 + . g401.t1 Scaffold_12 AUGUSTUS start_codon 110635 110637 . + 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_12 AUGUSTUS CDS 110635 111159 0.97 + 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_12 AUGUSTUS CDS 111257 111510 0.51 + 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_12 AUGUSTUS CDS 111798 112227 0.91 + 1 transcript_id "g401.t1"; gene_id "g401"; Scaffold_12 AUGUSTUS stop_codon 112225 112227 . + 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MKDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGL # ARIFHLNLVKLRCTYSYTYRIKAPFQVLLGRPFDVLVESEIKTFGNGDSEKTISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNENRQQ # NIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPINFEKVRYESRQRKKG # KAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGD # PLLELPELSKHPKPFASYGKIYGREERDYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # start gene g402 Scaffold_12 AUGUSTUS gene 113270 114346 0.81 + . g402 Scaffold_12 AUGUSTUS transcript 113270 114346 0.81 + . g402.t1 Scaffold_12 AUGUSTUS start_codon 113270 113272 . + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_12 AUGUSTUS CDS 113270 114346 0.81 + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_12 AUGUSTUS stop_codon 114344 114346 . + 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA # LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIM # GDGETEEPYQFDNFKDQIDPKSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFVRNLFPTFDEEFVQNNPYPEAHRSSEGNRLD # ELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVLCNK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 Scaffold_12 AUGUSTUS gene 115908 117321 0.55 - . g403 Scaffold_12 AUGUSTUS transcript 115908 117321 0.55 - . g403.t1 Scaffold_12 AUGUSTUS stop_codon 115908 115910 . - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_12 AUGUSTUS CDS 115908 116302 1 - 2 transcript_id "g403.t1"; gene_id "g403"; Scaffold_12 AUGUSTUS CDS 116384 116519 0.86 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_12 AUGUSTUS CDS 117154 117321 0.74 - 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_12 AUGUSTUS start_codon 117319 117321 . - 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MPIHQKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHELLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS # RQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSNELLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 Scaffold_12 AUGUSTUS gene 118402 120949 0.22 - . g404 Scaffold_12 AUGUSTUS transcript 118402 120949 0.22 - . g404.t1 Scaffold_12 AUGUSTUS stop_codon 118402 118404 . - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_12 AUGUSTUS CDS 118402 118929 0.9 - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_12 AUGUSTUS CDS 119053 119090 0.83 - 2 transcript_id "g404.t1"; gene_id "g404"; Scaffold_12 AUGUSTUS CDS 119186 119220 0.22 - 1 transcript_id "g404.t1"; gene_id "g404"; Scaffold_12 AUGUSTUS CDS 120426 120949 0.23 - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_12 AUGUSTUS start_codon 120947 120949 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MASTSSQTRAVASTILLPSSLAEAQELLAGIKSKSSLPSFFDSSEYQRLLDGKYVPPILSSQNSPDYDGLSALPIFLY # PRALVSFSFPQDSQFPLSVASGLDLFCCARMIIRSLQASVESSGDSDEIYEAIEEAAPFLVRSYSSFLSLLFINFHFRIISMIFGLDVPTVLYLPNFL # QFLRRLAFQLYVDLAMDALNALHELRTQLDRLGSLFDQARQSFLQSFRDLQQAGQDPIVVLEALKAADPQRKSLSVEDWTVLATLFQWSSPFNLNGLN # FDNRTPAEWIDLLRGLHSGASSATVTADGHLVDDSQPPAAAVEVSEALDPQGSLPNTVVEKASGVEDLASLSEGSPIQTELDLPQIESLTEPTLSPEK # GI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 Scaffold_12 AUGUSTUS gene 125893 126735 0.33 - . g405 Scaffold_12 AUGUSTUS transcript 125893 126735 0.33 - . g405.t1 Scaffold_12 AUGUSTUS stop_codon 125893 125895 . - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_12 AUGUSTUS CDS 125893 126735 0.33 - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_12 AUGUSTUS start_codon 126733 126735 . - 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MNFSFFYGRESQCPLFTSAKQAPVHTSLEQRICSGLLRSANSLTDQAMDVDSRTYHKSVRIKKRHPCGMNEQSNFYDV # ITIRLILKPRVCLSFTFPFKLNKGYYVPYMIEATWRYFTSLFFIPSFHGSQPYTKNHSSSSAGPRSSPRRHNMLLRSITRPVEIIQTPATVDPSTPNS # PVHTSEHSFLNETSVCPHIPSLVPPSDDLPKPEEASSSSLGLPLDLVMPEEPDATSILETMFSETREKFYDEQEKSIQFAIEYAELLSQQCSVSASTY # GLCSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 Scaffold_12 AUGUSTUS gene 130942 131640 0.86 + . g406 Scaffold_12 AUGUSTUS transcript 130942 131640 0.86 + . g406.t1 Scaffold_12 AUGUSTUS start_codon 130942 130944 . + 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_12 AUGUSTUS CDS 130942 131640 0.86 + 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_12 AUGUSTUS stop_codon 131638 131640 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MSKWRLQKPVTFNHSQVTSSFSRSDGDSSRTIQGGTVETSSTEGPPLPARRWSRVLPTSRTSSTPTSTPVHVSGDPTA # KSAPVFRKQVMLDREQAPHTIPLRDSRSRNLEHQREHDGQNSLNATSTKHRQTFSNRHPSIKESGTNSSSSSSTSSDVWESYVDSLDSGRKTGKSHFG # PKPERRGSLIQKMRAMPEDINDTQKDYRAVRLRKENFRKNKVFVEKKYLWTFTSRH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 Scaffold_12 AUGUSTUS gene 132811 133659 0.99 + . g407 Scaffold_12 AUGUSTUS transcript 132811 133659 0.99 + . g407.t1 Scaffold_12 AUGUSTUS start_codon 132811 132813 . + 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_12 AUGUSTUS CDS 132811 133659 0.99 + 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_12 AUGUSTUS stop_codon 133657 133659 . + 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MNDSNGKPVKVATPGMAVTVSGWKSLPTAGDDVLQGSETNIKKAIANRERKAEIDSSLADVEAINQTRRQEREKRELE # LQSGKDAAAADEQTEDGPKELRLIVKADVSGSAEAVVGALQGIGNDVATTKVISSGVGDITDTDVTLAQTAGGAYLFCYFVSSNPHIRIGMIVAFNVN # ASKQVQVAAAQKNIIILSSGIIYKLMDDVQEHVIKLLPVIIEKKITGEAQVLQIFDIQAKKQVVKVAGCRVTNGTVERSKQARVIRNGETVHEGVFDP # AGYVFHSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 Scaffold_12 AUGUSTUS gene 134699 135109 0.85 - . g408 Scaffold_12 AUGUSTUS transcript 134699 135109 0.85 - . g408.t1 Scaffold_12 AUGUSTUS stop_codon 134699 134701 . - 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_12 AUGUSTUS CDS 134699 135109 0.85 - 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_12 AUGUSTUS start_codon 135107 135109 . - 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MASLLIELPRSLLKVSPKGCVETDRHTNDVPDPESKAPAAFTAEKEIAKAPSKVLEVSAASSDPAPPPATAKVVPATL # PVVTEEEDDLSVSITPGTSCRRKGCNVTFISDDENRLGDGEGTRCKYHPAPVRASLKE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 Scaffold_12 AUGUSTUS gene 137033 137359 0.53 - . g409 Scaffold_12 AUGUSTUS transcript 137033 137359 0.53 - . g409.t1 Scaffold_12 AUGUSTUS stop_codon 137033 137035 . - 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_12 AUGUSTUS CDS 137033 137359 0.53 - 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_12 AUGUSTUS start_codon 137357 137359 . - 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MTAALCGAIAGGFQAIVAAPAENVRLLFEGGSVYHSWSHAWKDVFRGTEFRGLGSRQKKIEDARQVRRWMKEVGDMAG # RGWNGWIWGCAKDTTGSPRFFLHFGCPHDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 Scaffold_12 AUGUSTUS gene 143482 144477 0.81 + . g410 Scaffold_12 AUGUSTUS transcript 143482 144477 0.81 + . g410.t1 Scaffold_12 AUGUSTUS start_codon 143482 143484 . + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_12 AUGUSTUS CDS 143482 144477 0.81 + 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_12 AUGUSTUS stop_codon 144475 144477 . + 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MASALVDYHPSSESLPFVSESATAENINSFNAVDRDVSSFAGSLPANQGLYMNENEKDSCGVGFICHVKGEANHKIVS # DARQLLCAMTHRGATGADSRDGDGAGVMTGIPHEFFKREAERDLGCTLPEPGEYAVGNIFFKANDPVGLQSQQAVFSNIASDLGLRVLGWREVPTDGS # ILGPAASSKEPAILQPFIVLRAHYGSGTVSQGGTFDATHLERQLYVLRKHATHSMFVNFPCLNISKQKLNVFVTFLLLRTLAKGFYICSLSTKNIVYK # GQLSPPQVYNYYHDLNHVLYRSHLALVHSRFSTNTFPSWDRAQPMRWAAHNGTCSFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 Scaffold_12 AUGUSTUS gene 144543 145895 0.61 + . g411 Scaffold_12 AUGUSTUS transcript 144543 145895 0.61 + . g411.t1 Scaffold_12 AUGUSTUS start_codon 144543 144545 . + 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_12 AUGUSTUS CDS 144543 145895 0.61 + 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_12 AUGUSTUS stop_codon 145893 145895 . + 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MRAREGVLSSQNFGDELDLLYPIIETGGSDSAAFDNVLELLVVNGVVTLPEAIMMLIPEAWQGNENMESEKRAFYNWA # ACLQEPWDGPALFAFSDGRYCGANLDRNGLRPCRFIVTNEDIMICASEVGVLFIPPEKVVQKGRLKPGRMLLVDTLEGRIVDDKELKRTTAAKQNFAS # WVETHVLHVPKIMKRARRSGAVLEPKLDDYPLSTDPKLLAFGYTVEQLNLLILPMLYDGKEALGSMGNDAPLAAMASAPRVIYDYFRQLFAQVTNPPI # DSIRESIVMSLEAYVGPEGNLLEMKPEQCHRILLPSPVLSIEEMNAMKNLKSAYLTWPSRTIDITFPKEEGLPGYKFALERVCSEATQAIDDGVKVII # LSDRNVSMSRVPLSALVACGGVHHFLVAQKKRAKVALMIETAEAREVHHLCVLVGYGADAVSPWLLMETVHKVGREKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 Scaffold_12 AUGUSTUS gene 145973 146623 0.47 + . g412 Scaffold_12 AUGUSTUS transcript 145973 146623 0.47 + . g412.t1 Scaffold_12 AUGUSTUS start_codon 145973 145975 . + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_12 AUGUSTUS CDS 145973 146623 0.47 + 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_12 AUGUSTUS stop_codon 146621 146623 . + 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MDNYRHSVDNGILKVMSKMGISTLQSYKGAQIFEILGLHSEVVDRCFIGSASRIQGATFDLLAMDAFELHERGWPTRE # TILPPGMPESGEYHWRDGGEAHINDPTGIAHLQDAVREKNQTAYDAYARNADAQTSQIHLRGLLDFRYENNTPIPIEQVEPWNQIVRRFVTGAMSYGS # ISMEAHSTLAVAMNRLGGKSNTGEGGEDAENLMSSATETL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 Scaffold_12 AUGUSTUS gene 146707 149003 0.73 + . g413 Scaffold_12 AUGUSTUS transcript 146707 149003 0.73 + . g413.t1 Scaffold_12 AUGUSTUS start_codon 146707 146709 . + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_12 AUGUSTUS CDS 146707 146757 0.73 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_12 AUGUSTUS CDS 146859 149003 1 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_12 AUGUSTUS stop_codon 149001 149003 . + 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MAQGAKPGEGGELPGHKLIYDLKCANPRARVSVKLVSEVGVGIVASGVAKAKADHILISGHDGGTGASRWTGIKYAGL # PWELGLAETHQTLVLNDLRGRVTVQTDGQIRTGRDIAIACLLGAEEWGFATTPLIAMGCIMMRKCHCTFIVHSPFLYLTQSFITVNTCPVGIATQDPQ # LRAKFAGQPEQVINFFYYLAEDLRSYMAKLGFRTINEMVGRADVLKVNEKMRTPKTAHLDLSAILKPAWQMRPGAATYRVRQQDHKLYIRLDNKFIDE # SEPALTKGLPVHIECDILNTDRALGTSLSYRVSKLYGEEGLPRDTIHINMKGSAGQSCGAFLAPGITIELEGDANDYVGKGLSGGRLIVYPPKASVYK # AEENIIIGNVCLYGATSGEAFIRGIAAERFAVRNSGANAVVEGTGDHGCEYMTGGRVVVLGNTGRNFAAGMSGGIAYVLDTAHTFASKVNMEMVELGK # VTDPREIAALRSLIEDHRHFTGSEVADRVLHDFHHLLPLFVRVMPMDYKRVLEEQAAREKEEKIRSSIIDMVPSRTASQVDLASEGLEDILLPKTPLP # SATPKRHEPSVVDLEDSLVDESTQKQRLNKLDKTRGFMKYKRLAEAYRPPRKRVKDWKEISTRLTESELSYQSARCMDCGVPFCQSDTGCPVSNIIPK # WNDLVFKGQWQDALNRLLLTNNFPEFTGRVCPAPCEGACVLGINEQPVGIKSIECAIIDKVRTTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 Scaffold_12 AUGUSTUS gene 153945 154980 0.62 + . g414 Scaffold_12 AUGUSTUS transcript 153945 154980 0.62 + . g414.t1 Scaffold_12 AUGUSTUS start_codon 153945 153947 . + 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_12 AUGUSTUS CDS 153945 154425 0.62 + 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_12 AUGUSTUS CDS 154514 154980 0.97 + 2 transcript_id "g414.t1"; gene_id "g414"; Scaffold_12 AUGUSTUS stop_codon 154978 154980 . + 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MSSKVKRTYASRSDKPKPCFLSPASAPSSPPPAPSIKRKRLFGDSQSQVDASAKRVKSSKEKLRQKTLKQLHFCIDQS # IVRTCAICKLSYTKGAEDDEALHRAHCARVQRGMEWGKEEERDKAGAGNVKEIVEVVKLKDGKKGRIICVDATVGGKIGSKATSTLSPEALRASKAYL # FLLPAITPNKEKIVGCIFAQRIEKAMAVAPPSSSSIPENDDATPSSRSLLTVDDTSGLFCYPELLPTALGISRIFVTSTQRRQGIASGLLSAAAQTAI # HGCVLDPKDGQIAFSQTTGDGIALMRNWGQGGIRIYDEDNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 Scaffold_12 AUGUSTUS gene 174744 175715 0.89 + . g415 Scaffold_12 AUGUSTUS transcript 174744 175715 0.89 + . g415.t1 Scaffold_12 AUGUSTUS start_codon 174744 174746 . + 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_12 AUGUSTUS CDS 174744 175715 0.89 + 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_12 AUGUSTUS stop_codon 175713 175715 . + 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MLQLLQASPNLRRIQFNALVPDIEVAPWTLLQSFEATAGVLLKDLFTILKSCSRLQFCDACLLVENEEDSPSPSLESE # LVLQNLHTLNLSELLEEELTTVLRCLTLPALRKLSLSGPSDEPVYEWPHQSFIKLLSRSQCHLESLSLNNLAFSADQVINYLCLPNVNDTLEDLEIKQ # WEWPIPSEVLKHVTFKLPSTTSITSTSSPSMPTISLPKLHSVSLIVHAVAQAVPLRDFVASRWYNIARNDVPLPIPRLKRIQILLAVPFLPNASVSSI # ETIERVFRRVSLVARVDLNEFTIQPSAHELHAYTAIEKLDEDGFFDYTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 Scaffold_12 AUGUSTUS gene 185146 185991 0.95 - . g416 Scaffold_12 AUGUSTUS transcript 185146 185991 0.95 - . g416.t1 Scaffold_12 AUGUSTUS stop_codon 185146 185148 . - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_12 AUGUSTUS CDS 185146 185991 0.95 - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_12 AUGUSTUS start_codon 185989 185991 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MSARTPFIPNNSRPASRATHTKDDSASTPARDASFTPDLSNPLHADILKSTFQVPSSIKDSDLSDHNSSAGKNASKST # NLNGLFRTSSGSQGSLNLSGRKSNANQTNSTSTESPSLLATAKALSIRREQAGTPSVFAPKPLNAVSAADLLSSSSFKTPALPNSSVTNLLVKNEAHI # SNGNEENPHPASQYKLGNAPPQRVLLHDDDSTRIIPTSMAGLIPKHGRRDHDRSTKKRGRVELDADDDMMYANHMDPGPAKRYKTNAPIQVGIDPRSY # MVEEDVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 Scaffold_12 AUGUSTUS gene 189688 190233 0.93 - . g417 Scaffold_12 AUGUSTUS transcript 189688 190233 0.93 - . g417.t1 Scaffold_12 AUGUSTUS stop_codon 189688 189690 . - 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_12 AUGUSTUS CDS 189688 189907 0.93 - 1 transcript_id "g417.t1"; gene_id "g417"; Scaffold_12 AUGUSTUS CDS 189965 190233 0.95 - 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_12 AUGUSTUS start_codon 190231 190233 . - 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MTQLTQEKSGAEAEEREELLQNESEGEEESQQGEEEEVPAEDPRFHQPTPSPFKRILLLLFIAFLFWFAIVLGRARIL # RSQKPQIVYANRYSTEHKFRPAASPIITETLKDGRLRIRGAGPTASATPTPTPATPTKKVKKRKTSKKLGKKSKKAKQFKGASR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 Scaffold_12 AUGUSTUS gene 192433 193093 0.35 - . g418 Scaffold_12 AUGUSTUS transcript 192433 193093 0.35 - . g418.t1 Scaffold_12 AUGUSTUS stop_codon 192433 192435 . - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_12 AUGUSTUS CDS 192433 192942 0.54 - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_12 AUGUSTUS CDS 193043 193093 0.35 - 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_12 AUGUSTUS start_codon 193091 193093 . - 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MFGITNEPQASAIGNDQASGVGAGNGPIVSFHDAFLSRSDWAGFLPGADRISLDSHPYLCFSTQSSAPISSYATTPCT # AWGADVNSSMSNFGLTQAGEFSNAVTDCGLWVNGVNQGIRYEGTYVADPSFKSVGSCDSWTDWQAYDQTTKDAIKQFALASMDSLQVNSHKLLPNPQN # SDTDASRCNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 Scaffold_12 AUGUSTUS gene 193899 194750 0.85 - . g419 Scaffold_12 AUGUSTUS transcript 193899 194750 0.85 - . g419.t1 Scaffold_12 AUGUSTUS stop_codon 193899 193901 . - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_12 AUGUSTUS CDS 193899 194750 0.85 - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_12 AUGUSTUS start_codon 194748 194750 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MSHPTGGRDYDPLPLTHDQSNPDTLYNTPPSPIPDDPFSSQQGVHGFEHSDDLGVARPRFMGAALYSEGGPNIRDSYA # SSHRTELERNSEYSSSIYALNDQQAPTSLSTPYHDDPRDLAGDRGMSMSPLGKSGGMGGNRYMEEKRAMYASPKSKRKMLLIAGAAAAAVLVIVIVLG # VYFGVVKKNHDSSTASNVASGDSSNSGSSSSSSGNSGSSSTQKTLAVTGGDGSTVTMEDGTTFTYSNPFGGTWYWDINDPFNNGASAQSWSPALNETF # NYGVDRIRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 Scaffold_12 AUGUSTUS gene 197449 198018 0.72 + . g420 Scaffold_12 AUGUSTUS transcript 197449 198018 0.72 + . g420.t1 Scaffold_12 AUGUSTUS start_codon 197449 197451 . + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_12 AUGUSTUS CDS 197449 197504 0.72 + 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_12 AUGUSTUS CDS 197547 198018 0.83 + 1 transcript_id "g420.t1"; gene_id "g420"; Scaffold_12 AUGUSTUS stop_codon 198016 198018 . + 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MTREPYPENTNGVVRTVRRKKQGQKHRRTEHSVKLPVDEEYDEKVMRVPKPLEIGPSLLLTSVPGHRPKSCPHDPSSD # GRACLYTNKQEIDHSLLGGGGRLDSKIDDVDNVGKRVDHRPDTDGPTHCLVESDILVERNDCTNRGTTHERDEVSADWEKNEDDIDVAQHCRGTGDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 Scaffold_12 AUGUSTUS gene 199419 200997 0.21 - . g421 Scaffold_12 AUGUSTUS transcript 199419 200997 0.21 - . g421.t1 Scaffold_12 AUGUSTUS stop_codon 199419 199421 . - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_12 AUGUSTUS CDS 199419 200057 0.69 - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_12 AUGUSTUS CDS 200235 200410 0.73 - 2 transcript_id "g421.t1"; gene_id "g421"; Scaffold_12 AUGUSTUS CDS 200448 200997 0.3 - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_12 AUGUSTUS start_codon 200995 200997 . - 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MGPITISTPAVQSVLSTPAISSPATKFKEPPKRAMEHLWSASDDLLLKSLAEKFPNNWALISECYNAVKVTIKSDWRT # SKDCQERWRERWSPAATQRLMETESTAVEGTPPPSTPILMNVGGSRGVKRLASASISNSTAPTISTGSGSEPKKRRRHAMVQDAVRRSIKKRNEAAQK # NNGEIRRLRKSATMHESHNDFSNLAKMTPAEISRRKSDRDLQQSQELQLARARALAGPNGAGTRTPQRAATPLVAGNSRMSPQQQILAQKVQRVQGGP # AQTVTQAQAQAQVQAQLALSHALAQAQVAQAAQGHSTIDAQTAAALRGNLQQALAQNGVNGNAQLSPPYIPRDATSSPAHASPPRSTGTPSNGAVNSP # RPSSAQAQSHPLGQTQSQSSTPQLGMMQNGQIGAMNIPQARNIQGHYYLPNVSASYTPEQLQQSMLRMQNLVSLLCYSFVYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 Scaffold_12 AUGUSTUS gene 201056 203660 0.55 - . g422 Scaffold_12 AUGUSTUS transcript 201056 203660 0.55 - . g422.t1 Scaffold_12 AUGUSTUS stop_codon 201056 201058 . - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_12 AUGUSTUS CDS 201056 202157 0.77 - 1 transcript_id "g422.t1"; gene_id "g422"; Scaffold_12 AUGUSTUS CDS 202423 203660 0.55 - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_12 AUGUSTUS start_codon 203658 203660 . - 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MGFISHLSENELFDLVPPEEYTSPQLSPQSLLPTSTELKDVARRSKSRSLGKDSMSSIRTTPAAPALDTVEHLDDTIR # LSPPSLSASQATTVGAISILGSTESSQSIPVGGPRNESVPISPADCPSPGATRPPSSLATQERDGALTLEANTAEESSLQPTEMDDGSADVMEVDEPE # VKLRSSFSLPPVSEVSQSSHAYNPISSDQPQSVHDAFVSDFNMDVDIESSPMVNLRAKAEISTVARAPPSPKEATTPQGSSLPNSLVSPRVASPRNFG # SPAKVTSTVSPSSPVFIPVPSSSFHGIFNEFNFSTVALEPPSAPPLSPTQPRHQLDFRYTLPPLDSLSADFKIKNKKVKQKKKDKEKGKTEGQKDKEW # KDDWVPWGLNRWNATIRTNPVYKRVAKATKCLSTRDWAVRAEERKWKMALAYNLSTSVLEWHAAGNREKRLKRGICVQWKPPRQESPKDQIMEDADDV # PLEIEISTPSGPTRPSSALLNLDYGSDDEDDEEQEKDVDDALGTSVMIEESLADMKQSSYGDGIGFKDLQPKTEEVEDNSALQTESMDVDHPVQSEID # ITTRTTARTENDSSPERTLGGLKSTSDNPTLLSLSTSTSLSSERSPIPHSKSSKINLYTPLRENIAHSGVEKLFLDFDDFRITTTDPLSENTIETLLP # PSNLSDIFPDFQPYAMFDLAMPIPPVDGKKKSEKKSDRDDPVNKRVDEVAYSKLYPSSTFMFSKPTLVGALQPSKHLRGCQWVDLDETPISIEYEALQ # PFRLPEEFNHGTFPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 Scaffold_12 AUGUSTUS gene 205635 206684 0.44 + . g423 Scaffold_12 AUGUSTUS transcript 205635 206684 0.44 + . g423.t1 Scaffold_12 AUGUSTUS start_codon 205635 205637 . + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_12 AUGUSTUS CDS 205635 206684 0.44 + 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_12 AUGUSTUS stop_codon 206682 206684 . + 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MSFVLKSTDCEDNFCALGLSQLIWQCDLSNILFTRIALRGVEANTVRKHCKDLLFPPSLTLTFPTPEMQDISTFPESI # PLVTESNQLLPPSPMPQTPPSSTRRSLGRNLSSPLVPPTPMPSLPRCTSCGFGFSFDITSSNDMLHRPIVPCEKCQAQWDRCQKWYGKRGWQVGANEN # TVEATSPIVDMKKEKVLKRASRRLSRIVEDVFIPDRRSRQSSVKIPSQGTTWSSKRISFMDRSTQENTGSLPEDAHPSSQDQTNPLSSSALEELETRV # QDYSVETHFKRRINLSPHVVTQKTSALAKLMALRAFSRSKTEKSKEEKDKPQPKWRRSFLNLDTEKSERRPTSYN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 Scaffold_12 AUGUSTUS gene 212555 213022 0.66 - . g424 Scaffold_12 AUGUSTUS transcript 212555 213022 0.66 - . g424.t1 Scaffold_12 AUGUSTUS stop_codon 212555 212557 . - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_12 AUGUSTUS CDS 212555 213022 0.66 - 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_12 AUGUSTUS start_codon 213020 213022 . - 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MDQHLDARHFVSKISSYFDPSFMLTRHCSQNSGQNCIGIEKLIVHVDQYDDLYDMLKERIEKLRCGSVTLPSDQGYLS # PVDVGAMISDNRFDALEALIKQAEEDGAKIVNGERYHHVYHDQGTYFLPTLVGLTKNSAAIAQQERKPICDFCHSCY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 Scaffold_12 AUGUSTUS gene 216826 218252 0.83 + . g425 Scaffold_12 AUGUSTUS transcript 216826 218252 0.83 + . g425.t1 Scaffold_12 AUGUSTUS start_codon 216826 216828 . + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_12 AUGUSTUS CDS 216826 217314 0.85 + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_12 AUGUSTUS CDS 217368 218252 0.98 + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_12 AUGUSTUS stop_codon 218250 218252 . + 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MQSIPPKWIRREYSQRGWIPLVADKTGNYVGIDLNPDDSGTSGQVIVFGRDFDTKVVLFNGDGPAGWARWLASFVEEL # ESGEGFEIGKGEDNSDDEDDVGYASYYNDGSGSGDGGGDNGLGGGLRLTGEYKGWSVLEAWADKSVRKWYEAGVIKDTVDEKKGKEAEKVPSLHLSQG # AAAEVPIPVLDDVDSVEATDLRPGSVAPPANLTSPTAMNSRRPPNLPTIHITKPPLPLPVELPTPRDIVALPSPPDSRHSSFDEDLESGRARNMSEFP # TDNIAVSRRVSPVDAAITVTSPPSPPPEDLLADSDSVLETTPIIQAAALSSPDSIEAVKHEPPNPESLIDASSDSAPLPEERVDDTEDAIDPDVTIRL # VGGGGSSGDVAELAKEEIILDEADVDADVASLASTTSVASESSPSKEKKHKKTRSGLAGLKKLGLGKKKKGSVSSVKEAVADSKH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 Scaffold_12 AUGUSTUS gene 226095 226955 0.69 - . g426 Scaffold_12 AUGUSTUS transcript 226095 226955 0.69 - . g426.t1 Scaffold_12 AUGUSTUS stop_codon 226095 226097 . - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_12 AUGUSTUS CDS 226095 226955 0.69 - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_12 AUGUSTUS start_codon 226953 226955 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MISDIWPSKFNPSCMNGEQAICAIEQVADFECQLSRFSNFDSIGSLEYDEVKNEFRVGPVTPLQKLSTLPGFYPGPWK # SSIEYLRSLISTHKATLQQSDWLENRRAFFTYMNKANSPKIEDIDMEARSDHTHFITWYNMLEANLDHLDLSPFDPPHYPFVLLHEDLNIGNVMVDYE # DPTKVVAVIDWEGSRVVPFWVGNFYSSFLNESDYSNDPKEQEIYCRMVETRDETRKKNLDPSLWNEKHHSGIAQLIQPVSTCFIAAHLYSCASLQYIA # TEFFSKSPPGRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 Scaffold_12 AUGUSTUS gene 229144 229494 0.92 - . g427 Scaffold_12 AUGUSTUS transcript 229144 229494 0.92 - . g427.t1 Scaffold_12 AUGUSTUS stop_codon 229144 229146 . - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_12 AUGUSTUS CDS 229144 229494 0.92 - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_12 AUGUSTUS start_codon 229492 229494 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MEVSSAGDIANFMIPGKMVKGIGGAMDLVSNPDKTKVIVVMEHCAKDGSHKILEKCALPLTGARTVSTIITELAVFNV # DRQNGGLTLVDIAEGTTIDDLRAKTGCDFKVSGDVGNF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 Scaffold_12 AUGUSTUS gene 229773 230963 0.29 - . g428 Scaffold_12 AUGUSTUS transcript 229773 230963 0.29 - . g428.t1 Scaffold_12 AUGUSTUS stop_codon 229773 229775 . - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_12 AUGUSTUS CDS 229773 230193 0.47 - 1 transcript_id "g428.t1"; gene_id "g428"; Scaffold_12 AUGUSTUS CDS 230304 230487 0.58 - 2 transcript_id "g428.t1"; gene_id "g428"; Scaffold_12 AUGUSTUS CDS 230831 230963 0.5 - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_12 AUGUSTUS start_codon 230961 230963 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MYSSRNKSILCDLDTLLGALAKRKNEVTNLVGVSNNAGAGDSGLEEGTIPIRYNPGGVSAGIAIPGIKKETKVINGKK # FVLEPSIAGDVAFVHAWKVDEIGNCVFRCACAAKLCSILLSSVRQAEEIVPVGSISPNAIHLPSVYVDRIVKATVPKHIEIVTLSKAGQEEISTSKLS # PEKAAAQALRNRIAKRAAKELRNGFYVNLGIGMPTLVPEHLPKDVKVWLQSENGILGMGPYPTKEQLDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 Scaffold_12 AUGUSTUS gene 231952 234971 0.3 - . g429 Scaffold_12 AUGUSTUS transcript 231952 234971 0.3 - . g429.t1 Scaffold_12 AUGUSTUS stop_codon 231952 231954 . - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_12 AUGUSTUS CDS 231952 234335 0.39 - 2 transcript_id "g429.t1"; gene_id "g429"; Scaffold_12 AUGUSTUS CDS 234917 234971 0.37 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_12 AUGUSTUS start_codon 234969 234971 . - 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MFNSLTHLTYLTSTSPRIQVYQDTPNEASATTSLIHTGTSASGIEISGTDDDEGPVVIPPGRDRSGTVVARANWDPIG # QQWRNVAASLDTAQSSPTPSVSSNDQSRPSSRPQSETEDDADVDMDGPIPNSASTNASVSDIDAPSPRTSRPHQRTHRPSMNRHTLVGLGLAGDPVPP # LNMTMGGLAGIGHGDAHIIINDSAGGADGLGTMGDVGMNMGLGGGMAGEDGIVSLEIENNDDFAMGAPPGAPGAIPAANMGDVTLGLDGDLSMSETED # GSRPASRGEHVVPEGQVNLEMERSGTIRRVRAPGTPDATPRAGVIGLPPSPSAASSAGLNIPSSSRLPSSESSTSSSLPSTSTMGSSSASRSSTVRGI # SVGGIDLSRDSDERWDAPGSNADTAASLSGSESRWTQEPLEGGSLHAENTRRENGYEDRQNTLTVEGSRRSTNTLTTPGTVRSTASNISIASTAATAS # TTTTTHTLPPSPYRDEDVLLSLQLLAYLSKYPHVRQAFYKKRDSFHPASAGPIGGPTPSIPSTSTTNSTPGPSRSGKEKEPNKLLKESSVFFRAFTSA # ATRGKEKERVNDKYPTASSSSSPTAASPAPRQTNVFSLVERFTYRPSSSELAEYNSNGSQMNVPPRLPPEIQYWAGVIMRNACRKDDSRGGIRQCANS # ELSILIGVLLLCTHMCLVLCGRWEEYPREFAKCRRCRKAKYCGKECQSTAWSEGHRFWCSAKDADDETTAAPASASTVNAGEPSQTPQHQHAANAGEP # DRRERRDRERDRHGRDRVVGAHRPRGLEALGRQANDAPISYCNNIKSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 Scaffold_12 AUGUSTUS gene 240247 240861 0.58 - . g430 Scaffold_12 AUGUSTUS transcript 240247 240861 0.58 - . g430.t1 Scaffold_12 AUGUSTUS stop_codon 240247 240249 . - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_12 AUGUSTUS CDS 240247 240861 0.58 - 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_12 AUGUSTUS start_codon 240859 240861 . - 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MMADIWPSKFNPSCMNGEQAISAVKQIADFECQLLRYPSFDSIGSLEYDEAANEFRVGPLTPLYKLSTFPGFHPGPWK # SSTEYLRSLIILQKSILQQPDWLDDRRSFFTLMNTYGNDIPKIEDIDTEVRSDHAHFTAWYNMLEANLDHLDLSPFDPPHYPFVLLHEDLNIGNVMMD # YEDPRKVVAVIDWEGSRVVPFGLVAPIA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 Scaffold_12 AUGUSTUS gene 244074 244691 0.74 - . g431 Scaffold_12 AUGUSTUS transcript 244074 244691 0.74 - . g431.t1 Scaffold_12 AUGUSTUS stop_codon 244074 244076 . - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_12 AUGUSTUS CDS 244074 244691 0.74 - 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_12 AUGUSTUS start_codon 244689 244691 . - 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MVGLGAVPSSVSAAQGKREKSNSKDSNMGTSPSIGIHPSSSSAIISSSSFSPSSSASQNLDATLQKTLQPLLEQESLL # ESYIAEATKARKFEDAKILRGNLREIRGRSVGLLGMCRVLVTSLIQIDICPIDQYYPSNFYDAQNDSTIGSRQPFPFAGTFIQKHKFDDEFSIGVTWL # ACTIIEKRSSEVVNPSRSEYPLSLQLDGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 Scaffold_12 AUGUSTUS gene 248170 248454 0.76 + . g432 Scaffold_12 AUGUSTUS transcript 248170 248454 0.76 + . g432.t1 Scaffold_12 AUGUSTUS start_codon 248170 248172 . + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_12 AUGUSTUS CDS 248170 248454 0.76 + 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_12 AUGUSTUS stop_codon 248452 248454 . + 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MLKPSFADIWDDEEDELVEKEVVGEAEENPVSAADKGVEAIFPIPRVNKRIPNSVIESVGSFTRGKPTQSSREVLMYK # EQNIILTSQPFPEPAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 Scaffold_12 AUGUSTUS gene 253677 255509 0.09 + . g433 Scaffold_12 AUGUSTUS transcript 253677 255509 0.09 + . g433.t1 Scaffold_12 AUGUSTUS start_codon 253677 253679 . + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_12 AUGUSTUS CDS 253677 253885 0.1 + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_12 AUGUSTUS CDS 253970 253976 0.52 + 1 transcript_id "g433.t1"; gene_id "g433"; Scaffold_12 AUGUSTUS CDS 254982 255509 0.64 + 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_12 AUGUSTUS stop_codon 255507 255509 . + 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MLYSSGSTSVFQAAKTFLASSNSHFNARKVETSDPTELDEAFLKSELGFDNVTAGGGDSATIKTPLGGDTDEQDYFYL # LDSVKFKALRLATLPYDDFDVDKLQDEANSVARYPGYAEDWFKTCVGELGLSMDDFRVERSIAEIAYSQYLMHNAQGDDWYNLHVILIACYWVSLLVF # EPLYSDTISQGWCKLALELYKKDSTDKTTIFYKNWILPSVDITNGEPEIAQSAKTLSSKHTTFKIITTHDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 Scaffold_12 AUGUSTUS gene 255915 256484 0.9 - . g434 Scaffold_12 AUGUSTUS transcript 255915 256484 0.9 - . g434.t1 Scaffold_12 AUGUSTUS stop_codon 255915 255917 . - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_12 AUGUSTUS CDS 255915 256484 0.9 - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_12 AUGUSTUS start_codon 256482 256484 . - 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MIRVLFREMLLAVMGIDHMTLTASPEKPALKRSRPSDTPMKDNTTLTSNHSRVVRDEDSIEQDSEGWADFSTALHSTG # SQQVVSAIRSSFQVDDNYAPNTLAPIQPISISPIQGSGSRSSLTMFDPVRESSASHRPTSINMQINEMPTQLPTPTYTDLGPIDPMPMMSYDFGSNPA # FAVPVTSAWGDPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 Scaffold_12 AUGUSTUS gene 268132 268587 1 + . g435 Scaffold_12 AUGUSTUS transcript 268132 268587 1 + . g435.t1 Scaffold_12 AUGUSTUS start_codon 268132 268134 . + 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_12 AUGUSTUS CDS 268132 268587 1 + 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_12 AUGUSTUS stop_codon 268585 268587 . + 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MLIKNVDDVLVNGVVGKVLGFYHPSELTGGTLPAPSNSGLKSGSANTPSASTSSKMSSSSVPSNKIPFNTKSATETKK # NGALLRYVQLSEDGRTPVRVSRWNNKENTSGTKAEVKPKKKQTEKEVDDSSERYPLVLFEYPSRTAGTGQKPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 Scaffold_12 AUGUSTUS gene 269606 270889 0.53 - . g436 Scaffold_12 AUGUSTUS transcript 269606 270889 0.53 - . g436.t1 Scaffold_12 AUGUSTUS stop_codon 269606 269608 . - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_12 AUGUSTUS CDS 269606 270889 0.53 - 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_12 AUGUSTUS start_codon 270887 270889 . - 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MLSTPWYWTKISVRCTSTWGIRPEFHLLQLFLERSKENLLDLKVSFPISGYHTQELILQLFKTLAAQAHRWNSLEIFA # TQSKHLCLLRHPYISSCPELTSLTLRGVLDSQEEPPMNFVPMPKLKSFIPRVFNRPLRPDSSFPWHQLTKLSLDCWSLSDLSFVGLCKNLLHLRISVD # YDSEMTLPRVPKAPVPSVLEQLRTLTLVLSPSEPKTRFVEIVLDLVAMPALAHLEVEGDTSEQADHGAADWPSGIMDALIERDSFPLTTLAIHNISIS # ENDLTTFLRKAPSLMTLSIQEAQFEGSFEKQISSPISTNFMRSLWAVSGEEHSSTEAQLLLPNLTTLYLTIYKEFSDEAFTDMIHSRWGDEDHSLTQE # SSISRLKEVVVHLGDQDISLSKRDSDSTKLKALSTLQRQGLFIEVVDSGDYVYLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 Scaffold_12 AUGUSTUS gene 271428 272747 0.95 + . g437 Scaffold_12 AUGUSTUS transcript 271428 272747 0.95 + . g437.t1 Scaffold_12 AUGUSTUS start_codon 271428 271430 . + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_12 AUGUSTUS CDS 271428 271958 0.95 + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_12 AUGUSTUS CDS 272019 272747 1 + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_12 AUGUSTUS stop_codon 272745 272747 . + 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MLTIHCDTIELSDSETEIECSQATFLPSSQRSQVFEISDDEPPTAPLTSSPSAQLLNLSDDDDDMSISSPQKALPRGS # VDKGKARAFSGYDLQLDSGSDSDLPNANELLNDILPRTRSYPSSRTVYSSKRSYRQTSTCADSDEASSPPKKTRVNTLDVVKQQTKRRGKTVEEKARE # KELKDYERDKKKAERARQKQLKDDEKSAQKRAQKAQKELDKAQKQRDKEDKALHRTINQLLLNKKEALQYMTLILSKSFRKSYPDFARLLHAKLDGHK # AGIRDDGPDLLSGYDTVRWQRLVFKEYDTSVRAFKAVKPSYQKYEKFALMRLSIVQLSNLVQKNGLVDLVQDFRQAHGLGRKDHMYIMISGMGKLRTR # NAAEWKKLEGALTSLQFQEDVYLACVENEQEAVDRLYNYSGDLGEPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 Scaffold_12 AUGUSTUS gene 276974 277296 0.67 - . g438 Scaffold_12 AUGUSTUS transcript 276974 277296 0.67 - . g438.t1 Scaffold_12 AUGUSTUS stop_codon 276974 276976 . - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_12 AUGUSTUS CDS 276974 277211 0.67 - 1 transcript_id "g438.t1"; gene_id "g438"; Scaffold_12 AUGUSTUS CDS 277268 277296 0.74 - 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_12 AUGUSTUS start_codon 277294 277296 . - 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MVGLNIYPGSFPDEVVPCSDMAGEVIAVGDEAGSQWKKGDRVCANFAADHIAGDITPEIQKTAHGGNSRCIDAIQSVQ # SSRTFIYFLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 Scaffold_12 AUGUSTUS gene 280791 281722 0.99 - . g439 Scaffold_12 AUGUSTUS transcript 280791 281722 0.99 - . g439.t1 Scaffold_12 AUGUSTUS stop_codon 280791 280793 . - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_12 AUGUSTUS CDS 280791 281597 0.99 - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_12 AUGUSTUS CDS 281657 281722 0.99 - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_12 AUGUSTUS start_codon 281720 281722 . - 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MIFKTLTPVILAAALEIATVNAIPAVDIRQITSVITSIPGVTSFTSVGVVPTVSSSVTSIGAVSSSFTSVGVVPTVSS # FTSIGAVSSFTSVESVPTASSSFTSIGAASSFTSVGSVPTASSSFTSIGAVSSFTSIGSVPTACSSFTSIGAVSSSFTSVKIVPTVSTSFTTIATASS # SVPSPSVVTTTVYVTKTIKAHCHSESSVAFSTSTESHNFTSIIVTNPSGTASVITTTFDLSSAFPTGTASENITTVIVGTSSVNGSLTTITFDPSTAF # PTGTASGNITHHHQLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 Scaffold_12 AUGUSTUS gene 284139 285362 0.99 + . g440 Scaffold_12 AUGUSTUS transcript 284139 285362 0.99 + . g440.t1 Scaffold_12 AUGUSTUS start_codon 284139 284141 . + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_12 AUGUSTUS CDS 284139 285362 0.99 + 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_12 AUGUSTUS stop_codon 285360 285362 . + 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MLYGNAIYSVGAILIAAATTVRSYKFMILGTVIQAFGDIATQVAQYKVFSSWFAPSNGFASTLGFELGVGKIGSFVGK # ASANIIAENMGDFSWVYWMAVVMNVFTNVVTLIFWFFTRWCEKRYSAKHDPATGEKLTEKNDHFEIRKMLQLPWPFWCIIAFTAFQTSCAIVFTNNAT # EMAEQRFDVSAVTAGWYSAMAQYMGFFLVPCLGVFIDILGNRLSVMVICGIGMFIAMCLAKWGPTVSGTAASFGIYAVAESLGPVVIIDSIRTTMWYQ # EVFGSGYAIKIAVNNSMNIIVGIVAAVIQDKDDNSYNNVVGVYVFLAAGSMLVGIASFVAGYFFIDLGRLQWTKKHRIRYGELINAQKEKFEEGDAGK # KNRDFSVSMFTVVILLILGAWATYFWGLATGNNNA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 Scaffold_12 AUGUSTUS gene 287678 288415 0.47 - . g441 Scaffold_12 AUGUSTUS transcript 287678 288415 0.47 - . g441.t1 Scaffold_12 AUGUSTUS stop_codon 287678 287680 . - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_12 AUGUSTUS CDS 287678 288415 0.47 - 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_12 AUGUSTUS start_codon 288413 288415 . - 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MLEQIKSLQINAPKLSKIPGISRLSWGFYSSSKKTWVTASRMKLPSGVKFQFLCFGVQHCFGLDSDGKVQDIAPQLSG # ANFVDTRYHLAWDNSKEYPSFNLKKFEEFSKTSTFFTRLFSTPFADIEPAIEKEIGLKKGVDEDENTFFFRALLKYMASKEIITNYNEQRYDQEIKDL # ELIRTKDSKAPTLLDNSNTPRVMGSGSTQAGAPEGSGNNSSVGGSTRVTVSSLLRPNATFDPNINNLLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 Scaffold_12 AUGUSTUS gene 292736 293584 0.27 + . g442 Scaffold_12 AUGUSTUS transcript 292736 293584 0.27 + . g442.t1 Scaffold_12 AUGUSTUS start_codon 292736 292738 . + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_12 AUGUSTUS CDS 292736 292897 0.27 + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_12 AUGUSTUS CDS 293150 293584 0.95 + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_12 AUGUSTUS stop_codon 293582 293584 . + 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MSAKQLSSGTLSLKFMQNAQRAKQLKEVVLERAHVEDDGQWEIAKEIRILGFYRATIESSSLVKTETPVPPADSASDP # SVRNQKFDTGTTSNPYIKKSAKLAIFDTSRVGADLRPPTNNITSSVQAPTSSKTGFLKPAGVDEPKASSSGAHTALVKEKISTTAREMKNKRERKSSA # TRAGIEDDTPKRKKKKPKITAD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 Scaffold_12 AUGUSTUS gene 293838 294314 0.45 - . g443 Scaffold_12 AUGUSTUS transcript 293838 294314 0.45 - . g443.t1 Scaffold_12 AUGUSTUS stop_codon 293838 293840 . - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_12 AUGUSTUS CDS 293838 294314 0.45 - 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_12 AUGUSTUS start_codon 294312 294314 . - 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MVKLTNSTEEFAILLHVSSFTPLPAPTTVASSSTSIRPYSPSPMLNASVPAVPSPLPSVLYSQSQTNLLHLPEIENRG # LGLGPALSRSRSAQGSTTNKLPPSPAPTEAPRSAQPLQSFKLPVIRRLRDREAANGFRIDGITGGTGLHGNGNGIGNDPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 Scaffold_12 AUGUSTUS gene 294584 296473 0.7 - . g444 Scaffold_12 AUGUSTUS transcript 294584 296473 0.7 - . g444.t1 Scaffold_12 AUGUSTUS stop_codon 294584 294586 . - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_12 AUGUSTUS CDS 294584 296473 0.7 - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_12 AUGUSTUS start_codon 296471 296473 . - 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MSSATESVNLDTPASSYGQSDRPPPLHLGILQSYSEEASPTRSIESYLPSPAESDTFFDSTSTHDHADLDQQSQSQQQ # QQHARNASYAAGSIRSSNRPDFLGKKSMPDLRTAKLNFSKKSVPDSLQHTRVDRGFTAKSSSANSPSTSTPTNTHSHRPNLHHPHEDSFSIPSPLSQR # QDSSGSSNTSNSRAIRGPFSVAKDKDFIAQVSPTRAVPSMAFERNSYFRRISSLPTASISNTLPPPLLNLVDTARSILFAVCQIYQTLEHYTLHHTID # DRLSSVLKKVLHPASTDMMQFINSLDRFDAMSRKTVPPPTVCRGVVESCRDTVAVFGKTVGVLSLQLKVIVSVDDLRYVRALLIQLYSAAAEISLAWQ # GMIPLMDSVKPYLHSKAFPTPSPPNHVGLGNIDNNLYHSPASAPLLPTSLSLSEGSPSHLLSLRANPSGVRTHTARRHAGSFSSKDVEIGKTLPSCEE # MPSLSGGIALHTPTLRTPKRKNGSATTSTTMLTIQAPSPTGPISLSNSSSSLATSTISVSASVAESSRAVHSAHSHSRSGSQTSIIAGSSSNPSSSAA # SSPSLPPPKPTSFLELPSTSRTLVDNEALQAVQAAVEVAPTVWDMIENVLLGNEVKELRLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 Scaffold_12 AUGUSTUS gene 302951 303915 0.58 - . g445 Scaffold_12 AUGUSTUS transcript 302951 303915 0.58 - . g445.t1 Scaffold_12 AUGUSTUS stop_codon 302951 302953 . - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_12 AUGUSTUS CDS 302951 302981 0.58 - 1 transcript_id "g445.t1"; gene_id "g445"; Scaffold_12 AUGUSTUS CDS 303098 303915 0.58 - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_12 AUGUSTUS start_codon 303913 303915 . - 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MSHGASGSCWPRLYTDASIIRSLASLNSSSSRAAIDKLDRVIIIAGAAGEGRLDLVHTLIRRIQTEFLSYTVDLTRRF # SKPEVIASNDSCSSISFLKTSLHVIPVLNSPPSFTTFHTTHNHHPFVLPKYASSWPAINEHPWSSAAYLRFVAGPARIVPVEVGADYRADDWTQQFID # WDRFLSTLELDDIDLSADLASPSTIKPKKVLYLAQHNLIRQFPDLNRDIVIPDYVYTCPQPPLDYPQYKPPGNDEQLVINTWLGPLGTISPAHTVSAL # CTNSKLND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 Scaffold_12 AUGUSTUS gene 304917 306350 0.96 + . g446 Scaffold_12 AUGUSTUS transcript 304917 306350 0.96 + . g446.t1 Scaffold_12 AUGUSTUS start_codon 304917 304919 . + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_12 AUGUSTUS CDS 304917 305469 0.97 + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_12 AUGUSTUS CDS 305557 306350 0.99 + 2 transcript_id "g446.t1"; gene_id "g446"; Scaffold_12 AUGUSTUS stop_codon 306348 306350 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MQTDDSSLPAPEFTNFSVEELVIQGKLLLASSGKEFIRPAVLSSPAEVKKARKEAMGRLGLEFLDDVAEEMDLDKELG # ADVEENADVDMDIKAEELTPSGSPMDVCPPTSIKKEGSVPSRSATPADPSTTPTTPAAETDLGSMSARERNRLKRKRKPGNSAFVAPQPPRKLLGPNI # MQLQQELQSTSRLDSPSSDKVVVDPSKGGAVSPKAIKEAKALGVKPGVWIWDGVVQVLEVDLFSAAWEVRHGAALALRELLKIQGKCGGMQGAGRTVL # LPFSRVLTTVYFIDNSSWEENLMAHEKWCNDLSAKLLCVLVLDRFGDFVSDQVVAPVREMISQTLASLLIHMPQRSVLHVHSILLQMIRQQFLIPVPT # LPLPKLKGSRKKDSAEQKVTHIWEIRHAGLLGIKYEVAVRNDLFDRLQEEVKQENGSSAATGVTILSDVVDAAVLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 Scaffold_12 AUGUSTUS gene 307315 309864 0.02 + . g447 Scaffold_12 AUGUSTUS transcript 307315 309864 0.02 + . g447.t1 Scaffold_12 AUGUSTUS start_codon 307315 307317 . + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_12 AUGUSTUS CDS 307315 307908 0.16 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_12 AUGUSTUS CDS 308066 308400 0.22 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_12 AUGUSTUS CDS 309336 309864 0.38 + 1 transcript_id "g447.t1"; gene_id "g447"; Scaffold_12 AUGUSTUS stop_codon 309862 309864 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MEEVFQPILLHYIDSTSMLQKVLSAIISEEWAREHSSRVQTDSPLLIDSSDLAKEISSRTLAWLQGNPPAAYHEMAFA # LARIHVDSVSLLHSFATDCKLPISSIPFLGTEIDITGINPDRFTIETAQEAIGPRYNQLKGMLGRTKKRELAVIEEKRTVVSASIDRYLEVKNQHEIR # VAAAFAAAFVALRSTPDKVSPVISQPPDKIVKNLCTFLCQDVEQTPTFAYTRKVLDGILSFHKVGKVSPAKNLKEKEKSELPIEETGQSPLSRRGAGL # AFDELSSKFGGRLLDAIPNMWQSMAGGLLSAFQSGIKHFERAERYKETKSPDAVHLPSLIICPPTLTGHWYYEILKYAENLKPVLYTGNARERAKLIP # KFKTFDVVVTSYEVVRNDISNLESMRWLYCILDEGHVIKNAKTKLTKAVKSVQAQHRLILSGTPIQNNVLELWSLFDFLMPGFLGTESSFNERFSKPI # LSNRDGKSKNGEAGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 Scaffold_12 AUGUSTUS gene 310299 311195 0.12 + . g448 Scaffold_12 AUGUSTUS transcript 310299 311195 0.12 + . g448.t1 Scaffold_12 AUGUSTUS start_codon 310299 310301 . + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_12 AUGUSTUS CDS 310299 310327 0.44 + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_12 AUGUSTUS CDS 310378 310723 0.5 + 1 transcript_id "g448.t1"; gene_id "g448"; Scaffold_12 AUGUSTUS CDS 310769 310864 0.3 + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_12 AUGUSTUS CDS 310974 311195 0.71 + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_12 AUGUSTUS stop_codon 311193 311195 . + 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MHPNFLPYGGQLLLDCGIGGGSAPTSDQSKSELIDTNPDADGTSSTFSQHRVLIFCQMKQMLDIIETDLFKVHMPSVT # YMRLDGGTDTSKRHAVVQTFNSDPSIDVLLLTTHVGGLGLTLTGADTAMDRAHRIGQKKVVNVYRLITKGTLEEKIMGYNSGLSSMDTDLVLDLFRRT # SEEEDAAAAAKKKKAREGHGPVSQQNILHGLEDLPPEEEYQDLDMSKFLGSIGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 Scaffold_12 AUGUSTUS gene 313587 315252 0.84 - . g449 Scaffold_12 AUGUSTUS transcript 313587 315252 0.84 - . g449.t1 Scaffold_12 AUGUSTUS stop_codon 313587 313589 . - 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_12 AUGUSTUS CDS 313587 314517 0.99 - 1 transcript_id "g449.t1"; gene_id "g449"; Scaffold_12 AUGUSTUS CDS 314624 315252 0.84 - 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_12 AUGUSTUS start_codon 315250 315252 . - 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MYFVHPGAGNQFYVRLLLTVIRGPTSFADLRTYNGIEYDSFKQACLARGLLEDDGEWKDCLEDARHMQTGSSLRSLFA # TILKDCHPQQPGVLWEQFREYLCDDLHYHLQTSGILHNPTQQQVENYGLYLIDQILFHAGIFEGLKLYEGMPLPDYALWNTVLGNRLVAEQMAFDPQE # QQQKAAENIAMLNVGQRNAFDKVMNAITSNHPQMIGCITTSKGPHCHSTFKIPIDIFEGKTCSIKKNSELAELLQKVSLIIWDEVPMQNRYCQEAVNL # TMQDIKSNDQPFGGVTVVFGGDFQQILPVVHKGRREQIVGQCIQRSRLWHDIEVLHLTENKRLSSGTVEDCEYANWLLQVGHGSINTLENQVKLDPSM # KCGDTIESLITAIYPSLNLIHPAVNNDSWFLERTILCPRNDLVDQLNMICLNALAGNMSTYHSADSIGANEGEDNNNEFQYPVEYLNSINGSGLPLAK # LELKIGAPIMVLRNLDPSSGICNGTRAILTKCTTRVLEARILGGDYSGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 Scaffold_12 AUGUSTUS gene 315755 316378 0.15 - . g450 Scaffold_12 AUGUSTUS transcript 315755 316378 0.15 - . g450.t1 Scaffold_12 AUGUSTUS stop_codon 315755 315757 . - 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_12 AUGUSTUS CDS 315755 316378 0.15 - 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_12 AUGUSTUS start_codon 316376 316378 . - 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MFQLYQDSMAISRHFGKPDLFMTITANPNASETKDALLQGQQANDRPDLIARVFREKVRLMLKLIDNGSFGKCRGRVH # TIEFQKRGLPHIHILIFLHPSARLEDSHKIDQLISAQLPDPETQPRLFRLVEKLMIHGPCGALNPSASCMKDGKCSKGFPKSFQEQTTLSENGYTIYA # RPNNAVFLSKKSMARTYRWIILGLFLIHLGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 Scaffold_12 AUGUSTUS gene 316935 317886 0.81 - . g451 Scaffold_12 AUGUSTUS transcript 316935 317886 0.81 - . g451.t1 Scaffold_12 AUGUSTUS stop_codon 316935 316937 . - 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_12 AUGUSTUS CDS 316935 317774 0.83 - 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_12 AUGUSTUS CDS 317863 317886 0.97 - 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_12 AUGUSTUS start_codon 317884 317886 . - 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MQPQIHLQLARVPPHPIQPPNRNNRGRGRGRSRGHQPENHNQVHENNEEQNHNPHYREQYAPAGPLPLAMQPIQNDGV # YNELSLGKMEIKCSNCKAFHWKAEMLTTSRGEEKLFGTCCLSGKVRLPLLEEPPVELLQLFNGEDHNSQHFLENIRTYNAAYAFVSLGLKLQPQNDPE # LPQTGVKQFKIKGELWHSLGSLLPEPGKNPIYAQLYIMTPETALERRLANNMHHGTGLLPAVMSIIDDVLQRHNNFIQIYKTAHERIAELERENSNPL # QTASVKLHFTNYQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 Scaffold_12 AUGUSTUS gene 323658 324238 0.22 + . g452 Scaffold_12 AUGUSTUS transcript 323658 324238 0.22 + . g452.t1 Scaffold_12 AUGUSTUS start_codon 323658 323660 . + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_12 AUGUSTUS CDS 323658 323743 0.22 + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_12 AUGUSTUS CDS 323833 324238 0.42 + 1 transcript_id "g452.t1"; gene_id "g452"; Scaffold_12 AUGUSTUS stop_codon 324236 324238 . + 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSV # GDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTFYVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 Scaffold_12 AUGUSTUS gene 324861 325181 0.38 + . g453 Scaffold_12 AUGUSTUS transcript 324861 325181 0.38 + . g453.t1 Scaffold_12 AUGUSTUS start_codon 324861 324863 . + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_12 AUGUSTUS CDS 324861 325181 0.38 + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_12 AUGUSTUS stop_codon 325179 325181 . + 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 Scaffold_12 AUGUSTUS gene 325211 325885 0.75 + . g454 Scaffold_12 AUGUSTUS transcript 325211 325885 0.75 + . g454.t1 Scaffold_12 AUGUSTUS start_codon 325211 325213 . + 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_12 AUGUSTUS CDS 325211 325885 0.75 + 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_12 AUGUSTUS stop_codon 325883 325885 . + 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKLLCARYAIGESVQGLKRITTYQLYPKMEKLKFWTIHLGYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 Scaffold_12 AUGUSTUS gene 325933 327802 0.41 + . g455 Scaffold_12 AUGUSTUS transcript 325933 327802 0.41 + . g455.t1 Scaffold_12 AUGUSTUS start_codon 325933 325935 . + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_12 AUGUSTUS CDS 325933 326641 0.85 + 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_12 AUGUSTUS CDS 326716 326956 0.42 + 2 transcript_id "g455.t1"; gene_id "g455"; Scaffold_12 AUGUSTUS CDS 327049 327802 1 + 1 transcript_id "g455.t1"; gene_id "g455"; Scaffold_12 AUGUSTUS stop_codon 327800 327802 . + 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDE # EIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSE # ITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEI # IDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGT # ESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVD # KKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGPLKMNSFHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 Scaffold_12 AUGUSTUS gene 328151 330990 0.61 + . g456 Scaffold_12 AUGUSTUS transcript 328151 330990 0.61 + . g456.t1 Scaffold_12 AUGUSTUS start_codon 328151 328153 . + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_12 AUGUSTUS CDS 328151 329773 0.61 + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_12 AUGUSTUS CDS 329875 330990 0.95 + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_12 AUGUSTUS stop_codon 330988 330990 . + 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN # VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV # YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP # YQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGK # YLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGTDELLKAPPTLMHTPSLFQKVHVDTMI # MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIR # QALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKV # AELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELI # DLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 Scaffold_12 AUGUSTUS gene 341492 344028 0.86 + . g457 Scaffold_12 AUGUSTUS transcript 341492 344028 0.86 + . g457.t1 Scaffold_12 AUGUSTUS start_codon 341492 341494 . + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_12 AUGUSTUS CDS 341492 341508 0.87 + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_12 AUGUSTUS CDS 342267 344028 0.96 + 1 transcript_id "g457.t1"; gene_id "g457"; Scaffold_12 AUGUSTUS stop_codon 344026 344028 . + 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MRLYILKTAYFEEFGESRSLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLR # DNARMPRDDPNVPRYKKMNKWRKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 Scaffold_12 AUGUSTUS gene 344243 345031 0.97 + . g458 Scaffold_12 AUGUSTUS transcript 344243 345031 0.97 + . g458.t1 Scaffold_12 AUGUSTUS start_codon 344243 344245 . + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_12 AUGUSTUS CDS 344243 345031 0.97 + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_12 AUGUSTUS stop_codon 345029 345031 . + 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MKEQDRSRRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNRNIVRFEAPKSIDRPLK # KPSVMIEDVDESDDKDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIHNRRVRPRTKTDNYVSTLSEDGETEILDKPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 Scaffold_12 AUGUSTUS gene 345313 346424 0.44 + . g459 Scaffold_12 AUGUSTUS transcript 345313 346424 0.44 + . g459.t1 Scaffold_12 AUGUSTUS start_codon 345313 345315 . + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_12 AUGUSTUS CDS 345313 345907 0.44 + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_12 AUGUSTUS CDS 345982 346424 0.62 + 2 transcript_id "g459.t1"; gene_id "g459"; Scaffold_12 AUGUSTUS stop_codon 346422 346424 . + 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYQLRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFR # VLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 Scaffold_12 AUGUSTUS gene 357973 358548 0.8 + . g460 Scaffold_12 AUGUSTUS transcript 357973 358548 0.8 + . g460.t1 Scaffold_12 AUGUSTUS start_codon 357973 357975 . + 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_12 AUGUSTUS CDS 357973 358548 0.8 + 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_12 AUGUSTUS stop_codon 358546 358548 . + 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MPTRIEVDASGFATGGALMQKQGNGQWHPVAFRLASMQPVEQNYEIYDQEMLAIIEVLKDWRNFLEGLPQPFDIITDH # SNLEFWHTAQARWALYLSRFDFHMIHRPGRVNTQADALSCMAVHHVSDSDDNQQQTVLKLGHFTKIAASILRNPLEDHIRKASEWEAQVLGGLETVKK # HGIAEWEEDNGLVYY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 Scaffold_12 AUGUSTUS gene 371223 371957 0.35 - . g461 Scaffold_12 AUGUSTUS transcript 371223 371957 0.35 - . g461.t1 Scaffold_12 AUGUSTUS stop_codon 371223 371225 . - 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_12 AUGUSTUS CDS 371223 371957 0.35 - 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_12 AUGUSTUS start_codon 371955 371957 . - 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MAGYTYTLTHNQVSIDVSKPIQEADRPIYLKALQDYFGLDILASRLKYGISHPIIPALRGNGIPPYRFEEVADYRHFI # IVADILEHAYTGSYRLEILYNNINIGVVTSLARGLDTLCAGCQGRRETKNRIRGTIAVHQHVVNQIYSLVEQSDQPNQEDVFKEVFKLAFSAQLVGPT # GTVLATASNDVDPTENNALPEEKCPNITIHSTSAATHEEQGYCLFFDDTEYGQILEGKWVNIPPEQRV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 Scaffold_12 AUGUSTUS gene 372785 373468 0.19 - . g462 Scaffold_12 AUGUSTUS transcript 372785 373468 0.19 - . g462.t1 Scaffold_12 AUGUSTUS stop_codon 372785 372787 . - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_12 AUGUSTUS CDS 372785 373139 0.71 - 1 transcript_id "g462.t1"; gene_id "g462"; Scaffold_12 AUGUSTUS CDS 373199 373305 0.49 - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_12 AUGUSTUS CDS 373379 373468 0.24 - 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_12 AUGUSTUS start_codon 373466 373468 . - 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MPVSQVESLSLGKSEFDSSLIKLFYSRLGIQSIGEAALVIAGELTEELSDAVKKIWITAAQQLRWPYWDWTDPSTGKE # GLPALLKPHAVVLQIPNGTQRRLEYNPLATYQFENPRPDGFQNMENSKDDRWSPFQVGQTAYFKDWTSTYRWPTNSLHPEEQYASIDEYVVVVLSESN # TSIPFEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 Scaffold_12 AUGUSTUS gene 375529 377762 0.4 + . g463 Scaffold_12 AUGUSTUS transcript 375529 377762 0.4 + . g463.t1 Scaffold_12 AUGUSTUS start_codon 375529 375531 . + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_12 AUGUSTUS CDS 375529 375930 0.4 + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_12 AUGUSTUS CDS 376055 376491 0.5 + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_12 AUGUSTUS CDS 376550 377762 1 + 1 transcript_id "g463.t1"; gene_id "g463"; Scaffold_12 AUGUSTUS stop_codon 377760 377762 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MNSYPLELIAQLAPVMFVAGLNPASLNNANNVPNTTSPPLQSIQPPPPTHHSRNPSLTTMTTVSGADSVNYSLSLPPS # TTAPNLLRPDPFTILTSRLREILVHQRKITVWDTPTADKVFQVILIDKDVKFPPRKLYSWLFIRLFEADDPSSIYAYSLGVEYNTEFEQRLKEFRDLA # DRRNDKDTDRVVERVKELERLKDTELAALIAQRKRSTNERGIKLTVVLMASRKLLDDSASGAAGGLGLDARLTFIRRQSGLDSRAALFVLSPIPREEL # NDFVKSLQTALWDPAVEYYTAHSKRVRQKRNRHQAQSAQSSHRPTPSIVASSSSSNALGAMSALPAPLKPEGWTVRYEYKMASFAEFRGEYEVALKHY # QDAYAALTMLFMAPGSSLAMASGGAGVTMPISTSISTSTMPTSTSSMSATSSTSAASRAGVSSPVPGNGGSRTKRWAEAKVLADTINIKIVKLYLYNN # ETGLALAQQRLHVRTFPVVAGFTGGSTMSTKTGSAPVGGQITPSLSAADEGSYEYWSWVSRMWCILAEMLVEGTRTRGSPGSPPIPPSLIIPIHRPRL # PPSSAAVSTTDSGSRKPSPTPESLLHSAAPGVNPAHALMHPGWYYLLAAECAERKVGRFVEGLNFGASDEMKEQKITHLRALVGDILEVSVSLSFALS # RLSYSHLLPNVHDLHLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 Scaffold_12 AUGUSTUS gene 377880 378287 0.95 + . g464 Scaffold_12 AUGUSTUS transcript 377880 378287 0.95 + . g464.t1 Scaffold_12 AUGUSTUS start_codon 377880 377882 . + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_12 AUGUSTUS CDS 377880 378287 0.95 + 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_12 AUGUSTUS stop_codon 378285 378287 . + 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MTTSISNASNAVGPSNPPTNTSTSTTDRLALYIAHRIALTYARFPDPNRPDLRSTNSSNDTLRISKDSKNTGDPAADN # AEDLDEPGTSDNAPHELESLFAEFDSWAREFSADADEDLSESLDEGNFRGKDPESLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 Scaffold_12 AUGUSTUS gene 378413 380005 0.71 + . g465 Scaffold_12 AUGUSTUS transcript 378413 380005 0.71 + . g465.t1 Scaffold_12 AUGUSTUS start_codon 378413 378415 . + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_12 AUGUSTUS CDS 378413 380005 0.71 + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_12 AUGUSTUS stop_codon 380003 380005 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MFPGYPSNAGFLTYPTAKYNTEDDRENDEIWGWPALLVPLLRTWSGILRELVGRGINEMRKLSKTLRTSQKLDSLYKL # NSTPEKLESLEAHFDSYTRVLISRISVDRDVEFSRKKEEMEIQRELKRVMEMWVGVQTLKEVLDKTSSDSSSTREVKVIRVDNAETQPIFDTSVVFWY # GRIWISPFFPSVSSLSSSSSSNAESIQESTPFQLTLTAPSRVAIDKLDWVELRVRVTFEYEGYDDFDEGYEKQEEEGEGRGKEEGGNEDGEEDDEEGD # NREGAIRTDVEEAKIDLRTQEIEVIIRSNSLSQGGEAIETLNEPVQMIDVGHLSFGTGFGFDKKADYDGKSSTDKIQEIISVSSSSLRWTPGQAVIIT # GSVRVCSSGGGDQFGQGKIRVSDMLPDFKLFIVLLSRYLPFFSDSTPLLPRHLLRVFPTLHHSCSKSLYMSPLDEELRLRLRHMFMHLVAENLERAQE # LVEFTRKQCGSLGSRRFSTGTLNMGLRLRDGSLCRDVGLRKGWDMKVLSNVICYRMLFIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 Scaffold_12 AUGUSTUS gene 380745 381471 0.77 + . g466 Scaffold_12 AUGUSTUS transcript 380745 381471 0.77 + . g466.t1 Scaffold_12 AUGUSTUS start_codon 380745 380747 . + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_12 AUGUSTUS CDS 380745 381080 0.97 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_12 AUGUSTUS CDS 381157 381471 0.77 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_12 AUGUSTUS stop_codon 381469 381471 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MFGTTFLIRDVWTLLRTPLSNPGEGALWDRPQKPWWLDDEKDDHGDEGKGGNGYRGDTWEERVEADVEAVLGTTIVCV # GGGIADSGGSTSGSGLTSVASLGVEVEKVVLRRKDPRSTIVRILTSETILGSEKAVVKDEGEEQEEDGELSLFPLGKHSPSPTVIIANCSSFFLTIYN # ISHMPHTQNSYQEISSQMSVGLVSLPTGMMKRFISMRMVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 Scaffold_12 AUGUSTUS gene 387972 388691 0.85 - . g467 Scaffold_12 AUGUSTUS transcript 387972 388691 0.85 - . g467.t1 Scaffold_12 AUGUSTUS stop_codon 387972 387974 . - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_12 AUGUSTUS CDS 387972 388308 0.85 - 1 transcript_id "g467.t1"; gene_id "g467"; Scaffold_12 AUGUSTUS CDS 388393 388691 0.87 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_12 AUGUSTUS start_codon 388689 388691 . - 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MTCQWLLPFLENILAQQLDAVAKKHLLDNGDKQDNNNQEDHTVGQIQLWDEPTVVQVEDKTSDKSVTLNNGWTWIGLW # KFFYMSSTYACNPYFKDGRGKSLSIDTEYILKQCLNKSDQEFQHAIKLLENIYNNDSETETKDDDEAQDKNAALQSTVDVLSVSVANLNNSMDELKGM # IAGQKELLLNANHRSTSPFVVSNPNVCFTTMIQYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 Scaffold_12 AUGUSTUS gene 392545 393312 0.88 - . g468 Scaffold_12 AUGUSTUS transcript 392545 393312 0.88 - . g468.t1 Scaffold_12 AUGUSTUS stop_codon 392545 392547 . - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_12 AUGUSTUS CDS 392545 393312 0.88 - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_12 AUGUSTUS start_codon 393310 393312 . - 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MSRNPNSLTNTYHRDTYPAISPTKPSLNQAGRTILITGGGSGIGFAIARSFAQASASRIIIVGRRVSVLEEAASKLRE # EFKDSNPTTEIIIRQGDIGDDSSISALWDYLTSQNIFVRVLVLNAAHVTPWGSDTLKMDKRDLMEAFDVNIGGNFLMTVKFVNQPLRPRGEQLNLINL # STANIHMYPLPNQTPYATSKSGFTTLIGRIADEHPVEELQIISFNPGAHYSESAAKYFEKGHYKWDEKYAQCPSARGPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 Scaffold_12 AUGUSTUS gene 399381 400068 0.59 + . g469 Scaffold_12 AUGUSTUS transcript 399381 400068 0.59 + . g469.t1 Scaffold_12 AUGUSTUS start_codon 399381 399383 . + 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_12 AUGUSTUS CDS 399381 399811 0.59 + 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_12 AUGUSTUS CDS 399894 400068 0.63 + 1 transcript_id "g469.t1"; gene_id "g469"; Scaffold_12 AUGUSTUS stop_codon 400066 400068 . + 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MVFEKPSQDEVCVICGQTVPVDEPSDYTEDKLQNHRAASLNLSLPSSNNPDSSSDLSTLGSVAHFLDLHNIPKSLPQP # PYISDSKMLQGQSMAEFEALCRNYLSMLANNPTNDGLSPASDNIFPTQPPEFMRKEGEPVYRLPESPYADLPTSPLLAIDWDDLLTSPLSDSIGTPII # DEFEWPDGLFIGNDDVLNVALTSSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 Scaffold_12 AUGUSTUS gene 400462 400800 0.44 - . g470 Scaffold_12 AUGUSTUS transcript 400462 400800 0.44 - . g470.t1 Scaffold_12 AUGUSTUS stop_codon 400462 400464 . - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_12 AUGUSTUS CDS 400462 400800 0.44 - 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_12 AUGUSTUS start_codon 400798 400800 . - 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MMDWSPIYDIPPHGINVAMNANWSGLAKPHSRTTHPVKYYFIDWNLSGHYDPSLGTPMLRPGYGGDQSVPEFKRNEPC # NPFAVDVYCMGNVIRRRFVSVSVPIYICRSLFPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 Scaffold_12 AUGUSTUS gene 419421 420422 0.99 - . g471 Scaffold_12 AUGUSTUS transcript 419421 420422 0.99 - . g471.t1 Scaffold_12 AUGUSTUS stop_codon 419421 419423 . - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_12 AUGUSTUS CDS 419421 420422 0.99 - 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_12 AUGUSTUS start_codon 420420 420422 . - 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MRNPHSRKRYGLLQLLRLILNASVALYNQDKTEQEVSLQSQVLNRYIDHLGSSSLHSFKQEKLRSELNSLDLRRKKAE # EATKEHLKLLEICNAEDIEKRVSQVQRNVEVLETEVIPALRELLASLEPPMESERNPLNLKLDNLYINMQRIALDLGISMEGPFTQVVEGPASINLTR # ADHNYGVDDTVMDSFVNWDGGLPDTSVSDSVDGESNVNTLHLSFPSHVPPSTPKFSKTVGTMTHFNGHFSYPMVADTSTNPSVGSNLHQEEAETKETE # PDRRLEIPNCIALLLDKRKRVKNLQEETEYMKKLISKVRRVQAPHVSRIEFSRSYKNKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 Scaffold_12 AUGUSTUS gene 427540 427953 0.33 - . g472 Scaffold_12 AUGUSTUS transcript 427540 427953 0.33 - . g472.t1 Scaffold_12 AUGUSTUS stop_codon 427540 427542 . - 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_12 AUGUSTUS CDS 427540 427953 0.33 - 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_12 AUGUSTUS start_codon 427951 427953 . - 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MSLLVIEKLGGLLELGKPLPNGAEYVFRVLFPENMFNRSHIRSDLNDVGSDLAKLHILHSDLRWENILSVLPPSEGGL # PSLPSPFTGKIYGWRLVDFDLAKRTTHHITFAQGHYIGHMERVLSCIPMGIPVQPWNDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 Scaffold_12 AUGUSTUS gene 429546 429966 0.28 - . g473 Scaffold_12 AUGUSTUS transcript 429546 429966 0.28 - . g473.t1 Scaffold_12 AUGUSTUS stop_codon 429546 429548 . - 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_12 AUGUSTUS CDS 429546 429808 0.42 - 2 transcript_id "g473.t1"; gene_id "g473"; Scaffold_12 AUGUSTUS CDS 429864 429966 0.62 - 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_12 AUGUSTUS start_codon 429964 429966 . - 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MVRDNKLLGNFNLVGIPPAPKGVPQIEITFDIDADGIVNVAAKDKATNKDQSMTIASSSGLSDKDIEKMVSDAEQFAE # SDKARRSLIEEANKADSVCADTEKGTSTLVVNILASHVFHSYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 Scaffold_12 AUGUSTUS gene 430080 431509 0.65 - . g474 Scaffold_12 AUGUSTUS transcript 430080 431509 0.65 - . g474.t1 Scaffold_12 AUGUSTUS stop_codon 430080 430082 . - 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_12 AUGUSTUS CDS 430080 430929 1 - 1 transcript_id "g474.t1"; gene_id "g474"; Scaffold_12 AUGUSTUS CDS 431234 431259 0.94 - 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_12 AUGUSTUS CDS 431354 431509 0.7 - 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_12 AUGUSTUS start_codon 431507 431509 . - 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MPSVGPVVGIDLGTTNSCVSVMQGKDSLVIENAEGVRTTPSVVAFTKHGERLEVQDDMKHCHAVITVPAYFNDAQRQA # TKDAGQIAGLDVLRVINEPTAAALAYGLDKNDFSIIAVYDLGGGTFDISILEMQKGVFEVKSTNGDTHLGGEDFDIVLVEHLLNEFKKESGIDLSGDR # MAIQRIREAAEKAKIELSSTTQTEINLPFITADASGPKHINTKLLRSQFESLVDPLVKRTTDPCKKALSDAGVKASEINDVILVGGMTRMPRVGETVK # SIFGREPSKGVNPDEAVAKGAAIQGGVLAGSVTDILLLDVTPLSLGKLLYLLFMVSVQFSQVSRPWGVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 Scaffold_12 AUGUSTUS gene 432787 433229 0.73 - . g475 Scaffold_12 AUGUSTUS transcript 432787 433229 0.73 - . g475.t1 Scaffold_12 AUGUSTUS stop_codon 432787 432789 . - 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_12 AUGUSTUS CDS 432787 433043 0.74 - 2 transcript_id "g475.t1"; gene_id "g475"; Scaffold_12 AUGUSTUS CDS 433094 433229 0.73 - 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_12 AUGUSTUS start_codon 433227 433229 . - 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MRLVSAPTVASALSLALLSSAQTITGQYDCLPAGDFTLCQNLWGELSGVGNQSSTLISTTGNAVSWSTTWNWANNPNN # VKSCGYCSVARLIKTIPKLPSSSLDPDANVLSNTAKGVQVNNLIHEVHSDEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 Scaffold_12 AUGUSTUS gene 435009 435443 0.86 - . g476 Scaffold_12 AUGUSTUS transcript 435009 435443 0.86 - . g476.t1 Scaffold_12 AUGUSTUS stop_codon 435009 435011 . - 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_12 AUGUSTUS CDS 435009 435443 0.86 - 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_12 AUGUSTUS start_codon 435441 435443 . - 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MHWPSRAKNVVLVRFYTIPTPLISYRCLSVSLSATGTATTGSFSATGINTSSVTTTTSQASSTSASGSSVSAASSGSS # SGSSSGSATSSHSSGSGSSSTSSSTASTSATSSSSSGADKIAFFSTAGVIALGVVAFGFGLGNGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 Scaffold_12 AUGUSTUS gene 436719 437138 0.53 - . g477 Scaffold_12 AUGUSTUS transcript 436719 437138 0.53 - . g477.t1 Scaffold_12 AUGUSTUS stop_codon 436719 436721 . - 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_12 AUGUSTUS CDS 436719 437138 0.53 - 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_12 AUGUSTUS start_codon 437136 437138 . - 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MVQKDRLESFYGKEVIVADRDLVECGSDEILKDADKEDVCLLVVGDPFGATTHTDILLRARHLGIPTRVIHNASIMNA # IGASGLQLYNFGQTVSLVFFTETWKPDSFYDRIKENTEGGLHTLLLLDIKVKEQNEENLAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 Scaffold_12 AUGUSTUS gene 437575 438420 0.32 - . g478 Scaffold_12 AUGUSTUS transcript 437575 438420 0.32 - . g478.t1 Scaffold_12 AUGUSTUS stop_codon 437575 437577 . - 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_12 AUGUSTUS CDS 437575 438243 0.64 - 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_12 AUGUSTUS CDS 438361 438420 0.32 - 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_12 AUGUSTUS start_codon 438418 438420 . - 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MLPLHFILSMESRLISISLEYPQPQYLSIEYFIIQTNPSNSSSTEGSSNSTGVGSSSGGSSSSHSTPVGAIVGGVVGG # VVGLAAIILALYFFFRRRRRSAHHSPGMLDLSAGTPPLGHYGPNSGGSIINSPPPMQSVSSSGRPGSGAFSPDALYRDGTSPPHSPSAVMDSSVAGSV # AGSSSRASQSGPDSGRLVSMKNAQSLKVRDEQLRRSELRLHTDSGVRLPAPNEREVIDVPPTYTED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 Scaffold_12 AUGUSTUS gene 440493 441031 0.93 - . g479 Scaffold_12 AUGUSTUS transcript 440493 441031 0.93 - . g479.t1 Scaffold_12 AUGUSTUS stop_codon 440493 440495 . - 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_12 AUGUSTUS CDS 440493 440932 0.93 - 2 transcript_id "g479.t1"; gene_id "g479"; Scaffold_12 AUGUSTUS CDS 441013 441031 0.99 - 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_12 AUGUSTUS start_codon 441029 441031 . - 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MNFAFNVNFGSPTLFNASTAFYAIDGNTGVNFDLPGSAKSQNTGNYSNIINYPLFTASNLSTSPHNIEVATSYNGSKT # PQYLSIDYFIVKTNPANSTSLEHASNSSSIDSTSRSHSNVASIVGGVIGGVIGLAALLSLSTISGNGNKINTVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 Scaffold_12 AUGUSTUS gene 449662 451136 0.3 + . g480 Scaffold_12 AUGUSTUS transcript 449662 451136 0.3 + . g480.t1 Scaffold_12 AUGUSTUS start_codon 449662 449664 . + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_12 AUGUSTUS CDS 449662 450074 0.3 + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_12 AUGUSTUS CDS 450155 451136 0.69 + 1 transcript_id "g480.t1"; gene_id "g480"; Scaffold_12 AUGUSTUS stop_codon 451134 451136 . + 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MPRLALNNHLYRGELPDELKNVTWVEEMACSLYKTTAHVTRIYGSNKSSDPLQMHGNACAHPLDICSAVKILPWTPTD # LNDLISIIFVGPRKLTEKDLQKLKPFFVRREVIRRLLNMLCHHNQLYMGLPPPNAEHLALKETEGFDEHPGAIVEQESSDEVLLEKSSVYDPESVDVP # ARYMAAAAIHNIAERLVQSADNHGDFILRYNKDAIVEYNNADLFPGMFPTLYPLGIGGFEDSRQCPKVSIEAHAEHLLDDSSRVFRYHHFFSFVILNL # IQRRKAHLHTSISVASQKFEQISTALLSVTPYVLSSLANHLKHEKDVSHFTEDERNAFRLLKEVNFISAKIPGSQAAKSKIRQNIRSYYAYFGLPHLF # VTLNPSAVHSPVFQVIYGDQNVDLSADMPFIVQPRSERAYRLACDPVAGADFFEFMYRTIFGSLFGWDFEKGKSVQNGGIFGHLRAFFGVLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 Scaffold_12 AUGUSTUS gene 452689 452997 0.72 + . g481 Scaffold_12 AUGUSTUS transcript 452689 452997 0.72 + . g481.t1 Scaffold_12 AUGUSTUS start_codon 452689 452691 . + 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_12 AUGUSTUS CDS 452689 452997 0.72 + 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_12 AUGUSTUS stop_codon 452995 452997 . + 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MLSELQSDTSICIDTLTDKQMDEWCKEAKELGEKFSAMRRQRTDINNQVSDSYNAGSIVMHDTYENYPNMCNTMSGNS # KNKKALTPLELKKEIMTQFELNQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 Scaffold_12 AUGUSTUS gene 453358 454432 0.37 + . g482 Scaffold_12 AUGUSTUS transcript 453358 454432 0.37 + . g482.t1 Scaffold_12 AUGUSTUS start_codon 453358 453360 . + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_12 AUGUSTUS CDS 453358 453367 0.38 + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_12 AUGUSTUS CDS 453420 454432 0.39 + 2 transcript_id "g482.t1"; gene_id "g482"; Scaffold_12 AUGUSTUS stop_codon 454430 454432 . + 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MERSEIDAALRYAKEKPDDYFGGINIIFAGDLFQYPPVGTALYTPIRSSGPQTVNEMKRRRFAWKAINEVVILTEQKR # MEVDVEYAAAVSRLRIRECTEADVELFNTRVIKTANNPNGVTFETNEEYQASIIVAKNSIRQSLNDFKASAICEKEGSPQLIHVHAYDEIQYKKHPDI # NMIGCKHYPSKFEQLQLLGIDTSSGKLREGLPGVLKLYIGMPVVLKHKNLNTELGITNGAKGFIRKLELGSDVNGFTYCIGALVEFPNSKVQLDGLPK # GVYPIKPRRWQYNASYSVKKISRYWYLLQGFKYHLSLLLHLQVSLHKDIHLHLFFVCYTWVDMVHM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 Scaffold_12 AUGUSTUS gene 465742 466908 0.88 + . g483 Scaffold_12 AUGUSTUS transcript 465742 466908 0.88 + . g483.t1 Scaffold_12 AUGUSTUS start_codon 465742 465744 . + 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_12 AUGUSTUS CDS 465742 466908 0.88 + 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_12 AUGUSTUS stop_codon 466906 466908 . + 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 Scaffold_12 AUGUSTUS gene 466959 468392 0.93 + . g484 Scaffold_12 AUGUSTUS transcript 466959 468392 0.93 + . g484.t1 Scaffold_12 AUGUSTUS start_codon 466959 466961 . + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_12 AUGUSTUS CDS 466959 468392 0.93 + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_12 AUGUSTUS stop_codon 468390 468392 . + 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 Scaffold_12 AUGUSTUS gene 469334 470674 1 + . g485 Scaffold_12 AUGUSTUS transcript 469334 470674 1 + . g485.t1 Scaffold_12 AUGUSTUS start_codon 469334 469336 . + 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_12 AUGUSTUS CDS 469334 470674 1 + 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_12 AUGUSTUS stop_codon 470672 470674 . + 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MGWSTTEVEYTYQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARVCARKKIQRHPRA # VTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIK # SDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDA # GAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEI # PTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 Scaffold_12 AUGUSTUS gene 472159 472662 0.56 - . g486 Scaffold_12 AUGUSTUS transcript 472159 472662 0.56 - . g486.t1 Scaffold_12 AUGUSTUS stop_codon 472159 472161 . - 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_12 AUGUSTUS CDS 472159 472662 0.56 - 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_12 AUGUSTUS start_codon 472660 472662 . - 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MSIHSKSTLQEVFDNPAFHFPALQLLSYHNHNGSLHIGNFLHRHGTLKFLTYHVTEYQFAESADLLDSNILHNLLRFT # GSPSSASVLCRSQMRSISQISVEIINNEDPYIDKLVEALEGSTPIQKLILNTRQQYPLDVIQKFMDTCTCLKFFGCVLAPFNDESQVSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 Scaffold_12 AUGUSTUS gene 487042 487645 0.4 + . g487 Scaffold_12 AUGUSTUS transcript 487042 487645 0.4 + . g487.t1 Scaffold_12 AUGUSTUS start_codon 487042 487044 . + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_12 AUGUSTUS CDS 487042 487050 0.41 + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_12 AUGUSTUS CDS 487427 487645 0.52 + 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_12 AUGUSTUS stop_codon 487643 487645 . + 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MYQLHLDRLSSTLKHKCNESYDENPSPKKKGKKAKHLSMDNQTTEQDPTTENSHDQEINNQPMSELYEDDLMCPM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 Scaffold_12 AUGUSTUS gene 493393 493878 0.83 + . g488 Scaffold_12 AUGUSTUS transcript 493393 493878 0.83 + . g488.t1 Scaffold_12 AUGUSTUS start_codon 493393 493395 . + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_12 AUGUSTUS CDS 493393 493878 0.83 + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_12 AUGUSTUS stop_codon 493876 493878 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MLQELFNDIKITFLCLQEFVIEDAPVDIDDFLQRHPNIIRMTFMPSWQVYNAESVLRDIKIIPNLQSFTGTGNVAASA # CNSHRPLVYLGLREHRPSDVKMIQLLNGIHHTPTLINISLMVNWESGYELNELRNFITACPQLRILKCCIQQTGENVSTITSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 Scaffold_12 AUGUSTUS gene 497144 497998 0.15 - . g489 Scaffold_12 AUGUSTUS transcript 497144 497998 0.15 - . g489.t1 Scaffold_12 AUGUSTUS stop_codon 497144 497146 . - 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_12 AUGUSTUS CDS 497144 497652 0.6 - 2 transcript_id "g489.t1"; gene_id "g489"; Scaffold_12 AUGUSTUS CDS 497698 497998 0.16 - 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_12 AUGUSTUS start_codon 497996 497998 . - 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MERAALERKKIWQAEEEHRRKLREEEENRIMLAEAHTFLNTELLVFDYPTEEEWQKLRNQPPLQEDPAPITLFDPTFD # IISKSSFGSVRNFPSSFTGMRIGIPKMMDSTDIPEPRPSTTSECTSRQVSDNADIVIRSPTKRATLPVMKQATPSAAKPVTRSVIKPATLPTTKRAMS # PTSRRATSPTSRRARSPASKRARSPTSRRTSSLTAKRTTTSTMKRTGLVTTKRTTLPTTKSTMVDPDLSGKTSSNKKVGDHSFEADNTVFIHL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 Scaffold_12 AUGUSTUS gene 510043 510831 0.44 + . g490 Scaffold_12 AUGUSTUS transcript 510043 510831 0.44 + . g490.t1 Scaffold_12 AUGUSTUS start_codon 510043 510045 . + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_12 AUGUSTUS CDS 510043 510066 0.44 + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_12 AUGUSTUS CDS 510187 510831 0.48 + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_12 AUGUSTUS stop_codon 510829 510831 . + 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MVEVLNLVAARDLHAVLELPTDTSETQVFLRSIPTVFHDIDFPYPSRPDVPSIATGETVALVSASSCGKSTIARVLQH # LCESSSGFVEVADIDTGAMNIQQLCQCVSIISQPADLFDASVAENIGYGKSLISEVDIRKAIKTADIHDQVMSLEKDWTRTSARTLASFRVDEHKDCK # LPGRLLDRVGFEWLKQALRHRAGYYHKVLSKPNESRAEVVQEGCGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 Scaffold_12 AUGUSTUS gene 512043 512258 0.68 + . g491 Scaffold_12 AUGUSTUS transcript 512043 512258 0.68 + . g491.t1 Scaffold_12 AUGUSTUS start_codon 512043 512045 . + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_12 AUGUSTUS CDS 512043 512258 0.68 + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_12 AUGUSTUS stop_codon 512256 512258 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MINSVDDELNNADSDTNSDTDSNTDSNTDSKYTDSEYTDSENGNESDSDSDYQHLRFTQQKTSKNQPHLLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 Scaffold_12 AUGUSTUS gene 532508 534604 0.94 - . g492 Scaffold_12 AUGUSTUS transcript 532508 534604 0.94 - . g492.t1 Scaffold_12 AUGUSTUS stop_codon 532508 532510 . - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_12 AUGUSTUS CDS 532508 534604 0.94 - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_12 AUGUSTUS start_codon 534602 534604 . - 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWAHCTRPHPPTSPMGPLSVTV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 Scaffold_12 AUGUSTUS gene 535589 535819 0.51 - . g493 Scaffold_12 AUGUSTUS transcript 535589 535819 0.51 - . g493.t1 Scaffold_12 AUGUSTUS stop_codon 535589 535591 . - 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_12 AUGUSTUS CDS 535589 535819 0.51 - 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_12 AUGUSTUS start_codon 535817 535819 . - 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 Scaffold_12 AUGUSTUS gene 541935 543166 0.28 - . g494 Scaffold_12 AUGUSTUS transcript 541935 543166 0.28 - . g494.t1 Scaffold_12 AUGUSTUS stop_codon 541935 541937 . - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_12 AUGUSTUS CDS 541935 542271 0.76 - 1 transcript_id "g494.t1"; gene_id "g494"; Scaffold_12 AUGUSTUS CDS 542452 542594 0.76 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_12 AUGUSTUS CDS 542808 542920 0.71 - 2 transcript_id "g494.t1"; gene_id "g494"; Scaffold_12 AUGUSTUS CDS 543007 543166 0.46 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_12 AUGUSTUS start_codon 543164 543166 . - 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MDVADLEMEDSAIETALKETEVTKAGTTLTWLDARSVMTNANLFDGAIFAEARILSRLWFTTTFTLGWLEVWMFYAHA # LVRQHWSQTMSVWNRFKGQFYSALAGFIEPGETFEDAVKREMWEEAGVKAWDVQYHSGQPCTHRRCCHSDARWFTREEVMSVLNHATGSYLDLAKLAE # ASSQLNKDANDPPFRVPPTTAIAGVLIKDWAEESTVSSVCFEQPERKSVECNSLDLLLCHYHSGNFPILNHTPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 Scaffold_12 AUGUSTUS gene 546724 547261 0.93 - . g495 Scaffold_12 AUGUSTUS transcript 546724 547261 0.93 - . g495.t1 Scaffold_12 AUGUSTUS stop_codon 546724 546726 . - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_12 AUGUSTUS CDS 546724 547156 0.99 - 1 transcript_id "g495.t1"; gene_id "g495"; Scaffold_12 AUGUSTUS CDS 547227 547261 0.94 - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_12 AUGUSTUS start_codon 547259 547261 . - 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MIPVGTSVGEVKLAEYLESEPERLAAKAEAQKAKLEALERRLGIDSPSTGAGPSRTGSSSTEQPAKLAGKKHRFDDTE # YLEQSRELVDNVKSAVSAGKLPVPLIIIKANNIVALLKKKKKAKLSPTDAQSSKAQAPSKMPTPVVVPAAPTEAVGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 Scaffold_12 AUGUSTUS gene 579650 580322 0.28 + . g496 Scaffold_12 AUGUSTUS transcript 579650 580322 0.28 + . g496.t1 Scaffold_12 AUGUSTUS start_codon 579650 579652 . + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_12 AUGUSTUS CDS 579650 579694 0.48 + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_12 AUGUSTUS CDS 580050 580322 1 + 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_12 AUGUSTUS stop_codon 580320 580322 . + 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MLLVDSLDPQSILFPDGLHELQNEPPSIRQKFVTDIVSFVQGRTSTPVAQPNSTHEHTGSNDNNAGVTVALPLSSSSA # PNSTDPNTQLSLEIDRDGDDMKVTPKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 Scaffold_12 AUGUSTUS gene 582199 582750 1 - . g497 Scaffold_12 AUGUSTUS transcript 582199 582750 1 - . g497.t1 Scaffold_12 AUGUSTUS stop_codon 582199 582201 . - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_12 AUGUSTUS CDS 582199 582750 1 - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_12 AUGUSTUS start_codon 582748 582750 . - 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MSIIYIDEATGSDTTGQGTEAQPYQSLAFAIFTTADAKYLIRKDANTSYDEPTQSAIKKGKKGADGLEKKRKKAEELA # EREAKEKGEEREKRERLLEESKSIVLIEDTSLAKAIKVFNNYFFILNVVYRELCSRQRYHNLLNIDLNEFVSSAGSTVYDNKKTSPLLLYAMVQDIFK # LFFQAAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # start gene g498 Scaffold_12 AUGUSTUS gene 584842 585732 0.87 - . g498 Scaffold_12 AUGUSTUS transcript 584842 585732 0.87 - . g498.t1 Scaffold_12 AUGUSTUS stop_codon 584842 584844 . - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_12 AUGUSTUS CDS 584842 585732 0.87 - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_12 AUGUSTUS start_codon 585730 585732 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MDKPDVTARIYDEPMEIEPHSPSLTTLEVRSSPSLEINSRTRRQKVARPPLPPRTTRSASSKVPTKESTTSGRTKKVP # VSRKAGKKAANKAVASSEVADVAPSAVASSSSIDLSGHKESPADVDISNPQTLPVFTDDGEPLSELSDLPEDYLDVELPLKGDGGEDVEMEAPSDTAE # SRMKPSGDEKNSIRFSPKRKSPRGLKSEEAAPEGASASFSVVSPPSPNSTSTAPLSARSTRSSKKSAIPVPITPARPKSSIFKSPAAPGIKPGSAPSS # PTKLTKSYSMFSYVPVSEYLEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 Scaffold_12 AUGUSTUS gene 585958 587364 0.98 - . g499 Scaffold_12 AUGUSTUS transcript 585958 587364 0.98 - . g499.t1 Scaffold_12 AUGUSTUS stop_codon 585958 585960 . - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_12 AUGUSTUS CDS 585958 587364 0.98 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_12 AUGUSTUS start_codon 587362 587364 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MNLSPKKLGDKRSPSPSTSTDWPRLKRFKSSPKGSDLEANIASKPAHSRHLSDSILIVAKTRRKRSATTSKPKSSSSS # TTRRQSPAVLPPQKERARSVPVFPSFRDFPVININDIPTSPTRRRPPSWEPKLRITSGSLFPQSQTLESIPDEAGEEPEETVGAARGVVAEISVDAPL # PATPRQTDVLAVPADIHAVPLSPLTPLPETPFFKKVTENVDNTEDRFAASGEGQVCIPPLSGLVSLNCSQALFRKEEPKAVSETTSIEAVVPVKVSRS # RLPRPTNATASSSKTNLKGVVPLQATSNRPAASRGQETNAFDVLMRRTGKMQAKEKKSTEMTEIPIHLSGVNVDKATEIGKVTKQKKGSDMKGKGKSG # TNVEVKSGSTSTIIGKMRPRTKPDVKKPAIPHIFLEDEGEDLPGELSNIGKIPGSPAYPLQPLPTRNSPSPLEFGALPPKSSSPDIEERLALTKQY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 Scaffold_12 AUGUSTUS gene 591801 592904 0.91 - . g500 Scaffold_12 AUGUSTUS transcript 591801 592904 0.91 - . g500.t1 Scaffold_12 AUGUSTUS stop_codon 591801 591803 . - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_12 AUGUSTUS CDS 591801 592904 0.91 - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_12 AUGUSTUS start_codon 592902 592904 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MAYFETLIEQYRSRNSTTPCVTLGKRKRDPRVLPSSSTSASSLFEDNSFIGKEDNRQRISHRPRKRLCGSGSSRALDG # DAVDRAGNEYNRDEDHNKAYRRSKRLPAAPSSRSHGSDNSGEESDNEEDTSTPIEETGSLGRAGFFQREGAHTLSSLTMRFTRRHLRNSRAQDNVQDE # DDDLIEVDSYLRGCSVGSVESNMQSATDPPNSHSDKSSGARVRFASPCVSAKYTSTTIATLSPSLTEPQEFSATPIYVWRRVKILPRIQTLTSTDRPD # TMALNSPYDSDDCVSANADANNGLASVMPAHSSRRLRSNSLVRTRNVTKDSATDPRHPKTKCRVSTRLQTPSPSTYQSCRTRSMSSSAMKLGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 Scaffold_12 AUGUSTUS gene 597082 597915 0.77 + . g501 Scaffold_12 AUGUSTUS transcript 597082 597915 0.77 + . g501.t1 Scaffold_12 AUGUSTUS start_codon 597082 597084 . + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_12 AUGUSTUS CDS 597082 597915 0.77 + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_12 AUGUSTUS stop_codon 597913 597915 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MAVSQTVRILPEVITALRKGWPEHISLAYFNPKMVCSNPANRRRSDNTVSLSGTDLQIKSKDLSHFDLARVSTDDFGE # IAKTMPKALEAFLITEKSHGRTGSDHALAIADFVRRTFQMVTNRDDYLECFPTYLIYTEQVLFDWKNNPKQRGVPFVFNETRWSRIERGVRCKSDWLL # AYYTFQTSDQNNGKPKSNPSFRDTSTSSTSTSHQDNQCICGDGAHSSAQHVAKPTDIIRKDSNGRNWREKKENGEILCYSFNRRNGCSRAVCRYKHMW # QLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 Scaffold_12 AUGUSTUS gene 601876 602964 0.61 + . g502 Scaffold_12 AUGUSTUS transcript 601876 602964 0.61 + . g502.t1 Scaffold_12 AUGUSTUS start_codon 601876 601878 . + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_12 AUGUSTUS CDS 601876 602964 0.61 + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_12 AUGUSTUS stop_codon 602962 602964 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MTRIRTTLTTTTTHSNPARLSAKVRKLMNASVAAKTQSRKRNNITEFLDWAHQQHLHAKDVLPASEITLCEYAAEFGG # KLAGSSVKAKLSAIKGWTITKGYAWQGSDRLRKVLAGIERSAPPSSFRPEREPVKKSHLSMLHEDLDLSDTNGLDCCIAAAADLMFYSQLRAGEVLPT # NSSIAQYDFKAMPRVSDLSKANNAGSKKLFLPKTKTSQMRGDKVMIPVQQGSTNPIHSLDNHIHVNKLAPSDPLFAYMDTKGTKRILTKTLFLRRCNA # IWKRHSISRRTGHCFRIGGTTHYLLAGVNPDVVQVFGRWKSSAFLKYWRNLESLASLHLHRHHSQQSHFSRVSTENITRRRHRTTYRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 Scaffold_12 AUGUSTUS gene 606624 607308 0.41 + . g503 Scaffold_12 AUGUSTUS transcript 606624 607308 0.41 + . g503.t1 Scaffold_12 AUGUSTUS start_codon 606624 606626 . + 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_12 AUGUSTUS CDS 606624 606678 0.41 + 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_12 AUGUSTUS CDS 606758 607308 0.62 + 2 transcript_id "g503.t1"; gene_id "g503"; Scaffold_12 AUGUSTUS stop_codon 607306 607308 . + 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MHPLTIFHRTENSRLDPVHSRSRDYNFGSSDDHNLRSAATTFDYNDHPSSATTFDFNHPPPPPPSTTSTPPPPSTTSV # TTSKSVVSTTSTTSSSTQIAVTTSSSATAISTTSSTQVTSTASALSTTALSAAGSSTSGFVTLPSASLSTVPAVSTSTSTIAAPSTSTTSATTNNNSA # ASVSRQGPVTAVIGILMVLGAINLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 Scaffold_12 AUGUSTUS gene 608551 608976 0.38 - . g504 Scaffold_12 AUGUSTUS transcript 608551 608976 0.38 - . g504.t1 Scaffold_12 AUGUSTUS stop_codon 608551 608553 . - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_12 AUGUSTUS CDS 608551 608976 0.38 - 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_12 AUGUSTUS start_codon 608974 608976 . - 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MGISCLLQTEYEKRDGMGWVTRSRRGNKGGNDGEGRADGTGKDRGQQFLISLNHHTLNLIKSSRAKQKDNEQHSGQPG # GAFGEDENVEVSLPLRSSSRDEDNTFVTVLMLSFIAPIRKQRPQMGSSSAWLTNNFLSTQFSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 Scaffold_12 AUGUSTUS gene 610944 611866 0.33 - . g505 Scaffold_12 AUGUSTUS transcript 610944 611866 0.33 - . g505.t1 Scaffold_12 AUGUSTUS stop_codon 610944 610946 . - 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_12 AUGUSTUS CDS 610944 611737 1 - 2 transcript_id "g505.t1"; gene_id "g505"; Scaffold_12 AUGUSTUS CDS 611848 611866 0.33 - 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_12 AUGUSTUS start_codon 611864 611866 . - 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MERGEDPKVYEETKVTNIAFDPIDPEKPVSVSWTRTCTAQSPNASQNGTTKAVHGSTTFTHLIDASGRAGLLSTRYLK # NRHFNASLKNIAVWGYWHNRSDEEPDNEHDKEDHKPRVGMYGKGTSREGAPWFEALTDESGWAWFIPLHNDKTSVGIVMNQEQYNKSRPSSSDAQYKC # SLVGRYLANLRLAPGVARLLCGKDVVHNGSDSEHEIQIPIEEEILHQQAKLEPGSVCSASDFSYSAPSYAGKGFRIVGDAGGDLSEHNSVRLDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 Scaffold_12 AUGUSTUS gene 616138 616521 0.97 + . g506 Scaffold_12 AUGUSTUS transcript 616138 616521 0.97 + . g506.t1 Scaffold_12 AUGUSTUS start_codon 616138 616140 . + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_12 AUGUSTUS CDS 616138 616521 0.97 + 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_12 AUGUSTUS stop_codon 616519 616521 . + 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MGVRLYERELQESLDFCVKLFSDTAPESHIELVSNSNIAQELLDLTAPVVRPQDLERALSVASPLKDTDDLETRRTQE # ATKMVLEKINARKVLNPEYTLNGFEAEALNGFTIRLQRGKLGLKKALDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 Scaffold_12 AUGUSTUS gene 620786 622189 0.47 - . g507 Scaffold_12 AUGUSTUS transcript 620786 622189 0.47 - . g507.t1 Scaffold_12 AUGUSTUS stop_codon 620786 620788 . - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_12 AUGUSTUS CDS 620786 622189 0.47 - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_12 AUGUSTUS start_codon 622187 622189 . - 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MKEPNEKVDPLRFPMIRVEKEYYDDTRGRQWLGHGNDYGYGIYREKSDDLEVQIERELERRGYGSRTFHLVFSRFFLI # TSTENPGGGYTKPPSDVEDIGHSHQPRRSWWQSIYNRISQSGTEDNGVDHTVVHSRHASQRKSKSRDPSKLRSQKSSLDHVATTESRYDMDDPPPPSL # FRSKLSSRQSKAERGAYSPVTPYGDEDMLAPLSAFNGYQKFSKGQSQYRNSVQRQEPNIMFSPPTANYPPQFSPPPASPPPQALLAPTMMMSHGDASA # DSLLGRVFPSKSSDANLTVHGTDNTHSTGYVRAVPRTSLPSRESGHDIGVAGERNPVHNQASLPPSIPQAMTAYVINPMRGANSEGNMYTELRLLDNV # DHGPTRLARLPSHPRPPPNPSPPNEFSPGLRRSSARVGHKQAQTRRSAGCHFIHGQSITPYLPFSLFPVLWLHLPQMPIRMITWQAPRLPNPTNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 Scaffold_12 AUGUSTUS gene 627609 628022 0.37 + . g508 Scaffold_12 AUGUSTUS transcript 627609 628022 0.37 + . g508.t1 Scaffold_12 AUGUSTUS start_codon 627609 627611 . + 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_12 AUGUSTUS CDS 627609 628022 0.37 + 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_12 AUGUSTUS stop_codon 628020 628022 . + 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MSCHAHAHMQGGDTIWGNSTFAPDDPSEDSNVLDANDVRGRRSGHTHGELISFRRIPASVPIPEEGETETRLMDEDNG # VGVKNMTSEMAGDWILEHTPSSFQVCLMLFDANYYLDSDALGMIAENDGNKLFLWNRKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 Scaffold_12 AUGUSTUS gene 637087 638118 0.18 - . g509 Scaffold_12 AUGUSTUS transcript 637087 638118 0.18 - . g509.t1 Scaffold_12 AUGUSTUS stop_codon 637087 637089 . - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_12 AUGUSTUS CDS 637087 638118 0.18 - 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_12 AUGUSTUS start_codon 638116 638118 . - 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MRSSSPLSPRGSVSPFASPIGARPRSNRDDVHRRFLRPRSFGSASPSGSPKINVDGGRGLRTSVDRQRIVDLSIEHSP # EREDDHKEQLDSEINFERETEKDASSVMTAATENSAEMATIETVEKRKVVAVGVVQEHEPAETEASMEVTHDVTMDFEVKGEELQEQAEPNEPVHQDQ # PEPIAVTQAIELRDQSFSGDEVDSGMDDDDADDDNGEEFGLLKAPAFTNSKKLKFDLGSKFGLGKLGFLDLELSSEDLTTPSTSDKSDLGFDFNTKSS # KVPPKSVQNMPVGSVNVRMDMRSALDRLMDDVASVGGSTLEEPHDISMTTTRRMLLDPNSCNALQRILS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 Scaffold_12 AUGUSTUS gene 639007 639550 0.67 - . g510 Scaffold_12 AUGUSTUS transcript 639007 639550 0.67 - . g510.t1 Scaffold_12 AUGUSTUS stop_codon 639007 639009 . - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_12 AUGUSTUS CDS 639007 639393 0.94 - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_12 AUGUSTUS CDS 639482 639550 0.68 - 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_12 AUGUSTUS start_codon 639548 639550 . - 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MHDEAENENDRPFALKREEAVENRKASPPAVPPPPSRIPTHSGASPVRPSLVTKRMHGPRLSGAKRERRKTVTFHENC # EVVEFSRDEDESGEVFESDEDDNYGNAAEDDVDFFGEGKNEETPHDSYEDIELSDQEPEEQLELDADTSIPVW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 Scaffold_12 AUGUSTUS gene 646767 647597 0.42 - . g511 Scaffold_12 AUGUSTUS transcript 646767 647597 0.42 - . g511.t1 Scaffold_12 AUGUSTUS stop_codon 646767 646769 . - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_12 AUGUSTUS CDS 646767 647597 0.42 - 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_12 AUGUSTUS start_codon 647595 647597 . - 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MISRPLFMDKSNDTNNESKLDAIDALQCDLPMLTTLRTKSAYYDDLHTLSAYGELPIPLCHLPSFSPAPAPHTTDVQN # PSNKACVSIDSARSPTSPTGRLFDVAKPPAMAKRRRYTIATSKPSTAKEKENPQGTRPSLGSDGPEEMKEERLSSVLVKNDDESATSSTTWATQVPRP # SPIRTCSISCVPLTSCSPAVEPVKNQVRASDPVQLTPASLKSPAPPSPITPLPARRMNVNVRYIKHYPYMITEPANSPRIEGEIEEEGVLSRMKYHLV # RL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 Scaffold_12 AUGUSTUS gene 656104 656727 0.42 - . g512 Scaffold_12 AUGUSTUS transcript 656104 656727 0.42 - . g512.t1 Scaffold_12 AUGUSTUS stop_codon 656104 656106 . - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_12 AUGUSTUS CDS 656104 656727 0.42 - 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_12 AUGUSTUS start_codon 656725 656727 . - 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MTSCLNDEKGAEVNLGQDDPRQKENSRTSSEVHAEHSNLSEVHAIDPACLRPIVRFDYACLEDLDEELILRPRSAFAE # MCWSTAVQNIPRTTRHSQSSAQSPPSKCCQPCSALNWRSPSHSSRFPLNFKVSEGFFATDEGGQSECHSSSESDRSPSNTWYGSIEESSVMVVTGRLN # VLENHDGVKLFEKKSSPRIVVVPSDSIVSED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 Scaffold_12 AUGUSTUS gene 670522 670968 1 + . g513 Scaffold_12 AUGUSTUS transcript 670522 670968 1 + . g513.t1 Scaffold_12 AUGUSTUS start_codon 670522 670524 . + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_12 AUGUSTUS CDS 670522 670968 1 + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_12 AUGUSTUS stop_codon 670966 670968 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MDDAEILDNANDAPVTQINTAPTPASVEPDAENTKISDPAPPVPSPSIQTDELPQKVPVTTAEGALEAPKSSTNSQEV # EMADEPAVVSVSSVVLSVNDHEEDNAMQVDRPLNVTDALSYLDAVKNKFSTRPDVYNHFLDIMKEFKSQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 Scaffold_12 AUGUSTUS gene 671409 671930 0.56 + . g514 Scaffold_12 AUGUSTUS transcript 671409 671930 0.56 + . g514.t1 Scaffold_12 AUGUSTUS start_codon 671409 671411 . + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_12 AUGUSTUS CDS 671409 671930 0.56 + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_12 AUGUSTUS stop_codon 671928 671930 . + 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MEPAVAYVQKIKQRCDPETYRQFLDILSRYHHSPESINEVRSHVHVFLMCPINMFFLFGFQEEVSKQISQLFKDAPDL # RSDFRIFMPDGSQSLLDDNAAAEEGRHHHHHRERDHHDSKSRRKADVADSASASVLPQKRKRKAGERESIRVEREKIPVKPITSSKVYIRTYPRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 Scaffold_12 AUGUSTUS gene 672527 674376 0.5 + . g515 Scaffold_12 AUGUSTUS transcript 672527 674376 0.5 + . g515.t1 Scaffold_12 AUGUSTUS start_codon 672527 672529 . + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_12 AUGUSTUS CDS 672527 673746 0.5 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_12 AUGUSTUS CDS 673863 674376 0.99 + 1 transcript_id "g515.t1"; gene_id "g515"; Scaffold_12 AUGUSTUS stop_codon 674374 674376 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MCRDVLNDEWVSHPTWALNSSSYGSASTSNNSSGNITYPDPFDDPTFFWAVSRKNVYEEALHRSEEERHEYDFHIEAI # SRTIAILEPINNKISQLSPEERGGFRLKPNLGGSAKAIHQRVVRKIYGREVGTEVLACMQESPAHAVPVVINRLKQKEEEWKRAQREWNKVWREVDAR # NYAKSLDHQSVNFKAADKKLLTAKAFVNEIEAAREEQMASRASLVDPLFSRTRPRHQLEIDFEDLNVLQDSLKLVLSFLDRTQGQIHWTERRRIEAFL # RGLVPLVFMLDAGAFNAAFAVVLELGGADGEIDLEGLGLPDVEAPLTTGSRSGGGRSKKGGGGNGVSGGDLRKKLLKSEQAKSGRKTRGGVTLQASPS # VSRFASPAPHTTLEGTPKIVPTTSRKRGVFFTNTTAQLHEEVRQSSSGSYSPVHYQPISTYDTTSSIISNLRGHEDSTVSEQPGDIDVHTEVVPSLSF # VPAGQTNEESESFQMERERLDPTAAQSYDILLQNCERLFDNEIEQSAFEDQMRSMFGVKVKAPLISNSKTMVNIASLSRMLTRSSQSTSSSEPSSNRL # ARTEITRST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 Scaffold_12 AUGUSTUS gene 682173 682766 0.76 - . g516 Scaffold_12 AUGUSTUS transcript 682173 682766 0.76 - . g516.t1 Scaffold_12 AUGUSTUS stop_codon 682173 682175 . - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_12 AUGUSTUS CDS 682173 682613 0.88 - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_12 AUGUSTUS CDS 682716 682766 0.79 - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_12 AUGUSTUS start_codon 682764 682766 . - 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MASLLERMNVSNSGSGPARSARGDVDSAWSHDLYAQHNSLSARLNLPASKPTLPPDATHASKSLAQKAFRDALSFSSP # STSRGARGGEELNIKGAGSSGNVVEVSGLVDGTTADDVSAIFKRCGDILQSKLISRRNEEVRCPLSITTWLPTENSTKGAHSDHV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 Scaffold_12 AUGUSTUS gene 683253 683639 0.87 + . g517 Scaffold_12 AUGUSTUS transcript 683253 683639 0.87 + . g517.t1 Scaffold_12 AUGUSTUS start_codon 683253 683255 . + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_12 AUGUSTUS CDS 683253 683639 0.87 + 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_12 AUGUSTUS stop_codon 683637 683639 . + 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MAPRIFRSALPDKAIVQRSIFTHQFPEPPLYPPEYPAYVDAQTGVTLNRGHIKDLALTFACALRNKKHAKRGDTIMMF # SPNSICWPVVVFGGMLSQLTGSLMINDPILQPSLLDYDAHSPTLPTLLTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 Scaffold_12 AUGUSTUS gene 683711 685239 0.37 + . g518 Scaffold_12 AUGUSTUS transcript 683711 685239 0.37 + . g518.t1 Scaffold_12 AUGUSTUS start_codon 683711 683713 . + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_12 AUGUSTUS CDS 683711 684596 0.39 + 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_12 AUGUSTUS CDS 684713 685239 0.62 + 2 transcript_id "g518.t1"; gene_id "g518"; Scaffold_12 AUGUSTUS stop_codon 685237 685239 . + 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MLTSETVGVRLKEDAERRIILLPDDFNWVPGVKKTDGKKHIPGLTAFEDLLKLGRLDREEQFQGVDAEQETVFLCYSS # GTTGKPKGVETTHQNLTTVLDIVQSGFPILSPTGDRMLAVLPFYHIYGLVKLLLFPFICGVSTIVMPHFDPLAFCESIQRYKVTITLIVPPVLVVIAR # HDCVEQYDMSSLRIMFSGAAPLGGELVKAVKSRLRPTNQPPLHIVQGYGLTETSPTTHLLPILPAQQWGNITEESKYGSIGFLLPNLEARLVVDDKDG # HAQTDHEVIDAAEGERGELWIPNTNAFFPYSSLPPSDPTPGSRWFKTGDIGIIDKDGFFWIVDRKKELIKYKGFQVPPAELESVLLTHPKVADAGVIG # VESAKESTELPRAYIVPADSSIVSSDRAAELSREVQDWVKTKVSRHKFLRGGVVVVPVIPKSASGKILRRYLKEQAMKELAGRDPADIHAVEKVRTKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 Scaffold_12 AUGUSTUS gene 690351 691428 0.57 + . g519 Scaffold_12 AUGUSTUS transcript 690351 691428 0.57 + . g519.t1 Scaffold_12 AUGUSTUS start_codon 690351 690353 . + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_12 AUGUSTUS CDS 690351 690503 0.58 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_12 AUGUSTUS CDS 690553 691428 0.61 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_12 AUGUSTUS stop_codon 691426 691428 . + 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MSLYLCVDCGGSKTSAVVSDISGNIVGRASGGPSNIAYLTIDSFIETIRATLPCLPAGLEFVAAWFGISGADSPSIIE # SVVNPLSTLLGVPKGPRLSVANDAHLLAAPIRMHEDVISAVTVIGGTGSIVVSFKEKEDGELEELGRVGGWGWILGDEGGGYSIGREAVRQVLIEQDK # HSVMKSPPPEGPLRTLLKNYFGIKDVMEVLTEVYVPDPIPSTVVNSDRGAHKYMSREKRLSSLSPSVFAAAFEDKDPLALKVLCICAKDLAEQISIVV # GDASEEAPRLVKASESVICFGGSVVGLEVYRNMVLDELVAKGHVFKHVEFVDDCAAVGAAGLRLKFKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 Scaffold_12 AUGUSTUS gene 694667 695371 1 - . g520 Scaffold_12 AUGUSTUS transcript 694667 695371 1 - . g520.t1 Scaffold_12 AUGUSTUS stop_codon 694667 694669 . - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_12 AUGUSTUS CDS 694667 695371 1 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_12 AUGUSTUS start_codon 695369 695371 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MSSSTKSTIIDLTHPLDPDRITIYPGDHNFSCCPTSTVARDGYSVHSLSLGTHTGTHIDAPSHFILNGATIDQIPLDA # LISRPAIVVDLTYKKAGTKILWDDDLAKYESKMKEGTMLLLYTGWSAHWATPAYMKYPYLDRDAAERIISTGLKIIGSDTLSPDEIDGPEGYGVHLAI # LGAGGLIVENMTNLKALVELEAEGGTDSELSVSIIPLSLPKCDGSPVRAFGWKRRSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 Scaffold_12 AUGUSTUS gene 696043 696435 0.95 + . g521 Scaffold_12 AUGUSTUS transcript 696043 696435 0.95 + . g521.t1 Scaffold_12 AUGUSTUS start_codon 696043 696045 . + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_12 AUGUSTUS CDS 696043 696435 0.95 + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_12 AUGUSTUS stop_codon 696433 696435 . + 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MAKSHVEPSLLFFRTSPVSRSTPRFLNESRIIPPLSYPVAIHTLLELKTSHPEHIDIHFADEEGDPYAVELAGRLGAY # VVANDSDFAILNTEGYRGFIPLQAMVWHAIDEETDNEEFDEWIQAKQKKTTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 Scaffold_12 AUGUSTUS gene 696758 698314 0.97 + . g522 Scaffold_12 AUGUSTUS transcript 696758 698314 0.97 + . g522.t1 Scaffold_12 AUGUSTUS start_codon 696758 696760 . + 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_12 AUGUSTUS CDS 696758 698314 0.97 + 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_12 AUGUSTUS stop_codon 698312 698314 . + 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MDLISKTVKALLIRSLDSLGSGEVEEIVERIVNSTLQYAIPKYHAPTELENGLWPSPLCALHEPDLCSMLPLFSRNIA # ATEWTEEEHLENPISSDKFSQLVEVRSKLMKAYRSGKLSPNIINCLNSSSLWTRLFLENPDMETTATITRPIRIWYCAILDDAVGLPGKEDEEEEAGV # DGSAAVDDDDEDELVDVVEVDSDDEGRDILAPLKGALRRLHEPNSDSGDSSPDYSLTMSPVKHCSITEYYRRGTRVVDEAVEIPSLSELLSETTNSKS # ESYTPSHNHTNHTVKLPIRPLLTQPPDERLAVLLRALNESDDILRKIHSLSPEQLLTALAFRWLLRFLCEKVAENPISKERQQARWTEKELRCALAAF # TWDARNQARDALYESYPPITDRHVQLTSQILQCLDGVHQLAEVLLLSDLVSTSAHLFSGRRFHAYLTGDLSPVPVNAFSGELWDACVHKLGDAFAEER # MSRKEKKSKKSQNQNVPHVADTPKKANANNKTDGRRGGLYDMLGDVEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 Scaffold_12 AUGUSTUS gene 707820 710885 0.23 - . g523 Scaffold_12 AUGUSTUS transcript 707820 710885 0.23 - . g523.t1 Scaffold_12 AUGUSTUS stop_codon 707820 707822 . - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_12 AUGUSTUS CDS 707820 708202 0.81 - 2 transcript_id "g523.t1"; gene_id "g523"; Scaffold_12 AUGUSTUS CDS 708276 708578 0.57 - 2 transcript_id "g523.t1"; gene_id "g523"; Scaffold_12 AUGUSTUS CDS 708659 708839 0.39 - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_12 AUGUSTUS CDS 709786 709930 0.81 - 1 transcript_id "g523.t1"; gene_id "g523"; Scaffold_12 AUGUSTUS CDS 710015 710450 0.73 - 2 transcript_id "g523.t1"; gene_id "g523"; Scaffold_12 AUGUSTUS CDS 710504 710885 0.72 - 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_12 AUGUSTUS start_codon 710883 710885 . - 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFHLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMP # FGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEY # RCADDSAYPKRRSWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLILSLVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSE # FVSAFFRALDSRQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLANLVT # RNKLTGKESRTRKKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRY # YIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 Scaffold_12 AUGUSTUS gene 712759 713366 0.5 - . g524 Scaffold_12 AUGUSTUS transcript 712759 713366 0.5 - . g524.t1 Scaffold_12 AUGUSTUS stop_codon 712759 712761 . - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_12 AUGUSTUS CDS 712759 713034 0.67 - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_12 AUGUSTUS CDS 713148 713366 0.67 - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_12 AUGUSTUS start_codon 713364 713366 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQLSTAPCTLPAVRE # TTPTSAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGLVVLVVPAAGGPGGPGGPRSPIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 Scaffold_12 AUGUSTUS gene 719967 720657 0.71 + . g525 Scaffold_12 AUGUSTUS transcript 719967 720657 0.71 + . g525.t1 Scaffold_12 AUGUSTUS start_codon 719967 719969 . + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_12 AUGUSTUS CDS 719967 720168 0.71 + 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_12 AUGUSTUS CDS 720227 720657 1 + 2 transcript_id "g525.t1"; gene_id "g525"; Scaffold_12 AUGUSTUS stop_codon 720655 720657 . + 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MVSSTDLDPFVSLRGRNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHSKD # SDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSRQVVVSEDDSASNEVESEDEEE # DEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 Scaffold_12 AUGUSTUS gene 724689 725913 0.96 - . g526 Scaffold_12 AUGUSTUS transcript 724689 725913 0.96 - . g526.t1 Scaffold_12 AUGUSTUS stop_codon 724689 724691 . - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_12 AUGUSTUS CDS 724689 725789 0.96 - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_12 AUGUSTUS CDS 725908 725913 0.96 - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_12 AUGUSTUS start_codon 725911 725913 . - 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MITDEAVESTSYFDASTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWG # CPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLL # PFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPM # VVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDGTQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 Scaffold_12 AUGUSTUS gene 726150 730446 0.48 - . g527 Scaffold_12 AUGUSTUS transcript 726150 730446 0.48 - . g527.t1 Scaffold_12 AUGUSTUS stop_codon 726150 726152 . - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_12 AUGUSTUS CDS 726150 728607 1 - 1 transcript_id "g527.t1"; gene_id "g527"; Scaffold_12 AUGUSTUS CDS 728700 728940 0.5 - 2 transcript_id "g527.t1"; gene_id "g527"; Scaffold_12 AUGUSTUS CDS 729015 730446 0.95 - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_12 AUGUSTUS start_codon 730444 730446 . - 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSES # TETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIK # LNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVEKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDK # NHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIK # KDGKSLRLVHSLEPLNKVTILNSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILR # DEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVV # LEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPT # EKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDG # LSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDAHV # KSSVGICSLLLTKNLYKIIRTRST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 Scaffold_12 AUGUSTUS gene 730476 731024 0.46 - . g528 Scaffold_12 AUGUSTUS transcript 730476 731024 0.46 - . g528.t1 Scaffold_12 AUGUSTUS stop_codon 730476 730478 . - 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_12 AUGUSTUS CDS 730476 731024 0.46 - 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_12 AUGUSTUS start_codon 731022 731024 . - 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP # EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQD # SSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 Scaffold_12 AUGUSTUS gene 731108 731872 0.86 - . g529 Scaffold_12 AUGUSTUS transcript 731108 731872 0.86 - . g529.t1 Scaffold_12 AUGUSTUS stop_codon 731108 731110 . - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_12 AUGUSTUS CDS 731108 731872 0.86 - 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_12 AUGUSTUS start_codon 731870 731872 . - 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQWLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 Scaffold_12 AUGUSTUS gene 738688 739911 0.73 - . g530 Scaffold_12 AUGUSTUS transcript 738688 739911 0.73 - . g530.t1 Scaffold_12 AUGUSTUS stop_codon 738688 738690 . - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_12 AUGUSTUS CDS 738688 739234 1 - 1 transcript_id "g530.t1"; gene_id "g530"; Scaffold_12 AUGUSTUS CDS 739289 739911 0.73 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_12 AUGUSTUS start_codon 739909 739911 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MQRPSSVVASLRSLSSRRSIVSSHHPESPHHSDESDDESIYSRLSSKPSLSLLEAHAASLLAPENKEKVNTTSALNVV # KASPSANITTSDRALATVKNDSRRPSPLDLTKDQIRSSERSSGGGMIGPSPLLHTRWGSPVSSNGMSSGSAYDGRSSGGYPTPPFTDMRGSYDEKNRN # QAAGSEDRTFQEPKIDDTVQNDPDSSVSTITRPLVIEDDEELPSHAMDPQEGEADMSLVTMESAEFRYADDLRNSVHSSSTSKSKNESLGVTPIVITP # SIQTASTGSPSSGIADNFPISPVLPPSSNFSAASASTGQSVPRPSLAELRGYPNIAVQGQRQSLFLPHPNAPKAPLQSPGPLYIRKVENFTQLEPNLI # RQGPDPTRSLPMCYEWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 Scaffold_12 AUGUSTUS gene 740081 741790 0.63 - . g531 Scaffold_12 AUGUSTUS transcript 740081 741790 0.63 - . g531.t1 Scaffold_12 AUGUSTUS stop_codon 740081 740083 . - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_12 AUGUSTUS CDS 740081 741790 0.63 - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_12 AUGUSTUS start_codon 741788 741790 . - 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MTKRNSSAMSSRVKSPTGISPTPTLGSNYRNSSSSTPVSSNPATPLTPAFDRATSRDIQNLKQNSSLDAQATDRLTLS # RSPQNALLSTASETGTASLPLQPTVATSRVAVERSSTHHVHMPSVAHSEASQYSSTSASTVDIDYGLPRVMSPPSMYSEPDLHIRQPSIATVMSSESM # GKQTVRSESDVDQDVVPRRSGSIRSSNASTMRSNSPSSISQSYSPVPVSETSFSREEINDPRGSVASVASDGEVGIGLSLLASLGEGDSDDDSENERG # DERSHDLSRLLSKSIEDNHTDSGSSVGSLSVERRTLSPSPISEDAVAAFPRPPSTQVAVATTSDPINPFGTFGRTITSAGVHGGLDTIFGGRNTRDSH # SSMASSASLGTDSGVSKDTDSSESGGATAIDHFTLQAMVHEQPIELEHTRSPTLASVRSNSVYSSTGQRSPSLQASSPRNLSPPSPAFPPPNFRFPAQ # RPDNISLPAMSPSEILPPHSPTLSHTSGASASEWEGASDIYDNYLYRYSVASKSSRLSQMSMTSRSGFNHRNIPSTSTMPPTAIASMASLVNGIKSSS # S] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 Scaffold_12 AUGUSTUS gene 742580 743137 0.67 - . g532 Scaffold_12 AUGUSTUS transcript 742580 743137 0.67 - . g532.t1 Scaffold_12 AUGUSTUS stop_codon 742580 742582 . - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_12 AUGUSTUS CDS 742580 743137 0.67 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_12 AUGUSTUS start_codon 743135 743137 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MTEVGVDGVLGIEKAKAVVGSKEAKSKTGIVQPVEVVEKVQREDGPSVFRGKWKGTQGVLTVSTTATQPLVAFSKVGL # KKDVDSPAETAVWSLLINDILEVRKVGGFGWKGKMIVGWSTGDRVIDGCESQFGNLRRSLLELMVPFVGLVEIIDVNGNVYYITALPRRDELFNRLVA # IGNQRWESC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 Scaffold_12 AUGUSTUS gene 743535 744320 0.51 - . g533 Scaffold_12 AUGUSTUS transcript 743535 744320 0.51 - . g533.t1 Scaffold_12 AUGUSTUS stop_codon 743535 743537 . - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_12 AUGUSTUS CDS 743535 743781 0.52 - 1 transcript_id "g533.t1"; gene_id "g533"; Scaffold_12 AUGUSTUS CDS 743839 744320 0.51 - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_12 AUGUSTUS start_codon 744318 744320 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MVPSSRTVLFPPAPLAAIDTSTGGVKKPLAGQLGSKDSITGAQEQFRGEAAEKEADHFVTGLSTIAVSVAVGKEGQGA # GSSSPAEETNSTGEIVDAKVPNIVDIEGAVDAQRAASTADKPMKDDTGSKQAATSVQQTMWDNLGTLMSALIMIMDIWEMTGNALTSSPPFKSLPMRV # RIASPIALLIVVSLVLPEFWVYKGITLGFGLAFFGQPIFDKLAQKHVLKYLDHWIPMWRQYLDIRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 Scaffold_12 AUGUSTUS gene 747667 748089 0.99 - . g534 Scaffold_12 AUGUSTUS transcript 747667 748089 0.99 - . g534.t1 Scaffold_12 AUGUSTUS stop_codon 747667 747669 . - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_12 AUGUSTUS CDS 747667 748089 0.99 - 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_12 AUGUSTUS start_codon 748087 748089 . - 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MNDALVLQGWVPERKHDASAVLPIRFGLKQSNIQNLEEYLYDISDPDSSNFGKHWTPLEVAKTFAPSAESVKVVHEWL # IDNGIPKDRLRITPSQGWIEVDATVEEAEHLILADYYVYKHESGQEHIGAYNYTSFICKRVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 Scaffold_12 AUGUSTUS gene 748793 749062 0.74 + . g535 Scaffold_12 AUGUSTUS transcript 748793 749062 0.74 + . g535.t1 Scaffold_12 AUGUSTUS start_codon 748793 748795 . + 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_12 AUGUSTUS CDS 748793 749062 0.74 + 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_12 AUGUSTUS stop_codon 749060 749062 . + 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MSRDSISKASELYESQAQSSASPVPSSSARYSAVEMLDNVGEHEASGFLERLPPNADVNGKEELELQLSDNDETFDGL # PCFNKVSPHLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 Scaffold_12 AUGUSTUS gene 750016 750367 0.68 + . g536 Scaffold_12 AUGUSTUS transcript 750016 750367 0.68 + . g536.t1 Scaffold_12 AUGUSTUS start_codon 750016 750018 . + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_12 AUGUSTUS CDS 750016 750183 0.75 + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_12 AUGUSTUS CDS 750239 750367 0.69 + 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_12 AUGUSTUS stop_codon 750365 750367 . + 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MHSFDLDYPIDCDDEFWLLSDPEESFKQPPGKPSKIAFIISFIEVSFILSYALRTIYSINKSKVFLGYTGQGWEERLV # TQLDSKINSWEAKIPAHCKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 Scaffold_12 AUGUSTUS gene 753029 753442 0.51 - . g537 Scaffold_12 AUGUSTUS transcript 753029 753442 0.51 - . g537.t1 Scaffold_12 AUGUSTUS stop_codon 753029 753031 . - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_12 AUGUSTUS CDS 753029 753442 0.51 - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_12 AUGUSTUS start_codon 753440 753442 . - 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MWPLDLDGDAGVGQARGRALELVLKPQREGGGNNVYKEAIPEFLVSLPPRERPAWIAMELISPPLGLKNYLVRAGSEE # CVETEVVSELGIFGWSLFGEGKVINEKEAGWLVRTKGKDSNEGGVATGFSVLDSLVLVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # start gene g538 Scaffold_12 AUGUSTUS gene 755752 756709 0.41 + . g538 Scaffold_12 AUGUSTUS transcript 755752 756709 0.41 + . g538.t1 Scaffold_12 AUGUSTUS start_codon 755752 755754 . + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_12 AUGUSTUS CDS 755752 756185 0.41 + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_12 AUGUSTUS CDS 756325 756709 0.63 + 1 transcript_id "g538.t1"; gene_id "g538"; Scaffold_12 AUGUSTUS stop_codon 756707 756709 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MKAEKIVKANDLDSVITVIRGKVEDIQLPEGVKVDVIISEWMGYALLYESMLDSVLVARDRFLKLDGVMAPAHSKMML # GLCDASEIVKDRITFWNDVYGGYYLFDAFKTVFESAVIGFDMSVMAEELYHEAVIDVVGSHAMLSTPRSTYQSHCLHSIFDTFFTASGNPVAPEKEVD # VIQENDAVVAEVWPLGGRPAPQRRMSQHHKKEKSVEKSAGDATKTDVVTSFSTGPKRCDEHHLIIGVASHAFDQYPHSLETDSVLAERTFVVDEGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 Scaffold_12 AUGUSTUS gene 759725 760141 0.71 + . g539 Scaffold_12 AUGUSTUS transcript 759725 760141 0.71 + . g539.t1 Scaffold_12 AUGUSTUS start_codon 759725 759727 . + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_12 AUGUSTUS CDS 759725 760141 0.71 + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_12 AUGUSTUS stop_codon 760139 760141 . + 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MVIPKCEPSSLHHLIRLTPITSLSLLSDHAAKMHELPDEYLADALPIAKKIALAQGAENYNILQNNGALAHQVSSTSN # IVTDHICPVYICSSIQVVQHVHFHVIPKPNEEEGLIVGWPAKEVPKEELQKVYEELKGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 Scaffold_12 AUGUSTUS gene 763217 763702 1 + . g540 Scaffold_12 AUGUSTUS transcript 763217 763702 1 + . g540.t1 Scaffold_12 AUGUSTUS start_codon 763217 763219 . + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_12 AUGUSTUS CDS 763217 763702 1 + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_12 AUGUSTUS stop_codon 763700 763702 . + 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MTSKVPASTSSTSLVSNANTISSRVPLNPRQTPQKDYAAAFGDLQSRYGVAASHNPISTPVVKKKQAKDSTQALAAQS # APGTSEGAPSDGSTGRFDGPSPDGLKNKKRGISRFFPWIGLIIFMWVNDIVLMTIRQMKARRLDELNGACATTDQLLIMIGGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 Scaffold_12 AUGUSTUS gene 776244 776780 0.42 - . g541 Scaffold_12 AUGUSTUS transcript 776244 776780 0.42 - . g541.t1 Scaffold_12 AUGUSTUS stop_codon 776244 776246 . - 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_12 AUGUSTUS CDS 776244 776780 0.42 - 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_12 AUGUSTUS start_codon 776778 776780 . - 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MLISTLLRSRWRQLRARRLEAEEAADIKSRRFEEQEAENLRRESEDFLARQMDEMQALAEEQRKAGLLLDDGGLVKLN # VSLAPAPAKEGGKEKATTVFAEEEDEEEEIKKRKVPLVKLDFSVAESSEKMKERLERIKESVPHDTESLFKAKVRWDGLSDVSFIYHSFIEVFLTNLL # ST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 Scaffold_12 AUGUSTUS gene 780242 781576 0.73 - . g542 Scaffold_12 AUGUSTUS transcript 780242 781576 0.73 - . g542.t1 Scaffold_12 AUGUSTUS stop_codon 780242 780244 . - 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_12 AUGUSTUS CDS 780242 781576 0.73 - 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_12 AUGUSTUS start_codon 781574 781576 . - 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MHRSIINFLVTSQGCTDCSTNERALVSEDYGYFIDPDCSKIALDEPLTIMYGAGWLKKTYKKKSRFQITNFDIFDSHH # GTDPRASHFALFLALLFASMFDGFTQVSNAFTISGISTPLLEAKLVTFTRIGPRLEARDVHFTDHTPDRLVLLATTPEEALCWFKHEREEPFCALQYS # SSTSATLVFCLQFSDARTSWVFVRVPSTFQNKEDTDFARDIQDLHPTEIFRDQVRKPLNPSLSIYSPPLQLEVASLLNQIPDLCLDAGPSGMLRISGS # FWVEKATEESIPYELYPSGILNIEGLSGAAKSISEDMLMRRLSRVFSQRNEVTVAPPVSATEAPQEQGRKRGRSTTIDDDAGTATSGTSRSKTKQHAK # STRSDHAASSGSNTQARKTRKGAGRSLRSRRIPSKISNVATGRASASAPRSDRVEPTASSSSHTSPYNLRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 Scaffold_12 AUGUSTUS gene 784271 785359 0.94 - . g543 Scaffold_12 AUGUSTUS transcript 784271 785359 0.94 - . g543.t1 Scaffold_12 AUGUSTUS stop_codon 784271 784273 . - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_12 AUGUSTUS CDS 784271 785359 0.94 - 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_12 AUGUSTUS start_codon 785357 785359 . - 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MKEKIKSLCYDYLLRSKLDGWLGKDENDYIAYGFARVKNAGVRTLIRIDEPLVMMACAMWLNGSSESDAHSLYKYVAN # RIQDHNPSTGRNGFEEFICFYLQQVFQKPRRLGQVFDLPDKENPKKDSVLAQKRATLVTLHIDEIGSKRKLMEGTTDIQNIGEAKLPGALGLGIQSMD # ECIPLINWVKLKAHTAFCFPMNEMGPDIMCFLRLEDDKGKPEDFTYICLAIQCKFHQVDGELEPSTLRDAIATVTPRKFFAPRHVSQISLRVTANSTF # LHRDRSKMKTKQWGVKKNERKHVRVSYPPSKDYLARIPLAGKYGVMRIICGFPVRVNLDTVFYQHKEQVKTPKYVLDPDEEDEHPFRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 Scaffold_12 AUGUSTUS gene 788698 789347 0.66 - . g544 Scaffold_12 AUGUSTUS transcript 788698 789347 0.66 - . g544.t1 Scaffold_12 AUGUSTUS stop_codon 788698 788700 . - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_12 AUGUSTUS CDS 788698 789149 0.73 - 2 transcript_id "g544.t1"; gene_id "g544"; Scaffold_12 AUGUSTUS CDS 789329 789347 0.68 - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_12 AUGUSTUS start_codon 789345 789347 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MSISTLAVGPVPKSAKRWARTAHLHEVKSPAPLIATANNKVAKDDSKNLEKKSSEVVSNARSMTTLLTTQDKAKSLDD # SDLFLEAPGRSTRRSNRYSFATSDIDKPMIPAGKRWTSSSDSSCDGDGGDLWVDTDATDTSVDGDSGGFSGFSFEEGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 Scaffold_12 AUGUSTUS gene 790066 791563 0.55 - . g545 Scaffold_12 AUGUSTUS transcript 790066 791563 0.55 - . g545.t1 Scaffold_12 AUGUSTUS stop_codon 790066 790068 . - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_12 AUGUSTUS CDS 790066 790684 0.68 - 1 transcript_id "g545.t1"; gene_id "g545"; Scaffold_12 AUGUSTUS CDS 790812 791563 0.56 - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_12 AUGUSTUS start_codon 791561 791563 . - 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MALFAVLPAAFLALVFASPVLSAPSSSNDPFRALSAHATRQPEPPVCCLTPLPPIEPVEDEVLLSFEEWKEKQAALQA # SAKVNGKGEPPNHTNAVAGNSAHVNAGREIRSSAAENAVPVTPSEMLDALDSDNASEKLSPHFQVPLTDRFNYAGTDCSARVHLAHRSAKSPASILSS # KRDRYMLSPCNSPKEKQFVVVELCEDIRIDTVQLANFEFFSGVFKDFTVSVSKTYKEDWIVAGTYRAKNIRGVQVNEYYCPISLLRVYGLTHLEEWKW # EIWEAESRAKREGLLEPSAPRQVIADESLSMNLPSSIASEASVKPPVDNGAASVPPSNNSSSTTTDDEGALSFAAQKYSTSHRTLPAFAWEQFATANT # KETEVPQDSHELHTITNDHIAISTSTTLFSPSPLITLPIELSNTTVISSTQMASPVASSSSIVSVMHQVHNPPPAMGANLSIVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 Scaffold_12 AUGUSTUS gene 795800 796603 0.9 + . g546 Scaffold_12 AUGUSTUS transcript 795800 796603 0.9 + . g546.t1 Scaffold_12 AUGUSTUS start_codon 795800 795802 . + 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_12 AUGUSTUS CDS 795800 796603 0.9 + 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_12 AUGUSTUS stop_codon 796601 796603 . + 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MSTHSAYTIDGQFDVYAQEGAYTKTDLDQSLSFMNSMEDVVAPTTDEFDSDLDALFEGINFDALTVQITNPRAFQFHG # SDSFSLRGPASAFTFSSSESTYVSHSTHSESSYGYSSRDAASDYSLSFDLDSEYQRFSVDTQAQSQGLTLGRLDCIDPTAFNTMPASPYNPSDLALIA # TKSYDSKSSFSDYGPSTANFLNQLASYGTIAGATVSVDQIDSHLSGVYSIALAPSSTDDSRKDNSSKKKYKCTVCTRGKTCYFTSRSKIFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 Scaffold_12 AUGUSTUS gene 802819 804287 0.37 - . g547 Scaffold_12 AUGUSTUS transcript 802819 804287 0.37 - . g547.t1 Scaffold_12 AUGUSTUS stop_codon 802819 802821 . - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_12 AUGUSTUS CDS 802819 803543 0.47 - 2 transcript_id "g547.t1"; gene_id "g547"; Scaffold_12 AUGUSTUS CDS 803615 804287 0.37 - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_12 AUGUSTUS start_codon 804285 804287 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MQGGFVPGLPTNNHRAATQQTSQGILPPPTFMQQRGQNNFGFGGPLGQHQSVQQSQLNGTSNSLPPHLSQTPSLGNSA # PSVSSTSELGLDPNDFPALGSTSTNNNNGNGNNNGSVASSVTTSYASQAGTGMGGSTPAISGTGGTASNQTRDFTPDDFPALGGQSQSQNNQDSSLPH # PPGLNGFDQQHRQNLLGTLQGTPGMLNLGPQGRNAHTFDADKQQQQRVSHAAWNSPNTPNAQAQPTGGLGAFAATQQQNGTHPSQQNLSSTHLNAPPN # LPPPLLPAGNNPNGPGAATTPYGSNGLGGLDSQQLNATTVNPNPPNPIPNPNATPNPHPNSTQNSLPNSTAHVHQHPQTPAQQILMSAADRWGLLGLL # AMIKNAGSDSDQALSSVGTDLGTMGLDMGYAGSVSPLLRNSIWITEISFVVPGVYTRPSLHHGQISLQHIQLSLIFISQRVTAYNHHHRALEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 Scaffold_12 AUGUSTUS gene 806924 807223 0.46 + . g548 Scaffold_12 AUGUSTUS transcript 806924 807223 0.46 + . g548.t1 Scaffold_12 AUGUSTUS start_codon 806924 806926 . + 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_12 AUGUSTUS CDS 806924 807223 0.46 + 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_12 AUGUSTUS stop_codon 807221 807223 . + 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MNGSFRTPSLSSAPTSSFTSVPSLASSAKRNFSSINLSCPDVTPAAPSSPSSETTALELKELPPRRRLDCGKGVDLGT # EDAAWLERKDVPMDYEEPGLE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 Scaffold_12 AUGUSTUS gene 811563 812351 0.53 + . g549 Scaffold_12 AUGUSTUS transcript 811563 812351 0.53 + . g549.t1 Scaffold_12 AUGUSTUS start_codon 811563 811565 . + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_12 AUGUSTUS CDS 811563 812351 0.53 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_12 AUGUSTUS stop_codon 812349 812351 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MAENQTGKRMRIIRVDGGGEFDNSLMEAYCADRGITIEKITPYSSSANGMAERGNRTVIEGVRTFLEESGLPRSFWAE # AAATFTYVDNFVPTAWFPDRVPIEYWSNKRQDVSHLRPFGCRAWATLPESRNDGKLARQAVECQLIGYMGRRGYRLWHQPSRTFMESRDVRFEEGEAH # RSRACMPAPDDGELENDQPAGNLEPGVPTDGPTSQQHADQEGEEPQIPGSSDSLPPPATSDFSQPPQPRRSTRIRTPRVWPSKIAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 Scaffold_12 AUGUSTUS gene 816909 817999 0.55 + . g550 Scaffold_12 AUGUSTUS transcript 816909 817999 0.55 + . g550.t1 Scaffold_12 AUGUSTUS start_codon 816909 816911 . + 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_12 AUGUSTUS CDS 816909 817562 0.57 + 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_12 AUGUSTUS CDS 817640 817999 0.96 + 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_12 AUGUSTUS stop_codon 817997 817999 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MYLVRPNEPEINALHSINPNDTDEFWTWDSYYAAMKKSETFGAPSADVAAEAGIQYSASSYGSNGPIHWSYPGETFNL # VGNWTPSLLTLGIPTNPDAASGDNSGAYITTSSINPSNWTRSYSRSGYIDPLPPRSNLDILTSATVTNIVWQSGTSGNLTATGVQWASSSTAAKQTVN # ANKEVILAAGSIGSTQLLQLSGVGPSKYLQAAGVDVQLDLPGSGSLIYSTNAETAGDMYNAGVATAEFLSYINSATAYVNLTTLLGSDNASALISSAQ # AEVDSSVSSFLPLGDSTVAAGYKAIYDTITNQFYSSNSGQIELLLSITSTNVLLQAAIQHPLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 Scaffold_12 AUGUSTUS gene 824072 824566 0.93 - . g551 Scaffold_12 AUGUSTUS transcript 824072 824566 0.93 - . g551.t1 Scaffold_12 AUGUSTUS stop_codon 824072 824074 . - 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_12 AUGUSTUS CDS 824072 824566 0.93 - 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_12 AUGUSTUS start_codon 824564 824566 . - 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MTRIFLVVATVISAAYALWPLPTDFSTGTAALTLASDFDIDISAIPNPPQDLLDAISRTKGYLQTDQLEALVVDRGAS # YNQSLQNASSLVSLVLSYDSGVAGEPTSISEEAIDDIDSRVEGYTLTVPEDGSAATIKANSTLGLFRGLTTFGQLWYDLNNTHLHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 Scaffold_12 AUGUSTUS gene 825075 825608 0.3 - . g552 Scaffold_12 AUGUSTUS transcript 825075 825608 0.3 - . g552.t1 Scaffold_12 AUGUSTUS stop_codon 825075 825077 . - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_12 AUGUSTUS CDS 825075 825608 0.3 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_12 AUGUSTUS start_codon 825606 825608 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MVRGIPPFPLLSVDILSDDDFADFQAAPVTPHTTVAPFQAAPAAAHKMNLMEMLNSTSATPARPQSMSYAQPQAPPMQ # TQGLVYGSGMGMGSSGMGMAGMATGGMHRPSPSLSNQSSFGGVPTMRPMSTTSASSSGSTMNRAASVASSKPASSANFDDLWSMSLVQSLRRQRQVPQ # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 Scaffold_12 AUGUSTUS gene 845938 846834 1 + . g553 Scaffold_12 AUGUSTUS transcript 845938 846834 1 + . g553.t1 Scaffold_12 AUGUSTUS start_codon 845938 845940 . + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_12 AUGUSTUS CDS 845938 846834 1 + 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_12 AUGUSTUS stop_codon 846832 846834 . + 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MEDEGAETTAASHLKDPEVLHYPGPLFPPGSTSVARSLSPHMPLSESVPVATREEVCPNACSSYAPSISSSEIHICSP # SSVCSRPIAGSPQPKWSETISYPSSPSSLPTPSPVQSEKQPPASSGNAFSDLAMHASVSSFSSPAVSRASHSHQSGPHMGKPLSSPATTLSDASMTTS # SSAASLSDASTKRFLSSSGDASDAVSRRPEKKPRLQDPRNRRRAEKRARERSKLGTPLGQRLAHERHVLPAQEMPSNLQSTRLPVAAGGFIGVDADWY # SAKARRELEKMKEQGFKLVEWQTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 Scaffold_12 AUGUSTUS gene 847823 848458 0.53 - . g554 Scaffold_12 AUGUSTUS transcript 847823 848458 0.53 - . g554.t1 Scaffold_12 AUGUSTUS stop_codon 847823 847825 . - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_12 AUGUSTUS CDS 847823 848458 0.53 - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_12 AUGUSTUS start_codon 848456 848458 . - 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MPRSVLEKQVIALDRFIRAVKFSGEPQTVQTNLGCLKVTQSELRNSRAYILKIEDKIAEGRKYRTQSIIRNQRHSYMI # DDLRLQVSDSYAEAEIWCRQERLQLLKRIEELELRLGKDESMKQAKRIEELEIQVAREKLVRGKAAHILLNNHDPFAAKDEALTLLKPALVTKLPPSL # KYDLRPITESFHQARERLFRKQIAHELLLQEDTSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 Scaffold_12 AUGUSTUS gene 848529 849089 0.74 - . g555 Scaffold_12 AUGUSTUS transcript 848529 849089 0.74 - . g555.t1 Scaffold_12 AUGUSTUS stop_codon 848529 848531 . - 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_12 AUGUSTUS CDS 848529 849089 0.74 - 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_12 AUGUSTUS start_codon 849087 849089 . - 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MGEASEGRGSKSAVDPKLKLMKEGVKFELKKKIVPVETCATLPQIRPTDSILSFPFQLEPKAFKRSCQGPKISSSLQM # NVLPNELLDNMEVDSNLMPTTTPGTLDEVLTQAGLCDNFHLVENSSFTYLKFYSPSEIDSTAIASKEYLASLCVACGIDFTSLEQGQKLESSLVETSG # HHAKNSVGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 Scaffold_12 AUGUSTUS gene 854481 854873 0.95 + . g556 Scaffold_12 AUGUSTUS transcript 854481 854873 0.95 + . g556.t1 Scaffold_12 AUGUSTUS start_codon 854481 854483 . + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_12 AUGUSTUS CDS 854481 854873 0.95 + 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_12 AUGUSTUS stop_codon 854871 854873 . + 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MDSDRKSTVSSFYGGRRGSQDALNNDFPSSSGPSYPNYAQGRGRDDASSFFDPDRTSRNLDGAGRASTAGYNRGSFFL # AGREEPVKGGRDEEGGAGGNGGAWDIYADFNNEGPRYSSAFGSSSTAADAYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 Scaffold_12 AUGUSTUS gene 856485 858398 0.99 - . g557 Scaffold_12 AUGUSTUS transcript 856485 858398 0.99 - . g557.t1 Scaffold_12 AUGUSTUS stop_codon 856485 856487 . - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_12 AUGUSTUS CDS 856485 858398 0.99 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_12 AUGUSTUS start_codon 858396 858398 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MSSPPVSVCPSTATLGLYNVPSPVQVVQNYGSPRNPEVVRSYVNSDSDSDESLEVIDVRRDTTQGGGAYHEDEDVVRD # RGRHSLDDHDPPIPITSTQSKRRHMSLSPLRLFAHKPIALQERALSAQPASPYSFHRNVALFRSTTSLKTVSNGSFFRLPLSSSSSTSLVKVDRRVIS # KGKERSAEPLETWEVLDPPASLMSAVESLTNPPSPDSGSPSPVQTRIFTFDCHASSSNVACAESNGQGVYCKGPNLDSADRLPSIPTNFRDDSASIPR # RPCSQNVLSHQYISSYIPSNLHDRSNTLASPLPGPGILQNPGTSPPSPSSASKNMTSSLPLSLQSRGAKRLDLNSDTANPLQLALETPLPPTPIDNIM # GEESTNTRLQTVGHHIHAHFQFAPNPNEVLSSYNDTIAGDTTKVLPRSRVHVAPNDRTSGSLKVMYGMPQAAGYNNSVSKTQRPIPSPLQVPFPSVIS # PDPTSTSHIYTQTPTRRHYPGRPLPKTPQPVVSEIARNMVDSLYAPNPENTSNTDTCLGPTFPHGLLIDFDESTPVHSTLSSEMNSPTSTVRLSTYDR # STDGESHRLADKLARTNNKSSETLRALNPKNTGAYSALDISPLGQGEQKNLGESSYDASQFFFFHSPLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 Scaffold_12 AUGUSTUS gene 861877 862702 0.61 - . g558 Scaffold_12 AUGUSTUS transcript 861877 862702 0.61 - . g558.t1 Scaffold_12 AUGUSTUS stop_codon 861877 861879 . - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_12 AUGUSTUS CDS 861877 862390 0.72 - 1 transcript_id "g558.t1"; gene_id "g558"; Scaffold_12 AUGUSTUS CDS 862458 862702 0.62 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_12 AUGUSTUS start_codon 862700 862702 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MPGVNIWHPLWLPKLVVDDFEHRERQRLRESWVSDNGEYSEADSQYKPLWARDEEWGNDCLVTVQSSKWGEFLGVMDG # CDRKLGDSRSSGIRIRRRSSRHTGYKPGVVYGGGDSAKDGEQDGWSLKDIGWFLKAWRKDEKVQQEAIARLPQSSGTRQKEREREREKEREKDDAVVK # ASTDKLSAVFDWVTERVPSPPLLGTKNISAISESEPKSIYNTISTRDNRKKNELESKEDLERFYVALSRKLYDEGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 Scaffold_12 AUGUSTUS gene 864426 865295 0.99 + . g559 Scaffold_12 AUGUSTUS transcript 864426 865295 0.99 + . g559.t1 Scaffold_12 AUGUSTUS start_codon 864426 864428 . + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_12 AUGUSTUS CDS 864426 865295 0.99 + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_12 AUGUSTUS stop_codon 865293 865295 . + 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MPTTPITPLLRGSSPSYHDLYSKPLIDCNNQSYFPNTSDECELKEFFFGLYSFKPSPDEPLSPLSSEDSESLSSGSTI # GSDEQDIENVFALDKDSYDFKSQLPPCAVISIQEMLDTPDIYDSQFRDNYKHLNPQAAPFVPSVQSAGPRTRLPSIIRARVLAASASDSIPLLPPPPP # NPLKAIPAWMIILHLASTTTPADSFILAARAKELAHSHFWHPEALAELAQHFCWNASDVNADIDRETMAAFAREVSQALRDAFDKDTADSFVWHLRES # LIGTFKGCWCATVSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 Scaffold_12 AUGUSTUS gene 867277 868332 0.77 + . g560 Scaffold_12 AUGUSTUS transcript 867277 868332 0.77 + . g560.t1 Scaffold_12 AUGUSTUS start_codon 867277 867279 . + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_12 AUGUSTUS CDS 867277 868332 0.77 + 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_12 AUGUSTUS stop_codon 868330 868332 . + 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MNSFLAYKSKRAYVFQDYVWKPEYYSWPQSESFEWPPHTPLNAIIAGPTAGGLWDPGDDAPRSVSEKWFDVVCPREER # RILNTREVKPDIAWLMGDEIFEAWRKVLTEAPERCIEIVPADDDNFPQTFDLWLWGSFRVLPLWKPFSESPISRLLATSPIVNSAVDRNEYLFLPHGP # RPAHPVSHNPYDRMLAMHVRRGDFKDACIGLATWNSTYYSWNLLDFLPDHFEPPAGGSWGWNTPENTEKYMEHCLPTFDGIVKKVKDSKEDYIRAGGS # KGDQRTLDVLYLLTNEESEWLDQLKDTLRKDGWHTIKTSRDLTLDQEQTDVNMAVDMDIARRAAVFIGNGVSGLVIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 Scaffold_12 AUGUSTUS gene 874454 874948 0.57 - . g561 Scaffold_12 AUGUSTUS transcript 874454 874948 0.57 - . g561.t1 Scaffold_12 AUGUSTUS stop_codon 874454 874456 . - 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_12 AUGUSTUS CDS 874454 874948 0.57 - 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_12 AUGUSTUS start_codon 874946 874948 . - 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MDWAALHARDRGAETWWKSFTTGKSAETLGGVPHDTYGMTSLSIRQYVLGIYKQLGLKEKDITKVQTGGPDGDLGSSM # SFLRPRFINQLFILLVPDEILLSSDKTIAIIDGSGVLADPAGLDRDELVRLAKLRVPVGHFDKSKLSKDGYLVKVEEQDVKLPCVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 Scaffold_12 AUGUSTUS gene 881435 882840 0.3 - . g562 Scaffold_12 AUGUSTUS transcript 881435 882840 0.3 - . g562.t1 Scaffold_12 AUGUSTUS stop_codon 881435 881437 . - 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_12 AUGUSTUS CDS 881435 882526 0.63 - 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_12 AUGUSTUS CDS 882586 882840 0.3 - 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_12 AUGUSTUS start_codon 882838 882840 . - 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MEAKLATLKSPGLKSGLPASPTARNFSGSAGPGNRQSLALDNSSNFLSPDSAALPSDPAATLAQQRAKFKASNAAHRI # SAPVLASVAEQNGGSQDLVINSSRPKSTEFSGTIGSPRVPVSASNNEVTVSNETGSWASMVNTPLIPMFQKDSRMNPSLDAAATKLNEWSANKNATPG # VPRMGDPTIHRRNKNNNDDDNGQYNHGNNRMRNANFGAGAPGAGWSGVGVRSPALPNSASNRLDENGLANAMAGLNGLGMQMGGGGFGMGSPGLGMGM # PNLAGMSGMSPIAPFNMQMLAAMGISPEAQLLAAQMAANGFGQQGWMGMHNGPASAGASSRRGPHSARSVKSPSSTAGGATPKGEEDVDPHVLNDVPA # WLRSLRLHKYTPNFEGMKWQDMVVLDEAQLEGKGVAALGARRKMLKTFELVRKKMGIEGGPPSSQPPSAVLSLQSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 Scaffold_12 AUGUSTUS gene 884181 884537 0.99 + . g563 Scaffold_12 AUGUSTUS transcript 884181 884537 0.99 + . g563.t1 Scaffold_12 AUGUSTUS start_codon 884181 884183 . + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_12 AUGUSTUS CDS 884181 884537 0.99 + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_12 AUGUSTUS stop_codon 884535 884537 . + 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MSVELPFQISIPDSKLDLLRQKLALTEFPDELENTGWNYGAPLSDIKRLVARWKDGYDWKLEEAKLNQDLPQFTKDID # VNGFETLNIHYVHQKSSLANAIPLLFVHGCESSLKSKSCS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 Scaffold_12 AUGUSTUS gene 890306 892547 0.34 - . g564 Scaffold_12 AUGUSTUS transcript 890306 892547 0.34 - . g564.t1 Scaffold_12 AUGUSTUS stop_codon 890306 890308 . - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_12 AUGUSTUS CDS 890306 892367 0.65 - 1 transcript_id "g564.t1"; gene_id "g564"; Scaffold_12 AUGUSTUS CDS 892417 892547 0.34 - 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_12 AUGUSTUS start_codon 892545 892547 . - 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MAQTYFPSRVTSPTKELANFSVLSGDRQLRVEDVQEAYIEQKDRLVNAIDATKSILRDVRAFNKDEWIIRYPQYKEAI # ETVSPPPTASRRKSLRRSLTFADDPATETEVVVRKKLQRSVTVSPISENTEEEETDEDATSDFNVLRLDLQLGPNSTVTSLVSQLEKSSIANLLDERI # AASLSHVDKLRLRVEDTSSKVLVTGDLNAGKSTFVNALLRREVMPVDQQPCTTAFCEVHDAAENQGVEEVHIISQGVTYDVNNESTFTRASLSELEDI # VGENEDHERILKLYLADTRTPSESLLNNGVVDISLIDAPGLNRDSLKTTALFARQEEIDVVVFVVSAENHFTLSAREFLTNASKEKAYLFIVVNKFEQ # IKNKEKCRRLVLEQIRQLSPRTHENADDLVHFVDSAAALQPYTANPTFDDLESSLRSFVLVKRSKSKLHPVSTYLNNLLGDIELLAGANSIVANAELD # QARESLAQVKPVLERMKNGRESLEEGLETLEEEGASSASSSSKATLTQALERVGQGKLGVDKPLIPLPSYPGILGVWDYARDVRKALLASLDAAVALA # EDEVRNITSAGVDRIKELGEEHLPVGVERNRRVFMPEAMFSTIRKASKGPTKSRKSLTVVAGGVHGLGIGLAQRSEMLETTFFDLFDVQHQFWLHFSD # GESDNANKEDETTAPTVLGLASVGVGALTMVGGQAVGAKGSLRASFVSQIFSAMKQSESGQRLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 Scaffold_12 AUGUSTUS gene 901473 901896 0.27 + . g565 Scaffold_12 AUGUSTUS transcript 901473 901896 0.27 + . g565.t1 Scaffold_12 AUGUSTUS start_codon 901473 901475 . + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_12 AUGUSTUS CDS 901473 901613 0.27 + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_12 AUGUSTUS CDS 901705 901896 0.97 + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_12 AUGUSTUS stop_codon 901894 901896 . + 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MLWNTVATECQGDGDLLKNLRIKNVETGEEKDLAVNGLFYAIGKSSATDPDGYIVTVPGTTQTSVKGVFAAGDVQDKR # YRQAITSAGSGCMAALEAEKLIAEEEEELNGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 Scaffold_12 AUGUSTUS gene 905258 905716 0.6 - . g566 Scaffold_12 AUGUSTUS transcript 905258 905716 0.6 - . g566.t1 Scaffold_12 AUGUSTUS stop_codon 905258 905260 . - 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_12 AUGUSTUS CDS 905258 905716 0.6 - 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_12 AUGUSTUS start_codon 905714 905716 . - 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MQEIPPDIQGFLKDEERSQEEIQEEISTASAGEQRMDTSIARNEYFDGDKDVDHDSSPPTPPPTRVSRGSARRGRGRG # GRGRARGRGRVSSASVVDEDDDNDDDSPPPPRKSSRGRGRGRGAKTRVAVPELKRTPDPPTEAESDTPGASHDI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 Scaffold_12 AUGUSTUS gene 912291 914217 0.24 + . g567 Scaffold_12 AUGUSTUS transcript 912291 914217 0.24 + . g567.t1 Scaffold_12 AUGUSTUS start_codon 912291 912293 . + 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_12 AUGUSTUS CDS 912291 912317 0.59 + 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_12 AUGUSTUS CDS 912618 912927 0.61 + 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_12 AUGUSTUS CDS 913592 914217 0.35 + 2 transcript_id "g567.t1"; gene_id "g567"; Scaffold_12 AUGUSTUS stop_codon 914215 914217 . + 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MANPTTSSVRVDIPVPMYEFSSEDLWKEWYWSERYPSQKELRSYFEHVEKKLDVKKDVCFDTRVTSAHFNASKDRWII # ITENGVTAQAKFLCLCLGFGSKPYIPDLPNLSSFLEITPKGVKTADGIEHELDALILATGYDSVTGGTKYIRGIDGTSIKEKWQDGVYTYLGLTSAGF # PNLFFVYGPQGPTAVCSGPTCAVSVRDGIKLRTNVRIQETEGDWIVSCIKTMLEHNVTRIEATHEAEVAWRQQVMSEASTRLISTARSWYVGANVKNK # KVEILMYTGGAAKYTQICQEVADGGYEGFTLSSTEGNVDLIRDKLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 Scaffold_12 AUGUSTUS gene 922275 923840 0.13 - . g568 Scaffold_12 AUGUSTUS transcript 922275 923840 0.13 - . g568.t1 Scaffold_12 AUGUSTUS stop_codon 922275 922277 . - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_12 AUGUSTUS CDS 922275 922783 0.42 - 2 transcript_id "g568.t1"; gene_id "g568"; Scaffold_12 AUGUSTUS CDS 923654 923840 0.55 - 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_12 AUGUSTUS start_codon 923838 923840 . - 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MDVPHPSEEGKTLWDAKEDEGPFKPFGPVGPDGEFGLVVLNNGDSDVQGVNTTISSHRILEIDEQDDEALAGWLEHRL # ATSHNYELPELPDIPDIPKPPTPPDIPGIPDIPGIPDIPDIPDIPDIPDIPDIPDIPDIPDIPSIPSLSLPSLPLPTSTLILRSLPKLPLPPPILEFI # RAAKRVSRANRKLFLFERGFIDEGGIKDREWYRHLGWRLESGWVRCSIFFFGLMH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 Scaffold_12 AUGUSTUS gene 924979 926553 0.38 - . g569 Scaffold_12 AUGUSTUS transcript 924979 926553 0.38 - . g569.t1 Scaffold_12 AUGUSTUS stop_codon 924979 924981 . - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_12 AUGUSTUS CDS 924979 925423 0.97 - 1 transcript_id "g569.t1"; gene_id "g569"; Scaffold_12 AUGUSTUS CDS 926162 926553 0.41 - 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_12 AUGUSTUS start_codon 926551 926553 . - 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MEHMKDRFEATKDRIEWLLDLEHRPFTMNTHYFLDYKDKFFSYYKSYRDQDLNQELNSALQALESERQRNQFEWSSNA # AVVNEILAGLIKLGITGVKAVDLVKFLPTDGMEGALDIMAGVRAYFQGLFFALSVPNTENATAIAKQYSKHPHLAGSLEDYHDALSILEFIQTELSII # KPHSLEQPIYNAGTPKSRAKTIGLTSRLGPRNPTAWIDVYYPYLNTPLDRSLDILDGTGSSIWSADLREDGNAGDEDAAKYRDYIPPWHGLSAHGEGQ # GQVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 Scaffold_12 AUGUSTUS gene 926863 927231 0.99 - . g570 Scaffold_12 AUGUSTUS transcript 926863 927231 0.99 - . g570.t1 Scaffold_12 AUGUSTUS stop_codon 926863 926865 . - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_12 AUGUSTUS CDS 926863 927231 0.99 - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_12 AUGUSTUS start_codon 927229 927231 . - 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MHNTRKDLAQLPKEPSQDPMSDISAMIYSFSSRLSRVLEGTPEAEALLQCIRPAQNAFKREIRKTAPNFRPYEKKYAS # QRNMAHFKFLNNEEDELEWDQDSEDNTESGAPVYIDDVNRRIQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 Scaffold_12 AUGUSTUS gene 935248 935763 0.25 + . g571 Scaffold_12 AUGUSTUS transcript 935248 935763 0.25 + . g571.t1 Scaffold_12 AUGUSTUS start_codon 935248 935250 . + 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_12 AUGUSTUS CDS 935248 935268 0.25 + 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_12 AUGUSTUS CDS 935380 935763 0.35 + 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_12 AUGUSTUS stop_codon 935761 935763 . + 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MELTDQTDLNANVAAGHAVNNPSVAVSFPSDNSQASQLARIDAALVTLQNLNGAGVGCPASSTTFVAQQAAIQAGTSD # VAAASTSAVAAAAPTSAAAAASSTAPATGGVDASLVPEFGVTAGQSPDGGISSLYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 Scaffold_12 AUGUSTUS gene 951648 953330 0.52 + . g572 Scaffold_12 AUGUSTUS transcript 951648 953330 0.52 + . g572.t1 Scaffold_12 AUGUSTUS start_codon 951648 951650 . + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_12 AUGUSTUS CDS 951648 951660 0.52 + 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_12 AUGUSTUS CDS 951733 953330 1 + 2 transcript_id "g572.t1"; gene_id "g572"; Scaffold_12 AUGUSTUS stop_codon 953328 953330 . + 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MPSIRQSKLADFLNQRLRLLLISRLHYRLSLARVNGGWDNIQGLGLKTSNSVNLPIWSCSLDDTDGGRWAGLTAEDEE # DEDESPGEEDEDEDESQGEDEDEELEQDESMDSDEADKDADMDGDDEKSDSPAVMQTGKSKGKKRAADVDEDNQIVASPKRKSRKRALMDLRSAKDGT # VDVLTTSKKSKPIVSTPAKTVAKESATSISPAKDVVSASKPRAKKGTALQAPTPTAANTPATTKKATAAVDKKSTKKKSAETTDAADAASVTTTIPNT # SALKDAPKKDKKKEGKTSPTASGGLTKPAPTPIVAPIATTSAESMSTPANKSKKPLASKTAPVEALVDVSVSIHGEPPSTQKKGNNVKAKKVESVATV # VEEKETSSSKKAKKEKRTTPAVEVSEKIPTVEVEVKDENPKKKRKEKKAKLSSDGAPETEVMDVVVAVTENAKEGKEEQQKEKKKKGKKLIDPAAGPA # DDAMVMDTAPATDVVEKKSKKDKKSLVSDEKEVPASLSKEELKKKKAMRLGRKRKTRFRRLREARA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 Scaffold_12 AUGUSTUS gene 963271 964059 0.7 + . g573 Scaffold_12 AUGUSTUS transcript 963271 964059 0.7 + . g573.t1 Scaffold_12 AUGUSTUS start_codon 963271 963273 . + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_12 AUGUSTUS CDS 963271 964059 0.7 + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_12 AUGUSTUS stop_codon 964057 964059 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MNVYSCRITGLESESRTLARRISAISMSSAEPADDYSNSTFHYTSTPAPPPPTTTANKKPNQHQQSSSTSSRPGSRSR # THSQPSNVNNANRALSSSRPTSPPNQSVKTNQSRIPLPQRTRSRTGSLSSQSHSQHRTKTPTPGDVAPVTAAAAADLWVVHERPSHSRLVNEPAPFPP # PNSSVSSIDILPEPRPSNDSEERPFEHWYRGEVSRNGGVGEYRVAKRQEMLEIANYGHNIRPKKQNAITDAIDSESSEEVDHGLEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 Scaffold_12 AUGUSTUS gene 964116 965218 0.89 + . g574 Scaffold_12 AUGUSTUS transcript 964116 965218 0.89 + . g574.t1 Scaffold_12 AUGUSTUS start_codon 964116 964118 . + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_12 AUGUSTUS CDS 964116 964673 0.89 + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_12 AUGUSTUS CDS 964724 965218 1 + 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_12 AUGUSTUS stop_codon 965216 965218 . + 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MDENPLTDNGEEDDDGEEEYYDPMEEYYRPEELPPRTTTPRPSRIPTPTQLQRGQSEPPYFPTSSAGASTSALSSSSA # TPTQRLYATAGASNGTPQSKRAGTTSPPSASNKGKIKSYNSTTPSPSSNSRLAASKATQAKLAQNKRQREKEEEYRRSIAAYPDTGDDLMNAIPTWTQ # PVPKAGNWDDVVLPVVARKKGLDGHYERADGSPQQRKDEVTIAPAPGTFGFDHSKYRPPREGEENIPMDEFGTKNSAYTERDDEEQEDEDSQPSHSQS # RMETAHDQIRLPTNTIPSKRASSPVPFSSYKPRPSQPEPVGQMNGDVEKGNMKVQRVDADESEDAGKGGCCGCVVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 Scaffold_12 AUGUSTUS gene 965975 966373 0.89 - . g575 Scaffold_12 AUGUSTUS transcript 965975 966373 0.89 - . g575.t1 Scaffold_12 AUGUSTUS stop_codon 965975 965977 . - 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_12 AUGUSTUS CDS 965975 966373 0.89 - 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_12 AUGUSTUS start_codon 966371 966373 . - 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MKGKVTFGPLNNRGLSDNENTWAQLAVRALIGEAKNEYDSKHDYHIDFDFPNQAKFSGEVGIYEFNVALEGWHWLKPG # AKSSLAGRVHWGSGTKKLPGGVIRGKISGFLNYIGPDQTNYFEANDRPVEMTLQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 Scaffold_12 AUGUSTUS gene 972236 973566 0.45 - . g576 Scaffold_12 AUGUSTUS transcript 972236 973566 0.45 - . g576.t1 Scaffold_12 AUGUSTUS stop_codon 972236 972238 . - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_12 AUGUSTUS CDS 972236 972727 0.64 - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_12 AUGUSTUS CDS 972866 973000 0.53 - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_12 AUGUSTUS CDS 973059 973275 0.94 - 1 transcript_id "g576.t1"; gene_id "g576"; Scaffold_12 AUGUSTUS CDS 973382 973566 0.87 - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_12 AUGUSTUS start_codon 973564 973566 . - 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MAQGNDDVWDADYEDEYDHPGPFSAKHNDLKNGAGGSGSVRRASDAQKGSIGSIEIGGRKGVLSEKFDKYMEHPGQEV # DAEDFDYEDNNDSPSSTVGSGEGGLKPGLLKLNSRLSNRSWLGDEDDNSDEDVFAEFDEPFAEDDLETHLQRDKQARLSARVSALVDDLSLNANPIGS # LSNLTILVTSPEMQIQLVNSHGMLAILEVLEGYQSRVLDPQSGISASAQSSNSSPTPSPLTSVVPLPRSAVGTGRKASTMGGVVSSLGLGSLASLGSL # GIGGRSSSGVSATSSASSTTSRDSLGILGSLPMHNTVTGIGGGLSAGGRETVLQLLRIINLVSTMRLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 Scaffold_12 AUGUSTUS gene 973877 977444 0.06 - . g577 Scaffold_12 AUGUSTUS transcript 973877 977444 0.06 - . g577.t1 Scaffold_12 AUGUSTUS stop_codon 973877 973879 . - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_12 AUGUSTUS CDS 973877 975917 0.53 - 1 transcript_id "g577.t1"; gene_id "g577"; Scaffold_12 AUGUSTUS CDS 976013 976257 0.27 - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_12 AUGUSTUS CDS 977051 977171 0.22 - 1 transcript_id "g577.t1"; gene_id "g577"; Scaffold_12 AUGUSTUS CDS 977221 977444 0.17 - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_12 AUGUSTUS start_codon 977442 977444 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MSQKSHEQLGLPAFEIGIYEGRHCSEIEHCAISRYLKYKGFDPLELDYARAQGYLAFEVMGVPIKDQSSAVIEALSGF # ISAPMETISTLEDSEPDPEDWELVSISEGFNHDGESYPFFTELIRYQQLGDSLGKGAFGQVYRALNWATGETVAIKQISLNNIPASELSSIMSEISLL # KNLRHPNIVKYKGFVKTRMHLQVLEGLCYLHEQGVIHRDIKGANILTNKDGTVKLADFGVASSTAIPSGSSSAEVVGSPYWMAPEVIEQSGATTASDI # WSLGCVVIELLEGSPPYSFLDPMPALWRIVQDDCPPIPEGASAVVKDFLACCFQKDPNLRIGARKLLRHPWMVGVRARVKEAEAEKKDEQAQSHRHST # DNTSSGEDWTTSSTSSSTSTLHLSKSSSRSPLTTTVDKTRDHIDKSSLLLSKSPTQTVSLSKSQLDLGLQRQKTQRQPRKPSQKVSSAKNSARARPSI # SPSAVTGRVPGTEGRLVSQYGYDEAVQRVQEWNQALSSAANLSSLPSSTSMTIKPQSLAVPVVTIGIPTSTMSSSGSAGSVPTIHPSPMIPIPMFVPS # SSASSASSGSGSGSTSSSSDQGKTIRPVFTRPPSVSNDLLGKKDTHSHTKDMKGKGKGPTLITPSFNSLGSFNALSGIAGVLTDQRKQLAFVEEEDEM # DRDRWDDDFDLGEDDDFAARSKIDATKSKMDFGVKINHSKRDALHGTSNSSGSSSDGEDTTLTSSSKIKPQPRARDDRTIRASPGASLSRLPSSSNSS # PSQSSPVRPISPSRLPVAAVMTRSASDTTSASSSGTTYHAMSEAEEENYDDDFLGGDDDSGLEDGNALLERRVNEFKVIVILESSPISILNEFTISTG # KTCVSATPKPARQQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 Scaffold_12 AUGUSTUS gene 987526 988128 0.94 - . g578 Scaffold_12 AUGUSTUS transcript 987526 988128 0.94 - . g578.t1 Scaffold_12 AUGUSTUS stop_codon 987526 987528 . - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_12 AUGUSTUS CDS 987526 988128 0.94 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_12 AUGUSTUS start_codon 988126 988128 . - 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWCTAQDLTRRQACWALYFSWFDFHMIHCPGRTNTQADALSRMAAH # QVLDNEDNRQQTVLKPNHFTKIAASILQNPLEDHIRKASQREAQVLEGLKTVKEHGLQCLANGIAEWEEDNGPSVLSNQSICSIQLIHSIHSMHPLHP # SHLFYPIKPSVPSIHLSTPSGPSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 Scaffold_12 AUGUSTUS gene 992482 993189 0.64 - . g579 Scaffold_12 AUGUSTUS transcript 992482 993189 0.64 - . g579.t1 Scaffold_12 AUGUSTUS stop_codon 992482 992484 . - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_12 AUGUSTUS CDS 992482 993189 0.64 - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_12 AUGUSTUS start_codon 993187 993189 . - 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MGKPVFEEILEEMSDTPEGVVSDDGEAEWGDVEEEVEVKPVVNSSRRAKMDRRARRSRAASRKASREELRIHHTSKTP # SMTPLATAVPVDGKKEKEAAAVEVDDEKQALSFIDMLQRTMAQSPGAPQLRLPHFALLPGVSAMPWEALHQLNQFQFPMVFPVAVPLLPGWLSGEHRQ # DQDAADVADDNAGKLAGPIEAAQEWRALWEKWLAHVPWQATEMPPPPQYTLEQPQRKKN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 Scaffold_12 AUGUSTUS gene 993334 993723 0.7 - . g580 Scaffold_12 AUGUSTUS transcript 993334 993723 0.7 - . g580.t1 Scaffold_12 AUGUSTUS stop_codon 993334 993336 . - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_12 AUGUSTUS CDS 993334 993723 0.7 - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_12 AUGUSTUS start_codon 993721 993723 . - 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MTGNCKIEDAKKVAMRIVGAGEGTDSQNSNEQSASNGMNMQLSTTLSASRDLRSLMLVRAGNCEDFESLIADFLKSID # TPVDHPSAQVVSASKALSHMTKSGQSLLHLSAFLGYAAMWNSSSSMGSTWI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 Scaffold_12 AUGUSTUS gene 994759 995073 0.29 - . g581 Scaffold_12 AUGUSTUS transcript 994759 995073 0.29 - . g581.t1 Scaffold_12 AUGUSTUS stop_codon 994759 994761 . - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_12 AUGUSTUS CDS 994759 995073 0.29 - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_12 AUGUSTUS start_codon 995071 995073 . - 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MLQVSINFTLGRLWVISSSDLAFSLPIMFPSIPESSTKSRVEIQVRVTVDLADPSSSIDPHIYDRVGSWKWLKLPPGT # VPASRAKLVSNQHFLRGIFCSLLIRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 Scaffold_12 AUGUSTUS gene 995583 996242 0.5 - . g582 Scaffold_12 AUGUSTUS transcript 995583 996242 0.5 - . g582.t1 Scaffold_12 AUGUSTUS stop_codon 995583 995585 . - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_12 AUGUSTUS CDS 995583 996242 0.5 - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_12 AUGUSTUS start_codon 996240 996242 . - 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MDRVQQQRQRLTENALDYALALRGGAVLMDLTSDTAGITPLSQWQRWLSYVSTFPDYADKAPPLAVLEQEVHVGYCWA # FLGPRGHIAFALSEPIVVTDFTIFYANPDELTTKELQQAPKIIQLWALSAPKSPQDVVQQKLVPWKHFAQTNRKPLQLGFSNSFELLANVSFTLQQGT # KQTFSVESPTESLTTVVVIEVLDNWGSETTCLYRIAIHGQIPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 Scaffold_12 AUGUSTUS gene 1002111 1003073 0.83 + . g583 Scaffold_12 AUGUSTUS transcript 1002111 1003073 0.83 + . g583.t1 Scaffold_12 AUGUSTUS start_codon 1002111 1002113 . + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_12 AUGUSTUS CDS 1002111 1003073 0.83 + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_12 AUGUSTUS stop_codon 1003071 1003073 . + 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MSVLSLSKLAPDYAKMGSSAPSTSEGSLNSYVSHIAHFFQHINKLPWVADSRVTVDYYPGQSPRCARSRSPHRKEVLS # WYNRHAFPPGQNAEPLDLDAESSPSPVLGQVVQMIEAQPSVITKEPTKNVIQPLILPTVPVPESQIESGPTYFAELIPPPPPRSDTQQSARTGRSIVY # SVVNPSAPSTSTTTTSSSSPLTEPPRHLGIDTMTALAQSITGYTPYQPVAPQYGRPIHEPLAQVPVASSVIFTGDIREVKPAHTRTGTPAQSMYPYPL # YALPTTEYLTLHLCTPLLLPRNQGLYGVTLFRSLFFPVRKNVSQKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 Scaffold_12 AUGUSTUS gene 1010691 1011458 0.61 - . g584 Scaffold_12 AUGUSTUS transcript 1010691 1011458 0.61 - . g584.t1 Scaffold_12 AUGUSTUS stop_codon 1010691 1010693 . - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_12 AUGUSTUS CDS 1010691 1011458 0.61 - 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_12 AUGUSTUS start_codon 1011456 1011458 . - 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MLRMAVLPPSSPPMDFEVPGTASFNPDELMNFDLDCEILAITGFMDTMGSVPSSDLDHMKCTNAPSSVAVTKICKSAF # KPDLLSRLYNYCIDVKYISNEHFCIHDVSYSVCKKCKGKQRNQPKWWMNDSGRSEHTTFDLSDFIEYEDLEEKVLIATATTTAYITGIGAVLIHFKNV # RGRMHLARIAPVFYMKELSHRLIAQGCFLQDGKTVRSNTDKVDFWDKDGLFLSFEPQTVKSMPRCPIPPLGIPKIYPLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 Scaffold_12 AUGUSTUS gene 1013232 1013605 0.41 + . g585 Scaffold_12 AUGUSTUS transcript 1013232 1013605 0.41 + . g585.t1 Scaffold_12 AUGUSTUS start_codon 1013232 1013234 . + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_12 AUGUSTUS CDS 1013232 1013240 0.42 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_12 AUGUSTUS CDS 1013285 1013605 0.45 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_12 AUGUSTUS stop_codon 1013603 1013605 . + 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MRTKMSMQQLIRTNFVSRPRMSKGGNETQSPRLAESAYWKAHWLKLRCLSLGAESKISTEGPNGTSIVQDLNYISNNW # DEDDFDNNYQDPIHNDSSKEKSHFDPKIVLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 Scaffold_12 AUGUSTUS gene 1017656 1018117 1 + . g586 Scaffold_12 AUGUSTUS transcript 1017656 1018117 1 + . g586.t1 Scaffold_12 AUGUSTUS start_codon 1017656 1017658 . + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_12 AUGUSTUS CDS 1017656 1018117 1 + 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_12 AUGUSTUS stop_codon 1018115 1018117 . + 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MIDTPGPHYFFPTSAELPGVGGGPSPLEGSVLAEGDDENAPREVVGVTGETGVALCPNVATPTEEDDRDPPVGGSETP # AMARTPLFLPASHSPLSPLLILSVPVVPHIIDLTMIDNDGEDLYESCEEFEARMQGNVVVKNKRFSLALYGRSGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 Scaffold_12 AUGUSTUS gene 1018338 1018961 0.49 - . g587 Scaffold_12 AUGUSTUS transcript 1018338 1018961 0.49 - . g587.t1 Scaffold_12 AUGUSTUS stop_codon 1018338 1018340 . - 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_12 AUGUSTUS CDS 1018338 1018961 0.49 - 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_12 AUGUSTUS start_codon 1018959 1018961 . - 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MLEKELKSLKEYINEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCINYQALNKITKKNRYPLPLIGTLVDQLRKAKI # FTKIDLRAGYNNIRVAQGHEWKTAFQTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDNEVSHMEHIQKVLEQLRANHLH # AKPEKCAFHVNTVKYLGVIISPLGYPWTQRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 Scaffold_12 AUGUSTUS gene 1021086 1021913 0.68 - . g588 Scaffold_12 AUGUSTUS transcript 1021086 1021913 0.68 - . g588.t1 Scaffold_12 AUGUSTUS stop_codon 1021086 1021088 . - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_12 AUGUSTUS CDS 1021086 1021913 0.68 - 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_12 AUGUSTUS start_codon 1021911 1021913 . - 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MLELLEAEAHYGRLFRNSRGIPPLLPHTHRREKEFCGEAGLRILYQASNYRSGAIRFESPPLRVNIPNYQAIQILRNA # NLAAAAAKIDEESNEDVNTIAAENRRHRIYTMALTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEARRRLAWMKQMPEESFANF # FIHFNVYAPLTGFNDEALVTYLKKGLAPWLPLQVVTRREEPQSYDKWTRVFTKLDRAARAQAESLRNLHSKKTLQGWLSPESLSRVGVSTRSSLQVPL # A] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 Scaffold_12 AUGUSTUS gene 1022710 1023339 0.91 - . g589 Scaffold_12 AUGUSTUS transcript 1022710 1023339 0.91 - . g589.t1 Scaffold_12 AUGUSTUS stop_codon 1022710 1022712 . - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_12 AUGUSTUS CDS 1022710 1023339 0.91 - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_12 AUGUSTUS start_codon 1023337 1023339 . - 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 Scaffold_12 AUGUSTUS gene 1028301 1031517 0.97 - . g590 Scaffold_12 AUGUSTUS transcript 1028301 1031517 0.97 - . g590.t1 Scaffold_12 AUGUSTUS stop_codon 1028301 1028303 . - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_12 AUGUSTUS CDS 1028301 1028978 1 - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_12 AUGUSTUS CDS 1029031 1031517 0.97 - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_12 AUGUSTUS start_codon 1031515 1031517 . - 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MPVAESSYSVSGLDCQAGKSKHLFSSMTAKLSQYCNVAGLPFQDIPPNATQLQGPIPDVVDPFRSSLIVSSSDGTTHT # CPLDSTIKNQTLGLIPVTSSACPDPTHPYPKVDIVSESSFSTALNPDSEDISENDDDQVEECATLGEFMEEEPYRHDGGMSASGSVVSDGAVLAESGG # GTFRKASEPNPFVENINFDRDMGFTEVNDNQASNLNDTDTAHMETSNSFTIREDNPSIPNQNQAFEEDVNEDNENKESEESEEDEESENEREDEGNSA # PVGSAMSIRCSIIELEEENVAGPRSCVREVADSDSDMNPDGYDYQSSGDYGQSSVPNGTEAETTHLRSGTIVSEDAPPVQIQTCEEEEDDHDEEEEDG # YFEDYNMGREDQYEETEEEDDYVEDYNVDGKTGMGRRRRRRSTMAKIVAWVGMMMISMMQRKRRRRTMLKIITWMGKTSMGRRRKRGGRGGGRGGRGG # GRGGRGVGRGGGGGRGGGRGGRGGGKEEEEDYVEDDTMDGEDQHAEEEEGDLSNVIVQMSARDPIAVEKEEDVIESHASEEAFAYIGDYDMDGEDQYE # LDEEKDSGSSIGRSEEAYQSDAYDEDYNMDSEEQFAGERKKRRKRRKRRREEEAEEEEEAEEEEEAEEEEEEEEAEEAEEEEEAEEEDSGNGIGRISP # RGPTAVEDEEEEEEIENCNSDEAFQRHAYVEDYNMDEEDEYADHDDSEDSNDEDVDMRDGDVDMRDESPVIHDTSRKAMVEDVSDEDDQYPATHFHSG # KQRGTASFFSISPPSTPFKTSYVEIDEEVDNEADSIVDNPDQDTVLWMRDEIQELIKTQVKTKEMKKHFTTFLEKSMDNPALVLVALHAHIVYNSGRP # SRNASQDMEHFDFGSADGMSAASQESDEDDDPPPAKRKSPKRRSQNQIHLARQIRASVKSLLKLDDDKETLIKRCVEQWEIKDWIDAKCSGPTVDNFR # LDLENKGTLTRWNKAACTVFVSYFKSSPAHQKYSTVIVTKAFETHLIQLKRNMAKARESVKTKTKGGQSVKSDRERQNRRVARRKRVCLLFYFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 Scaffold_12 AUGUSTUS gene 1033253 1033741 0.46 + . g591 Scaffold_12 AUGUSTUS transcript 1033253 1033741 0.46 + . g591.t1 Scaffold_12 AUGUSTUS start_codon 1033253 1033255 . + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_12 AUGUSTUS CDS 1033253 1033741 0.46 + 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_12 AUGUSTUS stop_codon 1033739 1033741 . + 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MTRTLKRKLIETGASDVDAKRVRVSIANPSVAGPPNAGPLNKASLPNVTGFANTAGPLNIADPSNIAGPSNIAGPSNI # AGPSNIAGPSNIAGPSNIAGPSNIAGPSNTASQSPNKKRRAKSLSRRLRLRIAVQIRSVQLTAREQYTIDSNQFEHLRCGYEYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 Scaffold_12 AUGUSTUS gene 1042695 1043138 0.99 - . g592 Scaffold_12 AUGUSTUS transcript 1042695 1043138 0.99 - . g592.t1 Scaffold_12 AUGUSTUS stop_codon 1042695 1042697 . - 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_12 AUGUSTUS CDS 1042695 1043138 0.99 - 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_12 AUGUSTUS start_codon 1043136 1043138 . - 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MVLIWKESDRFQIEPCTADSNHDRKYSINSISLSPDAHYLAIGYGTQLQIWDLVDNTAVTPKANVEVNTTTNFAIWFS # NSPRLVTAHDEGPVYVFTIKNPGVDIAYHRDIGVEKPATSIAILDERTIAVALTEFVQIQWLDEGEFCA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 Scaffold_12 AUGUSTUS gene 1045427 1045888 0.64 - . g593 Scaffold_12 AUGUSTUS transcript 1045427 1045888 0.64 - . g593.t1 Scaffold_12 AUGUSTUS stop_codon 1045427 1045429 . - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_12 AUGUSTUS CDS 1045427 1045888 0.64 - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_12 AUGUSTUS start_codon 1045886 1045888 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MVDHPPDFELPRGSGLLRPNDLFVCVDLSLWHETEDVLSANSISSTSISSSALSSNSSTASSRNDPLRWSDPTMSQYL # RIWCWDDKLKVWQPIQYGCSRCISSYDLVLSFYRNTFEPLWVTPESLRRKDHHRLEPLTKPKARRKSKLGKLRSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 Scaffold_12 AUGUSTUS gene 1045936 1046292 0.51 - . g594 Scaffold_12 AUGUSTUS transcript 1045936 1046292 0.51 - . g594.t1 Scaffold_12 AUGUSTUS stop_codon 1045936 1045938 . - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_12 AUGUSTUS CDS 1045936 1046292 0.51 - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_12 AUGUSTUS start_codon 1046290 1046292 . - 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MLRLHLQGESYELELVLSVADDMNSLHENSEHVHATSSAVSSEANHDPDLQSMPPDASVTNSSERDLSPKAESGSVWT # GIKVSAQDSAQDSKAPKENHLRVGIHGGKPSSTIIFFRKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 Scaffold_12 AUGUSTUS gene 1051000 1051320 0.7 - . g595 Scaffold_12 AUGUSTUS transcript 1051000 1051320 0.7 - . g595.t1 Scaffold_12 AUGUSTUS stop_codon 1051000 1051002 . - 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_12 AUGUSTUS CDS 1051000 1051320 0.7 - 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_12 AUGUSTUS start_codon 1051318 1051320 . - 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MHPLHPFHPIDLFHASTPSIPSNPSTPSIPSNPSTPSIPSILCIHSIYSIQLIHSIYSICSMHLLRSCTPCNRAKATR # CLSAEDEWDSSEVINNTAVTPLVPGDRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 Scaffold_12 AUGUSTUS gene 1052627 1053130 0.67 - . g596 Scaffold_12 AUGUSTUS transcript 1052627 1053130 0.67 - . g596.t1 Scaffold_12 AUGUSTUS stop_codon 1052627 1052629 . - 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_12 AUGUSTUS CDS 1052627 1053130 0.67 - 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_12 AUGUSTUS start_codon 1053128 1053130 . - 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MHPLHPFHPIDLFHASTPSIPSNPSTPSVSSVPCIHSIYSIQLIHSIPSICSMHPIDPFRLFHASASIPTNSSVPSIH # SIQLIHSVCFIHSMHSLHLFHPIHPFHPFHLFHASTPSTPSIYFIRSMHPLHPFHPIDLFHASTPSIPSNPSTPSVSSVPCIHSIYSIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 Scaffold_12 AUGUSTUS gene 1059012 1059338 0.93 + . g597 Scaffold_12 AUGUSTUS transcript 1059012 1059338 0.93 + . g597.t1 Scaffold_12 AUGUSTUS start_codon 1059012 1059014 . + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_12 AUGUSTUS CDS 1059012 1059338 0.93 + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_12 AUGUSTUS stop_codon 1059336 1059338 . + 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MWEGSTEVENWRNEMKRVKAGFLDELRDEGVLSHVNVSGESGTSHKAQTEKEKIKPNKKRSERKRKSLLTRDEEDLQQ # APNLQLDSPDIFWTYDEGLEEIRRLSGKEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 Scaffold_12 AUGUSTUS gene 1064679 1065146 0.83 - . g598 Scaffold_12 AUGUSTUS transcript 1064679 1065146 0.83 - . g598.t1 Scaffold_12 AUGUSTUS stop_codon 1064679 1064681 . - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_12 AUGUSTUS CDS 1064679 1065146 0.83 - 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_12 AUGUSTUS start_codon 1065144 1065146 . - 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MPIDKVKLPEDQNGWHFGAFMDNPLANDDPIAVISLFLDPIPIDHVAAHSACGSSAFWDNGSITGPSEIITVRFRKFA # CKTTMQGQGVGTALFKHAMHFAHSELKAEVFWCDARVSSVAWYSGRGLSQFGHKFYKGAVEYVRMRVRLSETSPRSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 Scaffold_12 AUGUSTUS gene 1067238 1068340 0.82 + . g599 Scaffold_12 AUGUSTUS transcript 1067238 1068340 0.82 + . g599.t1 Scaffold_12 AUGUSTUS start_codon 1067238 1067240 . + 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_12 AUGUSTUS CDS 1067238 1067869 0.83 + 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_12 AUGUSTUS CDS 1067923 1068340 0.95 + 1 transcript_id "g599.t1"; gene_id "g599"; Scaffold_12 AUGUSTUS stop_codon 1068338 1068340 . + 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MARFPQGIFVEGIETPVAPKENTEDDFFESWSKPSTPKPSAPSTPRISTPPILGRTPSPVTPASSSTSIIAPAPRTTT # SSAAARTGKIGATRLNSATSIGSGPKKSKLGLGASKAAKPIDFEEAERKAREEAERIKQLGYDRQREAEEEKVRKEAEAKMAALEIGNKTVSASVSAA # KKVETPKSASFPRFGFGAIPSAGAAAAVVQGAKSNSSDAVDDAPTTARDKFGNQKGISSDMYFGRNSYDPQAAAEAQNRLQSFQGASAISSSQYFGRD # DEDELAMRRGNSDSLLGDGSLAGLELAARDALSRVMANPDVQNVGDSIRNGALKVSGMFCCCKVPFVSNHHILAV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 Scaffold_12 AUGUSTUS gene 1074255 1075151 0.41 + . g600 Scaffold_12 AUGUSTUS transcript 1074255 1075151 0.41 + . g600.t1 Scaffold_12 AUGUSTUS start_codon 1074255 1074257 . + 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_12 AUGUSTUS CDS 1074255 1075151 0.41 + 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_12 AUGUSTUS stop_codon 1075149 1075151 . + 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MCKTLVSQPRVAELVEALTIAIEEGEERRGEGEAPAEEDEEEGGGGDDEATDTEENEAQSGVLEPDDQDESMELAVAL # ALSLETGSHADVPTTSSSARVRLETEENLWPAISDALKKMSRLRHLSIVIDGSFSSPYSGRLAWILTDCPFRLKSFHSDMRWDENLVRFLNMQDEIED # LYIGDYDEGDEAGEVEESTGLDEKTPVTTMSSGPVGPRASHNSLTLSPTALPHLFTLECTFSEAAIAIVPGRPVSRLKTCFSRTDPEGKRAEMKVLFE # GLGKALVPAKNRSSARGVERFRKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 Scaffold_12 AUGUSTUS gene 1088060 1089448 0.43 - . g601 Scaffold_12 AUGUSTUS transcript 1088060 1089448 0.43 - . g601.t1 Scaffold_12 AUGUSTUS stop_codon 1088060 1088062 . - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_12 AUGUSTUS CDS 1088060 1089155 0.98 - 1 transcript_id "g601.t1"; gene_id "g601"; Scaffold_12 AUGUSTUS CDS 1089297 1089448 0.43 - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_12 AUGUSTUS start_codon 1089446 1089448 . - 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MDIEINNKDSMVNDENLEKMISFRNLALESIEPDHLRFMMNLIVQRYSKKSCRPGGFASFILQNNAFAIGVGISPLPR # ESVSAPETVKLEDGVLERERERAQEEYYARHQKHYSPFTRSPNSRFKLYFLDTAKIDLRRPGEKNRRGLFNTTSELTSWSGFGNEESIQGGLGHGASE # VTTAADIPSELLDLKRPPQELLFGFKQGPESNRHTMAGASSRKFNLVILDDHTSPSSSLTSDLHSIAQLLLGFQSLTQSQSGGGTLVVRLRHPESVIT # AKILYMLDTLSSTVAVVKPRGMLGDAEDPGCFYAIAQNVGGGPHGHKVGEVVEELRKLWWKLVMRVVRWKGLVGSVGSDVKVEADAIRDMCGLREEDF # DFIIYTDELKGSKSDYLVRLVALGEMVWTRQLEMILMVGDNRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 Scaffold_12 AUGUSTUS gene 1090053 1090742 0.99 - . g602 Scaffold_12 AUGUSTUS transcript 1090053 1090742 0.99 - . g602.t1 Scaffold_12 AUGUSTUS stop_codon 1090053 1090055 . - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_12 AUGUSTUS CDS 1090053 1090742 0.99 - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_12 AUGUSTUS start_codon 1090740 1090742 . - 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MANSSYSGYNPNSNLNIPYSSYDGGRGYGFGHGPERFSDSKPENPYGIQEQEQEQEVGPHSSYYDEDNSGMPVESARQ # NLSHPENPADNYCGRSGHSQHPLGPSSQDSRVYNPSSELPSSFVFSSLGPTRPAQVPSEREHPRRDHFPQTSHTNDHLNQLKQSRDSHNDSVSISHVS # NRHFSDRYHHHGHDSHPEWDHSEFPGRCQPKVLEEIAGTPRGSGYFDNSKNLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 Scaffold_12 AUGUSTUS gene 1104778 1105099 0.42 - . g603 Scaffold_12 AUGUSTUS transcript 1104778 1105099 0.42 - . g603.t1 Scaffold_12 AUGUSTUS stop_codon 1104778 1104780 . - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_12 AUGUSTUS CDS 1104778 1104851 0.42 - 2 transcript_id "g603.t1"; gene_id "g603"; Scaffold_12 AUGUSTUS CDS 1104955 1105099 0.83 - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_12 AUGUSTUS start_codon 1105097 1105099 . - 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MTIELKPLPLPNSAEPSHFINFGREVKGIDPGNCTSEQLEDIKADAVPTTEAHKGRFQSCLCASHVLNHNPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 Scaffold_12 AUGUSTUS gene 1105787 1107152 0.16 + . g604 Scaffold_12 AUGUSTUS transcript 1105787 1107152 0.16 + . g604.t1 Scaffold_12 AUGUSTUS start_codon 1105787 1105789 . + 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_12 AUGUSTUS CDS 1105787 1105838 0.42 + 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_12 AUGUSTUS CDS 1105924 1106197 0.38 + 2 transcript_id "g604.t1"; gene_id "g604"; Scaffold_12 AUGUSTUS CDS 1106247 1106567 0.54 + 1 transcript_id "g604.t1"; gene_id "g604"; Scaffold_12 AUGUSTUS CDS 1106771 1107152 0.61 + 1 transcript_id "g604.t1"; gene_id "g604"; Scaffold_12 AUGUSTUS stop_codon 1107150 1107152 . + 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MSALMRASLMSGIWFSQKWLTPSSLSSLKPYSSTLSVILNEKGGIIDDTIVTKHAEDAFYVVTNAGRRDRDLAWFIEK # LEQWNSTEYAKNGQVEMEVLENWGLIALQGTTKGCILPSSSHSFDLQKLTFGTSAFVPLEGFNLHVARGGYTGEDGFEISIPPSETVEVAKILSKYPV # QLTGLGARDSLRLEAGMCLYGNDLDEDTTPVEAGLSWVNCQTDADFPVLAEGAKIFSGTEQIGTITSGIPSPTLNKNIAMGYVKNGFHKKGTELEVEV # RNRRRQAVVTSMPFVKPNYWRGIRDNSVSGITCNSPSVPQISLFWFPDPDTFISSMFFERNACMNGCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 Scaffold_12 AUGUSTUS gene 1107329 1107802 0.77 - . g605 Scaffold_12 AUGUSTUS transcript 1107329 1107802 0.77 - . g605.t1 Scaffold_12 AUGUSTUS stop_codon 1107329 1107331 . - 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_12 AUGUSTUS CDS 1107329 1107802 0.77 - 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_12 AUGUSTUS start_codon 1107800 1107802 . - 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MHPLQGPFAVDSSDTGVTNLQSLRPRASLLSEGKVKFDSPYPIIGANNEDKTQKVKIKNAVKLLIKAALDPSGRMRLT # VSDWGQIAPNAVGNEQKLTVEVNFTPELPPTTSGLRIKSQTATKHYTGWVSWEKAPKVSGELRDDHTTLKVENSKLKDD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 Scaffold_12 AUGUSTUS gene 1110030 1110875 0.48 - . g606 Scaffold_12 AUGUSTUS transcript 1110030 1110875 0.48 - . g606.t1 Scaffold_12 AUGUSTUS stop_codon 1110030 1110032 . - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_12 AUGUSTUS CDS 1110030 1110143 0.57 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_12 AUGUSTUS CDS 1110196 1110231 0.48 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_12 AUGUSTUS CDS 1110345 1110875 0.6 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_12 AUGUSTUS start_codon 1110873 1110875 . - 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MSSSSLRKNQPESIDPPNLNTLESQVETEFPGQSSFQKRIAFAKRKVTTKDGWFGDYDYAWLCIPALPFSAKASRKQP # PFYSLDADLPLALAISSGLQHALAMLAGMCPIGIMRTWNLLAHRTYIGLITPPIIFASSLNLDSTTSSYMISASLIGCGASKITIVNQLLIDGTGILS # LSLVPALQHYLPRIFDAMYQDGTCTSTVGSDGTVVRNACPDAYGKVLGSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 Scaffold_12 AUGUSTUS gene 1112150 1113088 0.67 + . g607 Scaffold_12 AUGUSTUS transcript 1112150 1113088 0.67 + . g607.t1 Scaffold_12 AUGUSTUS start_codon 1112150 1112152 . + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_12 AUGUSTUS CDS 1112150 1113088 0.67 + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_12 AUGUSTUS stop_codon 1113086 1113088 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MNVATYQNTRSNHKLIVIVKFQQVVSEGNWFLKGDFSYKHCTLRNIELITCSRIPCALPELTQPHGMSYTTPFYRPAH # PNELEAQAFQLHRAPTHRPLGLWAYVDPTWNTTQHVQNRTSVAIPSPATYCIPNPCIQTPPVPQTRDGQQNYDDDEAATFSVCGSFDDRLRNRDLLDV # VQNENVLQPIFGRFDSSVDSAIPLGPGTDVTDPVPVTVAGLEKLIQDHARRNQNYFDYHSSSTTTTIISLPPLTELNLSTHNSQSTHDCLRPVEAVAC # CDEEIGTKSQSAMELPLAMGGRRSKSIEKVMRWRMGCI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 Scaffold_12 AUGUSTUS gene 1114317 1114988 0.46 - . g608 Scaffold_12 AUGUSTUS transcript 1114317 1114988 0.46 - . g608.t1 Scaffold_12 AUGUSTUS stop_codon 1114317 1114319 . - 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_12 AUGUSTUS CDS 1114317 1114988 0.46 - 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_12 AUGUSTUS start_codon 1114986 1114988 . - 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MQSAGSVQAIHDSVFRPLFTCAMDKLPTEHSTELVMKLAEQQMRLDKKFYNGHGLKKRPCIISGDTSKTFSRPGSKNT # GLVPIVLMATFAGSSLNTLSSMHQCFSAPVLTTGQNQHFRDYFSYVHPFEQGLITEKRFISTIPEWKSNHRNAQQYIICYEYMVPTSQIKAWRCSSAA # EYALDDDNQFKLTTLCKRKRQGWIRALKLHPQFYHNMVTDLLVCHLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 Scaffold_12 AUGUSTUS gene 1115534 1116545 0.93 + . g609 Scaffold_12 AUGUSTUS transcript 1115534 1116545 0.93 + . g609.t1 Scaffold_12 AUGUSTUS start_codon 1115534 1115536 . + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_12 AUGUSTUS CDS 1115534 1115692 0.93 + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_12 AUGUSTUS CDS 1116189 1116545 0.98 + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_12 AUGUSTUS stop_codon 1116543 1116545 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MSDSDDFDTTSLYVPFEGMYITFSFDIQETLDLHHCDPEDYAHLFEDIKNFPAVPVEVSSTHEPGPGSLLDMKLHGLA # QSRPDEHAINYRLEGSEAGPSRKLVIEGIDGDRRLELEVHHPAFAPIIDTIRPDSVDNDSEFTPVVKFDSDISAVDDFPNAYELYDHLDALEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 Scaffold_12 AUGUSTUS gene 1118959 1119261 0.64 + . g610 Scaffold_12 AUGUSTUS transcript 1118959 1119261 0.64 + . g610.t1 Scaffold_12 AUGUSTUS start_codon 1118959 1118961 . + 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_12 AUGUSTUS CDS 1118959 1119261 0.64 + 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_12 AUGUSTUS stop_codon 1119259 1119261 . + 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MKQHNLAQSYPDSGLAIRIQGNELGPTQKLVVEGTDSDIPKLEFDIHHPAFAPIVEASRPNYVDNDAIFTPVVKFDSD # IAALKDIPSGLELCRCLDALEA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 Scaffold_12 AUGUSTUS gene 1123151 1123801 1 - . g611 Scaffold_12 AUGUSTUS transcript 1123151 1123801 1 - . g611.t1 Scaffold_12 AUGUSTUS stop_codon 1123151 1123153 . - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_12 AUGUSTUS CDS 1123151 1123801 1 - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_12 AUGUSTUS start_codon 1123799 1123801 . - 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MSAAVTPHPCTVTQQTACTGSTCSSPNSTAGVCDQAGCDFNSFRLGDTTFYGPGQTVDTTKPFTVVTQFVSSNNQSTG # TLSAIRRLYVQNGKVIQNSETNIPGITATNEIDATFCEQQKVAFGDTDTFDSKGGLSGMGKAMSAGMVLVLSLWDDYAVNMLWLDSDFPTNGGTKPGV # ARGSCAVSSGVPATVEAQSPNAQVIYSNIKFGAIGTTFTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 Scaffold_12 AUGUSTUS gene 1128128 1128466 0.89 + . g612 Scaffold_12 AUGUSTUS transcript 1128128 1128466 0.89 + . g612.t1 Scaffold_12 AUGUSTUS start_codon 1128128 1128130 . + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_12 AUGUSTUS CDS 1128128 1128466 0.89 + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_12 AUGUSTUS stop_codon 1128464 1128466 . + 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MTAKDFDSLYPSSGKKRAHSPASDDESSEDESTSQAPPPRKKSQRLSAKKDVSPPVFDIAWHDNDVEEAGAVEVDNTS # GDDYGSPRPSSPILASVPTNVWDLNRKLEYFTTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 Scaffold_12 AUGUSTUS gene 1128486 1129013 0.87 - . g613 Scaffold_12 AUGUSTUS transcript 1128486 1129013 0.87 - . g613.t1 Scaffold_12 AUGUSTUS stop_codon 1128486 1128488 . - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_12 AUGUSTUS CDS 1128486 1129013 0.87 - 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_12 AUGUSTUS start_codon 1129011 1129013 . - 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MDDCEGLDTDTIEHLYGTDGPEVLRPPGHTGAGYLNDEGESTPSNASSDSEGDNDSDVEGFDTRIDNVAQASSRQFLP # KPVKTPRHICPLTNEEMAIFNEALQLAVAQGIVPVGYGICPEEWKDNHYPSIEIIQTGRKGAKEISVQLPDFIWRPRAHLWTLGLNILEHIVENRTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 Scaffold_12 AUGUSTUS gene 1130590 1131291 0.59 + . g614 Scaffold_12 AUGUSTUS transcript 1130590 1131291 0.59 + . g614.t1 Scaffold_12 AUGUSTUS start_codon 1130590 1130592 . + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_12 AUGUSTUS CDS 1130590 1130709 0.77 + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_12 AUGUSTUS CDS 1130763 1130950 0.76 + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_12 AUGUSTUS CDS 1131000 1131291 0.59 + 1 transcript_id "g614.t1"; gene_id "g614"; Scaffold_12 AUGUSTUS stop_codon 1131289 1131291 . + 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MDIDNGPISGDDLPEQGDKSPAVYKRHPLYYFEDANLFLKAQDSGFIYAVYKGMMAKFSETFEACFTFPQPQGKEEGT # IFDNPILLPIDAAAFDVLCSFIFHLGWKSQSNRSTDELLALGRISQFLQCPDALKFAIAGLRFHSYDFNGGKKMFYASTFGVPKWGYSATREILTSVY # GVGGCCSGVLSEFTSMSKLILPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 Scaffold_12 AUGUSTUS gene 1147858 1149874 0.44 + . g615 Scaffold_12 AUGUSTUS transcript 1147858 1149874 0.44 + . g615.t1 Scaffold_12 AUGUSTUS start_codon 1147858 1147860 . + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_12 AUGUSTUS CDS 1147858 1148699 0.44 + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_12 AUGUSTUS CDS 1148863 1149874 0.73 + 1 transcript_id "g615.t1"; gene_id "g615"; Scaffold_12 AUGUSTUS stop_codon 1149872 1149874 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MVTWRQYDAALHERTSSTSTLLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGSSKKVRSNAS # KKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPLPPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNM # PPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDSQRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGP # PDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRARGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATV # LHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGLDYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAG # FAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPALPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPI # VQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPSFLGPSPAYPSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 Scaffold_12 AUGUSTUS gene 1150500 1151192 0.71 - . g616 Scaffold_12 AUGUSTUS transcript 1150500 1151192 0.71 - . g616.t1 Scaffold_12 AUGUSTUS stop_codon 1150500 1150502 . - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_12 AUGUSTUS CDS 1150500 1151192 0.71 - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_12 AUGUSTUS start_codon 1151190 1151192 . - 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQDDWDLLLPMAEFVYNN # TPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNMENVRTRRPMKKLDHKW # TGPYTVLSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPQSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 Scaffold_12 AUGUSTUS gene 1151554 1152612 0.87 - . g617 Scaffold_12 AUGUSTUS transcript 1151554 1152612 0.87 - . g617.t1 Scaffold_12 AUGUSTUS stop_codon 1151554 1151556 . - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_12 AUGUSTUS CDS 1151554 1152612 0.87 - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_12 AUGUSTUS start_codon 1152610 1152612 . - 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MWTRQEGPERYGQHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFID # NYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDK # ELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQVLAGRERVL # IPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLIKRGGRIYVPDVGTYEGRSYSRTTTIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 Scaffold_12 AUGUSTUS gene 1152942 1153370 0.88 - . g618 Scaffold_12 AUGUSTUS transcript 1152942 1153370 0.88 - . g618.t1 Scaffold_12 AUGUSTUS stop_codon 1152942 1152944 . - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_12 AUGUSTUS CDS 1152942 1153370 0.88 - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_12 AUGUSTUS start_codon 1153368 1153370 . - 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD # IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTCDSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 Scaffold_12 AUGUSTUS gene 1162053 1163719 0.91 + . g619 Scaffold_12 AUGUSTUS transcript 1162053 1163719 0.91 + . g619.t1 Scaffold_12 AUGUSTUS start_codon 1162053 1162055 . + 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_12 AUGUSTUS CDS 1162053 1163037 0.93 + 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_12 AUGUSTUS CDS 1163151 1163719 0.94 + 2 transcript_id "g619.t1"; gene_id "g619"; Scaffold_12 AUGUSTUS stop_codon 1163717 1163719 . + 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIILDIEALHQAI # ILALSADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGR # NKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFF # RALGKALSMEFTIPLDTIRKPMGKLSVSTRLSSSTSGSIAPTNRMTGLLYSRSPTRDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGS # EYSFLLSTFVLLVLLKNSQKNILVLSSHQSTWYLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYK # RCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 Scaffold_12 AUGUSTUS gene 1173521 1174510 0.27 + . g620 Scaffold_12 AUGUSTUS transcript 1173521 1174510 0.27 + . g620.t1 Scaffold_12 AUGUSTUS start_codon 1173521 1173523 . + 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_12 AUGUSTUS CDS 1173521 1174510 0.27 + 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_12 AUGUSTUS stop_codon 1174508 1174510 . + 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MQMISDKKSTSNSGMRMEHPIYLQLNVRPTHSFVLLIALLLYVRLSELLKGRMVKTFDPRLRTWILQESTNKQLLQDG # EILLIRSRVCQSGEGMKEAEAEEINWKNPHKRRYEQDVESYLIPTMPSTPRHHISHPEPLVSCSPTPQLIQPLATTFPRDLSNSPDLPSIINTRPTTP # TPAPKKVKRTHVEEPSIPLATIDLTGSNSRHGNWPWKSYQRMHDGFVKLAETGGKHSDVFPVTSNKTRSVARAAWAAGSVELKAKFRTNPASTWKEYV # KEVRTAHGGFIPSYTTQKVKVEKVIAPTSPKVKQEVAELQIDGILQHEGIEIESD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 Scaffold_12 AUGUSTUS gene 1177997 1178902 0.87 + . g621 Scaffold_12 AUGUSTUS transcript 1177997 1178902 0.87 + . g621.t1 Scaffold_12 AUGUSTUS start_codon 1177997 1177999 . + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_12 AUGUSTUS CDS 1177997 1178902 0.87 + 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_12 AUGUSTUS stop_codon 1178900 1178902 . + 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MVNPNQASTTSTAAAPTRAARLIVRNIPFNTSQQDLRALFLPYGPIYSIHIPLETKTDDANVANDGEEPSQKSNSQPR # SQSRTRGFAFVWMNSKKDAERAMEGCNGTVLRAGMAENMISDKQKRKKQRRVEKKMKERTKKEIAGEEKDEDEGEESDQEEDNEHSLDERIIAVDWAL # SKDKWEEEKAKLGKADDDGDQMEDDAASGSGSSSDSSSGTGSEDEDGIGLHDDGDESGSDYSGDDDNKSDGEEEVPVKPELPAPEAGTTLFVRNVPFT # ATEDELRTLYVFSCFSSTHYEPFFLIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 Scaffold_12 AUGUSTUS gene 1179594 1180223 0.69 + . g622 Scaffold_12 AUGUSTUS transcript 1179594 1180223 0.69 + . g622.t1 Scaffold_12 AUGUSTUS start_codon 1179594 1179596 . + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_12 AUGUSTUS CDS 1179594 1180223 0.69 + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_12 AUGUSTUS stop_codon 1180221 1180223 . + 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MFNKEVKGGERKGLTEDELTVEPEAEVEGDADIQEKNDKEGKKRKPFGRSKPNLTKQAKLVRQQERVDQITGKGRSKG # YGFLELNTHADALRVLRWANNNPSVAELWEGWWKEELVALLKAEKSKPENEKEESRIKRVEGEIEKLESAGGGGTALKKSRGTLIVEFSIENVQVVQR # RRVMQDERRKVGSVPMLFRTLTLICDCALHFTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 Scaffold_12 AUGUSTUS gene 1193693 1195681 0.41 - . g623 Scaffold_12 AUGUSTUS transcript 1193693 1195681 0.41 - . g623.t1 Scaffold_12 AUGUSTUS stop_codon 1193693 1193695 . - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_12 AUGUSTUS CDS 1193693 1193965 0.44 - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_12 AUGUSTUS CDS 1194061 1194204 0.44 - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_12 AUGUSTUS CDS 1194299 1195681 0.98 - 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_12 AUGUSTUS start_codon 1195679 1195681 . - 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MRVILALLRCIVRVLKRNSEVDSHIPSQIPKDVHTIVDCYDIDPTLHAFVACPTCYALYPLTDEALKNAESVYQANKP # LPVCDERSHPDSAPCGTTLWKTRRIDRRTFVTPIRKQIFQDLKEWIGRIVATPGFEDAIAQHQQSPPPADGDPERDFVDSTTFRQFKGADGESYAIPK # VGPSGSPDLRLVTSLGFDAFNPFHSKTAHAIVQSTALYMVILSLPEHLRYRPENMYLLTVMTGKPSQHHINFTLRKLVKQLLPFWEGVFYVRTARYFL # GRRVFIALIPAVCDTEGAHQLSGFASHSHTYFCRRCLLQIGDIHNLVPQTWIMRDPAQHRQLALKWKEASTEEERQKIYDEFGIRWSELLELPYWDPV # LFTIIDDMHFAQLGLFETHLRDVWQIDHEKSGGDGLYPEVKDQQKLSKASLRNLLNEIRENQTSLQKRLQEQKKKTLWYICFKLGLRTGRSSSGPANV # PQVPPLNYNDIPDAWEGDVLMDNVKYLLSACYLNTLPWNSFGSRASSAPLVMRPAPSFAFNRDSAFEKLKSKTLDFAGKPPSLSKPNLRTLKALCQDL # GIHYNSVDSKRILAARILDYVCLSSSYMIHF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 Scaffold_12 AUGUSTUS gene 1197244 1197750 0.89 + . g624 Scaffold_12 AUGUSTUS transcript 1197244 1197750 0.89 + . g624.t1 Scaffold_12 AUGUSTUS start_codon 1197244 1197246 . + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_12 AUGUSTUS CDS 1197244 1197750 0.89 + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_12 AUGUSTUS stop_codon 1197748 1197750 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MLVQVFQSFSTKRPVLTTFLRAGSATAAEVRGATPVTFKFSAPAPKYFLKESKRASSIVGDTYGPTKLQTTPFRSHAS # EGETAWYYSQSPADLDGPLPETPIPRMLGTIYIHRSIKDGGYQIWVWFNRDGTGLGWQSVDLSNEQVAHPRVADRSLKVDCGGKAKLDPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 Scaffold_12 AUGUSTUS gene 1199999 1200592 0.49 - . g625 Scaffold_12 AUGUSTUS transcript 1199999 1200592 0.49 - . g625.t1 Scaffold_12 AUGUSTUS stop_codon 1199999 1200001 . - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_12 AUGUSTUS CDS 1199999 1200592 0.49 - 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_12 AUGUSTUS start_codon 1200590 1200592 . - 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MSLFVMISCSARGHSALLAGGIIARLARGIVDVNDVYDGPTGHALNEGEQALCVWEAGQACAFWDDKLTDEEMDLICG # SYEVATGSYSFPSNLILIQKSMHLGFISREGKQQTAIKSWWPRSGSWRSCGLNCGYWSSDAEDWFRNRLDQILKSTVPMALMTSQEWHGRLKFQRAHT # LSNQNDGFAAEYLKTKCNLPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # command line: # augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000002