# This output was generated with AUGUSTUS (version 3.4.0).
# AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de),
# O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Sources of extrinsic information: M RM 
# Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ...
# saccharomyces version. Using default transition matrix.
# Looks like split/input_1/input_1.fa_chunk_0000001 is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 619333, name = Scaffold_18) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
Scaffold_18	AUGUSTUS	gene	44020	44631	0.74	+	.	g1
Scaffold_18	AUGUSTUS	transcript	44020	44631	0.74	+	.	g1.t1
Scaffold_18	AUGUSTUS	start_codon	44020	44022	.	+	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_18	AUGUSTUS	CDS	44020	44631	0.74	+	0	transcript_id "g1.t1"; gene_id "g1";
Scaffold_18	AUGUSTUS	stop_codon	44629	44631	.	+	0	transcript_id "g1.t1"; gene_id "g1";
# protein sequence = [MSTPVPPAQTTSADELMTQLIKQVANLATAMEERSSSKSSMNKPEVFKGKDSNEARRFRAQFQNWASEQPDLANSQVK
# LIKSALGFFTEGAEDWATPHLLHFNAENPPFEGSWEKFLLAFGQRFESIDPGMEARNAIQSLKQGKGQTVEEFAQKFQDIGSRTGMSDIDLRECFYCA
# LLPEIQQNLITVNIGQGVARTLREAIT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g1
###
# start gene g2
Scaffold_18	AUGUSTUS	gene	55123	56289	0.79	+	.	g2
Scaffold_18	AUGUSTUS	transcript	55123	56289	0.79	+	.	g2.t1
Scaffold_18	AUGUSTUS	start_codon	55123	55125	.	+	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_18	AUGUSTUS	CDS	55123	56289	0.79	+	0	transcript_id "g2.t1"; gene_id "g2";
Scaffold_18	AUGUSTUS	stop_codon	56287	56289	.	+	0	transcript_id "g2.t1"; gene_id "g2";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g2
###
# start gene g3
Scaffold_18	AUGUSTUS	gene	56340	57344	0.64	+	.	g3
Scaffold_18	AUGUSTUS	transcript	56340	57344	0.64	+	.	g3.t1
Scaffold_18	AUGUSTUS	start_codon	56340	56342	.	+	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_18	AUGUSTUS	CDS	56340	57344	0.64	+	0	transcript_id "g3.t1"; gene_id "g3";
Scaffold_18	AUGUSTUS	stop_codon	57342	57344	.	+	0	transcript_id "g3.t1"; gene_id "g3";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQELDRFLGSSPQNHQSHHRSSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g3
###
# start gene g4
Scaffold_18	AUGUSTUS	gene	61943	62572	0.96	-	.	g4
Scaffold_18	AUGUSTUS	transcript	61943	62572	0.96	-	.	g4.t1
Scaffold_18	AUGUSTUS	stop_codon	61943	61945	.	-	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_18	AUGUSTUS	CDS	61943	62572	0.96	-	0	transcript_id "g4.t1"; gene_id "g4";
Scaffold_18	AUGUSTUS	start_codon	62570	62572	.	-	0	transcript_id "g4.t1"; gene_id "g4";
# protein sequence = [MLRASDSSTTEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARMLPPHRPYD
# IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFT
# KIDLRAGYNNVRVAQDTSGRLHSELGMGPSNTW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g4
###
# start gene g5
Scaffold_18	AUGUSTUS	gene	63095	63451	0.77	-	.	g5
Scaffold_18	AUGUSTUS	transcript	63095	63451	0.77	-	.	g5.t1
Scaffold_18	AUGUSTUS	stop_codon	63095	63097	.	-	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_18	AUGUSTUS	CDS	63095	63451	0.77	-	0	transcript_id "g5.t1"; gene_id "g5";
Scaffold_18	AUGUSTUS	start_codon	63449	63451	.	-	0	transcript_id "g5.t1"; gene_id "g5";
# protein sequence = [MHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPEVPQ
# QPPEAPLRAPRTRVKLEEVKDEEYEASQPGPHKLFPRTKI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g5
###
# start gene g6
Scaffold_18	AUGUSTUS	gene	67530	68159	0.85	-	.	g6
Scaffold_18	AUGUSTUS	transcript	67530	68159	0.85	-	.	g6.t1
Scaffold_18	AUGUSTUS	stop_codon	67530	67532	.	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_18	AUGUSTUS	CDS	67530	68159	0.85	-	0	transcript_id "g6.t1"; gene_id "g6";
Scaffold_18	AUGUSTUS	start_codon	68157	68159	.	-	0	transcript_id "g6.t1"; gene_id "g6";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g6
###
# start gene g7
Scaffold_18	AUGUSTUS	gene	69628	70242	0.35	+	.	g7
Scaffold_18	AUGUSTUS	transcript	69628	70242	0.35	+	.	g7.t1
Scaffold_18	AUGUSTUS	start_codon	69628	69630	.	+	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_18	AUGUSTUS	CDS	69628	70242	0.35	+	0	transcript_id "g7.t1"; gene_id "g7";
Scaffold_18	AUGUSTUS	stop_codon	70240	70242	.	+	0	transcript_id "g7.t1"; gene_id "g7";
# protein sequence = [MHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPEVPQ
# QTPEAPLRAPKTRVKLEEVKDEEYEASQPGSHKLFRSDKDLGPDDPILMGINEWLAFANESTEEEVEEILEAGRSTMENVTPNPAKDSEEAYQKWKSR
# DTERSSSWPGAKQKVRWRKKRREHGTLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g7
###
# start gene g8
Scaffold_18	AUGUSTUS	gene	80227	80655	1	+	.	g8
Scaffold_18	AUGUSTUS	transcript	80227	80655	1	+	.	g8.t1
Scaffold_18	AUGUSTUS	start_codon	80227	80229	.	+	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_18	AUGUSTUS	CDS	80227	80655	1	+	0	transcript_id "g8.t1"; gene_id "g8";
Scaffold_18	AUGUSTUS	stop_codon	80653	80655	.	+	0	transcript_id "g8.t1"; gene_id "g8";
# protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD
# IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTCDSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g8
###
# start gene g9
Scaffold_18	AUGUSTUS	gene	88297	89463	0.88	-	.	g9
Scaffold_18	AUGUSTUS	transcript	88297	89463	0.88	-	.	g9.t1
Scaffold_18	AUGUSTUS	stop_codon	88297	88299	.	-	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_18	AUGUSTUS	CDS	88297	89463	0.88	-	0	transcript_id "g9.t1"; gene_id "g9";
Scaffold_18	AUGUSTUS	start_codon	89461	89463	.	-	0	transcript_id "g9.t1"; gene_id "g9";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD
# RANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g9
###
# start gene g10
Scaffold_18	AUGUSTUS	gene	91714	92448	0.81	-	.	g10
Scaffold_18	AUGUSTUS	transcript	91714	92448	0.81	-	.	g10.t1
Scaffold_18	AUGUSTUS	stop_codon	91714	91716	.	-	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_18	AUGUSTUS	CDS	91714	92448	0.81	-	0	transcript_id "g10.t1"; gene_id "g10";
Scaffold_18	AUGUSTUS	start_codon	92446	92448	.	-	0	transcript_id "g10.t1"; gene_id "g10";
# protein sequence = [MRTVVELALEYLSQGRLTHGELHLRSTSSLLYYYSNAADRVDGCTRTCLPTLVSPDAAFLTAAQHAGYVEARPDSLEP
# PLHRQLFSFDHPIPLPQSPISDHIPAVPMMDSVMLMWEDMIRTYVREVLGYPASPDRASSPVDVPGSNDPLPTASPLVAPDAPPALDASESVSQDAPL
# FLPESLSPTSPRPPSPIPSSSRVPHVPREIVDLTMDDAEDLYESQEEFLARTGGAVTVKQEDTESEVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g10
###
# start gene g11
Scaffold_18	AUGUSTUS	gene	98703	99318	0.51	-	.	g11
Scaffold_18	AUGUSTUS	transcript	98703	99318	0.51	-	.	g11.t1
Scaffold_18	AUGUSTUS	stop_codon	98703	98705	.	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_18	AUGUSTUS	CDS	98703	98969	0.7	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_18	AUGUSTUS	CDS	99067	99318	0.55	-	0	transcript_id "g11.t1"; gene_id "g11";
Scaffold_18	AUGUSTUS	start_codon	99316	99318	.	-	0	transcript_id "g11.t1"; gene_id "g11";
# protein sequence = [MSTHFQQYFYMGKPKKDQVDWKNSPGDVEALVRFLHSQRSRVGQGGNFDSTVYNEAAKHLEARGPPSHGVAKTAVSIK
# KYYSSTKTYTGASGWTYSHEGGFNVVSATEDAWRNFVSVHKQFKPFKTSGWPLWELMHEIVPTQARGVHVFNAASQDTVRPGTKGLLSSYLDWA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g11
###
# start gene g12
Scaffold_18	AUGUSTUS	gene	113366	114427	0.26	+	.	g12
Scaffold_18	AUGUSTUS	transcript	113366	114427	0.26	+	.	g12.t1
Scaffold_18	AUGUSTUS	start_codon	113366	113368	.	+	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_18	AUGUSTUS	CDS	113366	113594	0.85	+	0	transcript_id "g12.t1"; gene_id "g12";
Scaffold_18	AUGUSTUS	CDS	114102	114427	0.32	+	2	transcript_id "g12.t1"; gene_id "g12";
Scaffold_18	AUGUSTUS	stop_codon	114425	114427	.	+	0	transcript_id "g12.t1"; gene_id "g12";
# protein sequence = [MLVPPSIQFVIVAHDDLQIRLFLGSVKVLLWPSRSPQWYDLRTSVMKPTYGVLPSSLNARTYFQSFAKMVLRLILRSY
# ETGQTLPRRPDDLVHQENEFEEEQYLFSVVYDTGSDLEYLPLSALSSPPDTPFLRTPQLPVLELDEPSIVVHSDKHDFDVVADLFPSVPVPKRTASHD
# AESVKSKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g12
###
# start gene g13
Scaffold_18	AUGUSTUS	gene	118794	119459	0.42	+	.	g13
Scaffold_18	AUGUSTUS	transcript	118794	119459	0.42	+	.	g13.t1
Scaffold_18	AUGUSTUS	start_codon	118794	118796	.	+	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_18	AUGUSTUS	CDS	118794	119459	0.42	+	0	transcript_id "g13.t1"; gene_id "g13";
Scaffold_18	AUGUSTUS	stop_codon	119457	119459	.	+	0	transcript_id "g13.t1"; gene_id "g13";
# protein sequence = [MSETTIRKVNDEPKATLHHPETVTEEGQNEDAVLEIPLNLQRQRTNSSGRSSAPPVHTVRTPARTKRRSVSSTLSDPE
# HDQTPNGTEKSLPQKDIDLNFSSLLFTPAPIIFSTPLERELLNVMSLLGFDLGQIVYSVLNDACDSAGAVWWMLKRKAEKKLLEEGTDSLFSGIGTDG
# TLSPTIDEHLGKYRSSSSSRRKKHNMGIQTESTPLISISQKPPHN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g13
###
# start gene g14
Scaffold_18	AUGUSTUS	gene	122749	123132	0.74	-	.	g14
Scaffold_18	AUGUSTUS	transcript	122749	123132	0.74	-	.	g14.t1
Scaffold_18	AUGUSTUS	stop_codon	122749	122751	.	-	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_18	AUGUSTUS	CDS	122749	123132	0.74	-	0	transcript_id "g14.t1"; gene_id "g14";
Scaffold_18	AUGUSTUS	start_codon	123130	123132	.	-	0	transcript_id "g14.t1"; gene_id "g14";
# protein sequence = [MHSTAMCIEDIDALDYLLTRIKHVDEIPRVLSAHEELRMERCTHARDWELRKLQMFTLNQGEDRELRDAKIRCLSECE
# DMEEKEYAFNDLWGEEVDFYAYDPIEQADNWWSMYGTVISRRTQITGPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g14
###
# start gene g15
Scaffold_18	AUGUSTUS	gene	137977	138525	0.83	+	.	g15
Scaffold_18	AUGUSTUS	transcript	137977	138525	0.83	+	.	g15.t1
Scaffold_18	AUGUSTUS	start_codon	137977	137979	.	+	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_18	AUGUSTUS	CDS	137977	138525	0.83	+	0	transcript_id "g15.t1"; gene_id "g15";
Scaffold_18	AUGUSTUS	stop_codon	138523	138525	.	+	0	transcript_id "g15.t1"; gene_id "g15";
# protein sequence = [MRGKDDVFIQVKSLHYQHPRHDSGKDYAHDCNHNPPFIPFNPTGLDDPFDPADADDPFGPTDADDPWDPEPHNGPDEF
# NASSGIRTLGRPLVATTVKLPSEPIITESHDKTSTRVSFGLYKPAVLGIIHVALDELPPFVRRVSKGGLDIASVEMEDCEMKEALVVRKDELYDIACF
# RAELRA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g15
###
# start gene g16
Scaffold_18	AUGUSTUS	gene	143360	143845	0.63	+	.	g16
Scaffold_18	AUGUSTUS	transcript	143360	143845	0.63	+	.	g16.t1
Scaffold_18	AUGUSTUS	start_codon	143360	143362	.	+	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_18	AUGUSTUS	CDS	143360	143845	0.63	+	0	transcript_id "g16.t1"; gene_id "g16";
Scaffold_18	AUGUSTUS	stop_codon	143843	143845	.	+	0	transcript_id "g16.t1"; gene_id "g16";
# protein sequence = [MPSASNSLLAQHALGLMKETQKYFASLATIAVNPSNSLVLPQSQAVIEAIGHAMAYAAAGEAKIPQPILDIYECSVIR
# QDPAWYSENVGLNRMAQRRREDAAVKAALPNLNAYLDALRIEDYVSAPIVSDEGWKKYVDSLPRYTGNATVEPQQIQHTQAML]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g16
###
# start gene g17
Scaffold_18	AUGUSTUS	gene	146408	146860	0.7	+	.	g17
Scaffold_18	AUGUSTUS	transcript	146408	146860	0.7	+	.	g17.t1
Scaffold_18	AUGUSTUS	start_codon	146408	146410	.	+	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_18	AUGUSTUS	CDS	146408	146860	0.7	+	0	transcript_id "g17.t1"; gene_id "g17";
Scaffold_18	AUGUSTUS	stop_codon	146858	146860	.	+	0	transcript_id "g17.t1"; gene_id "g17";
# protein sequence = [MPEDRRFVLYMSSPLIYLCHSRHLPDITIITPVFDSNSKEIIFFTASRGHHADIGGILPGSMPPTSVNIFEEGAEIVS
# FKIVDAGVFDREGLLDYMVEQPSKYPGSSGCRNIRDVESDLKAVCYLASAHSITNAQSFLDSKSRRIIKAFN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g17
###
# start gene g18
Scaffold_18	AUGUSTUS	gene	154842	156135	0.92	-	.	g18
Scaffold_18	AUGUSTUS	transcript	154842	156135	0.92	-	.	g18.t1
Scaffold_18	AUGUSTUS	stop_codon	154842	154844	.	-	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_18	AUGUSTUS	CDS	154842	155635	0.99	-	2	transcript_id "g18.t1"; gene_id "g18";
Scaffold_18	AUGUSTUS	CDS	155706	156135	0.92	-	0	transcript_id "g18.t1"; gene_id "g18";
Scaffold_18	AUGUSTUS	start_codon	156133	156135	.	-	0	transcript_id "g18.t1"; gene_id "g18";
# protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSASTVVAKVAVP
# LPELRRRFHRQFWRPLLGTHSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVKVAADRSSTTPTVPPLHPSIPEEYAEFADVFDE
# IAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLIS
# DLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVRR
# FFGGYGNIGFTPTPRSANSIWILLSIWVIFFLPTD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g18
###
# start gene g19
Scaffold_18	AUGUSTUS	gene	168817	171672	0.9	-	.	g19
Scaffold_18	AUGUSTUS	transcript	168817	171672	0.9	-	.	g19.t1
Scaffold_18	AUGUSTUS	stop_codon	168817	168819	.	-	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_18	AUGUSTUS	CDS	168817	171672	0.9	-	0	transcript_id "g19.t1"; gene_id "g19";
Scaffold_18	AUGUSTUS	start_codon	171670	171672	.	-	0	transcript_id "g19.t1"; gene_id "g19";
# protein sequence = [MGESGDIGRTNRGSMVLSRVHYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESALSDYLPISPGITLSILYPEH
# QQPWTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYN
# NVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQ
# QQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWA
# PDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIIDHSNLEFWRTAQDLTRRQARW
# ALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQVLEGLETVKKHGLQRLANGIAEW
# EEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQRHPRAVTQPLDVPSGLWEEVGV
# DLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTER
# ANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYER
# GKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFMSTNYIHGKVTPSMAKYQHHQSRCT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g19
###
# start gene g20
Scaffold_18	AUGUSTUS	gene	172801	173526	0.92	-	.	g20
Scaffold_18	AUGUSTUS	transcript	172801	173526	0.92	-	.	g20.t1
Scaffold_18	AUGUSTUS	stop_codon	172801	172803	.	-	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_18	AUGUSTUS	CDS	172801	173526	0.92	-	0	transcript_id "g20.t1"; gene_id "g20";
Scaffold_18	AUGUSTUS	start_codon	173524	173526	.	-	0	transcript_id "g20.t1"; gene_id "g20";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTSHYPCRPSRHGH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g20
###
# start gene g21
Scaffold_18	AUGUSTUS	gene	176973	177284	0.58	-	.	g21
Scaffold_18	AUGUSTUS	transcript	176973	177284	0.58	-	.	g21.t1
Scaffold_18	AUGUSTUS	stop_codon	176973	176975	.	-	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_18	AUGUSTUS	CDS	176973	177284	0.58	-	0	transcript_id "g21.t1"; gene_id "g21";
Scaffold_18	AUGUSTUS	start_codon	177282	177284	.	-	0	transcript_id "g21.t1"; gene_id "g21";
# protein sequence = [MSATSMERPSSSKTESKKQKSALSRGNMTQAQKLNQAASSTVITVAAGQCLMPIPEQSFGDETASNIRTPEGRHRRFR
# GPLQWNLGWDHHNGGLPPWVTPNLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g21
###
# start gene g22
Scaffold_18	AUGUSTUS	gene	189127	190515	0.51	-	.	g22
Scaffold_18	AUGUSTUS	transcript	189127	190515	0.51	-	.	g22.t1
Scaffold_18	AUGUSTUS	stop_codon	189127	189129	.	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_18	AUGUSTUS	CDS	189127	190515	0.51	-	0	transcript_id "g22.t1"; gene_id "g22";
Scaffold_18	AUGUSTUS	start_codon	190513	190515	.	-	0	transcript_id "g22.t1"; gene_id "g22";
# protein sequence = [MVDRIKELWREGYLVAVLYMDVKGAFPSVDLDMLQHELRMGVPEEILDWMRRRYSGRKTQLSFDDYISQPFAVPGGED
# QGDPFAAVGYILYAAGLLATFKTLDKEEGFGFMDDVAAMKWGKDVNQLHAEIGQMMNKANGPLEWAASHNCQFGVPKFKLVDFNRQRKPHPTESRKTI
# PITGPGVQLRGTLIKSEPFTKFLGTLMDRQLRWNEQHAAMVRKGQQWVAQFRRVARMRDGMVAQLVRQLYKAKALPKMLYAADIVLTPTSRKSEKKWT
# QASHTRGIIRKLTSIQRQAALLITGAMTTTATDILNIHAALLPLPLEIERHRHRAATRLLTLPEEHPLSDRIKDGTRNRRRTHHFSPIHDLMARYGLR
# PNHMGKATRGPIRSLLGPKLTVNIWEDKSEALKAYGEDGTALKIFTDGSGFQGYVGASAILYRNGQETNAIRYRLGLTNIMKSMRESAWG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g22
###
# start gene g23
Scaffold_18	AUGUSTUS	gene	194039	194431	0.26	-	.	g23
Scaffold_18	AUGUSTUS	transcript	194039	194431	0.26	-	.	g23.t1
Scaffold_18	AUGUSTUS	stop_codon	194039	194041	.	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_18	AUGUSTUS	CDS	194039	194431	0.26	-	0	transcript_id "g23.t1"; gene_id "g23";
Scaffold_18	AUGUSTUS	start_codon	194429	194431	.	-	0	transcript_id "g23.t1"; gene_id "g23";
# protein sequence = [MKASKRQVTYVPALISSTSLGCFLDSAMNNPVINTPVLGSPKTIFCREGFCDTRRMASFQTLGTCVANVCRDGDLANA
# LVNKSMGPPPAGEEGLLIKGDVGGEVSDTGVEADNGVDVSTEREGRPCETVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g23
###
# start gene g24
Scaffold_18	AUGUSTUS	gene	196657	197931	0.81	-	.	g24
Scaffold_18	AUGUSTUS	transcript	196657	197931	0.81	-	.	g24.t1
Scaffold_18	AUGUSTUS	stop_codon	196657	196659	.	-	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_18	AUGUSTUS	CDS	196657	197060	0.91	-	2	transcript_id "g24.t1"; gene_id "g24";
Scaffold_18	AUGUSTUS	CDS	197202	197931	0.81	-	0	transcript_id "g24.t1"; gene_id "g24";
Scaffold_18	AUGUSTUS	start_codon	197929	197931	.	-	0	transcript_id "g24.t1"; gene_id "g24";
# protein sequence = [MNPGGPPLKGLPVRKPRAQNSKNHSNQKLPSNPSPDSSGSQKKVLGATLTSKSTKPTSVPSSKPFSTSAAPQNAKPSS
# SSLLKVIKGKVQAKKREKRGNKEKNDDDDSMEVDDDENNMDDIGDLDDDVDMDEDENDDEDEDVKPTKQSVVPSKRPKKRAKEDSEIEGEEEEAENNP
# NKRPKKPSASHKGKSPVKKPNKGNEAISETEDDSDSNQEENDKKSTLVKGKGKKIFNQKPAPPKAKVHESETDDDDANDSDNQADRKTPSTSKKLSPK
# GKPASKRQKVEEEEEGDEPEDNDERDDDEEEEGDDDDGGDELASIKGIKPNVLMEDGEEMEVQSQTRFVRLLLLPLLYLVNNSCDCVSSSTYKVKRTW
# DHYYW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g24
###
# start gene g25
Scaffold_18	AUGUSTUS	gene	199409	199807	0.98	-	.	g25
Scaffold_18	AUGUSTUS	transcript	199409	199807	0.98	-	.	g25.t1
Scaffold_18	AUGUSTUS	stop_codon	199409	199411	.	-	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_18	AUGUSTUS	CDS	199409	199807	0.98	-	0	transcript_id "g25.t1"; gene_id "g25";
Scaffold_18	AUGUSTUS	start_codon	199805	199807	.	-	0	transcript_id "g25.t1"; gene_id "g25";
# protein sequence = [MRSLGQNPTDAELQDMINEVDVDGNGTIDFKEFLSMMAKKFKDTDSEEEIRQAFQVFDKDGNGTISAKELKAVMESLG
# ALLGLLKWIIAISDRDVFVDLGEKLSDKEVDAMIQEADLDGDGCINYQGKPLSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g25
###
# start gene g26
Scaffold_18	AUGUSTUS	gene	202811	203407	0.88	-	.	g26
Scaffold_18	AUGUSTUS	transcript	202811	203407	0.88	-	.	g26.t1
Scaffold_18	AUGUSTUS	stop_codon	202811	202813	.	-	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_18	AUGUSTUS	CDS	202811	203407	0.88	-	0	transcript_id "g26.t1"; gene_id "g26";
Scaffold_18	AUGUSTUS	start_codon	203405	203407	.	-	0	transcript_id "g26.t1"; gene_id "g26";
# protein sequence = [MRSLGQNPTEAELQEMVNEVDVDGDGTIDFPEFLSMMARKMKDIDSEEEIKEAFRVFDKDGNGFISAAELRHVMTNLG
# MSRSLSSAMFKCVTFTGEKLTEEEVDEMMREADQDGNGTIDYNGAIQLQFTVAGSNLSFLILEFVKREYFLQDIDNHSNYHLPRSCYQSKPSRPLGFE
# VVKLQYARLSVNPSQIIRSCIT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g26
###
# start gene g27
Scaffold_18	AUGUSTUS	gene	204750	205451	0.7	-	.	g27
Scaffold_18	AUGUSTUS	transcript	204750	205451	0.7	-	.	g27.t1
Scaffold_18	AUGUSTUS	stop_codon	204750	204752	.	-	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_18	AUGUSTUS	CDS	204750	205451	0.7	-	0	transcript_id "g27.t1"; gene_id "g27";
Scaffold_18	AUGUSTUS	start_codon	205449	205451	.	-	0	transcript_id "g27.t1"; gene_id "g27";
# protein sequence = [MYEKATKAYVSTTSPGNTTMGRLNVVREDADALHTLETFAGYTKLLMKKMRSSRRTPDTQRNEFPEASGQYQSDTSDS
# EMFPSSEHITQSTLESRYSFPFSSPSSSSSSYPSPSSAAGQSNDPIPLWQSPTDLPVDRPGFISNTSKSSSSGASSYSSQSYTSGISSFRYGPGTSRD
# VPPAAGQYHPPTRSTTQREYWNDNQDQLTPLPVHHRGGYDAKPSWVSNPSTRIRSLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g27
###
# start gene g28
Scaffold_18	AUGUSTUS	gene	216173	218747	0.13	-	.	g28
Scaffold_18	AUGUSTUS	transcript	216173	218747	0.13	-	.	g28.t1
Scaffold_18	AUGUSTUS	stop_codon	216173	216175	.	-	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_18	AUGUSTUS	CDS	216173	217320	1	-	2	transcript_id "g28.t1"; gene_id "g28";
Scaffold_18	AUGUSTUS	CDS	217435	218117	0.41	-	1	transcript_id "g28.t1"; gene_id "g28";
Scaffold_18	AUGUSTUS	CDS	218177	218662	0.34	-	1	transcript_id "g28.t1"; gene_id "g28";
Scaffold_18	AUGUSTUS	CDS	218722	218747	0.37	-	0	transcript_id "g28.t1"; gene_id "g28";
Scaffold_18	AUGUSTUS	start_codon	218745	218747	.	-	0	transcript_id "g28.t1"; gene_id "g28";
# protein sequence = [MDKLFCTFLDEDCGCNNDGSGSSQDHPPPPPPPPSTSCPTSGSSSASGTYGDLINGLLSSLGLRKRSQDHCESSTPPP
# PHSATPSSSSSSSNDAGSPAPSSGSSAGSDIVADLTPLADADVNLGPGLDGATTGTAAGLGLGKLIHPGHLIDSKRDEDCNCEDGHNSTSTGAIFYWT
# GPSSTPSAGTASGSPSSSAGSSSPSGSVSTCSPGSSPAFSSGSSTGSDIVADLSPLASADADLGLGLNSAVTGTAEGLGLGGIIHSGHLVNGKREEDC
# DGNGSGSSSHYTTIPVTPSSSSLSRTSWPSPTSLPSSSAGDEPCPDDPSAVPNPSGTAGDDLVVDLSPLAKADVNLGPGLDGAIAGLAGGLGLGPIVH
# LGHLVNEKREEDCDCEDGHGSTSTSTGSTSSGSSCPSGSGSNPHPGSSSGSDIVADLSPLASVDVNLGPGLDSAVTGATEGLGLGGIIHSGHLVNGKR
# DEDCDGNGFGFGSHSMSSSPSPTPQSSSSTIWPSPTHSSSSSEGDEPCPDDSDSSAVPKPSGSGSSTGDDLVVDLLPLTEADVNLGTGLDEAVAGLAG
# GVGLGPIIHLGHLVSAKRDQDCDCEDGSGSSSSYHPPPPSPSTPSTGAGSESTSTCPSGPKSVSAQSPGSSSGSDIVADLSPLAKADVNLGPGLNSAT
# TGTAQGLGLGEVIYPGHYVNGKREDCDGNGLSMSSSSPPPPPPSSSGDEPCPDDSGPVPSTGSGNSSGNDIIVDLSPLAEADVDLGPGLNSATTGLAK
# GLGVGQLIYPGHLGKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g28
###
# start gene g29
Scaffold_18	AUGUSTUS	gene	224268	224603	0.94	-	.	g29
Scaffold_18	AUGUSTUS	transcript	224268	224603	0.94	-	.	g29.t1
Scaffold_18	AUGUSTUS	stop_codon	224268	224270	.	-	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_18	AUGUSTUS	CDS	224268	224603	0.94	-	0	transcript_id "g29.t1"; gene_id "g29";
Scaffold_18	AUGUSTUS	start_codon	224601	224603	.	-	0	transcript_id "g29.t1"; gene_id "g29";
# protein sequence = [MVVPKRHGTTAYAVFTKEYMANGLQNKIPVRDLIKTASKEWNALSDAQKQVCYSISHVSPTKLIGSFTSPTPYPSKQT
# RRPSRNDTISGSAHFPLDMFVRSTFRGRRGANT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g29
###
# start gene g30
Scaffold_18	AUGUSTUS	gene	225140	226057	1	+	.	g30
Scaffold_18	AUGUSTUS	transcript	225140	226057	1	+	.	g30.t1
Scaffold_18	AUGUSTUS	start_codon	225140	225142	.	+	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_18	AUGUSTUS	CDS	225140	226057	1	+	0	transcript_id "g30.t1"; gene_id "g30";
Scaffold_18	AUGUSTUS	stop_codon	226055	226057	.	+	0	transcript_id "g30.t1"; gene_id "g30";
# protein sequence = [MSAPVVASELPTFNPSSLPVAQLESLRFKANQIIESIKALQMNIDFHPTAISSWPDILSKYNLLLSQTHNFSSSLSTP
# LPSSVSANGATFVNGTGTGSSTKSSPFEKIALHPRVAVTDIQLDTEIIPLLRNQQTTDVLNVENDIVRRLSEHMVTRGSVGVLSGVPIPPPPSHLHSS
# GTSTFGSTFSAAHLAHRKPEYEDVLQECELIRADHDRRADRAVRAVLLLREKFEWKTRVAVEVEEPEELSWDPAGRRGSTKMSVQAEEEGAESEGDEG
# SSEEDEVEGHLVRDDTEPAVSTQTSGDTDMG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g30
###
# start gene g31
Scaffold_18	AUGUSTUS	gene	227819	229500	0.15	+	.	g31
Scaffold_18	AUGUSTUS	transcript	227819	229500	0.15	+	.	g31.t1
Scaffold_18	AUGUSTUS	start_codon	227819	227821	.	+	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_18	AUGUSTUS	CDS	227819	227983	0.71	+	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_18	AUGUSTUS	CDS	228036	228332	0.2	+	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_18	AUGUSTUS	CDS	228377	228416	0.9	+	0	transcript_id "g31.t1"; gene_id "g31";
Scaffold_18	AUGUSTUS	CDS	228471	228776	0.99	+	2	transcript_id "g31.t1"; gene_id "g31";
Scaffold_18	AUGUSTUS	CDS	229019	229500	1	+	2	transcript_id "g31.t1"; gene_id "g31";
Scaffold_18	AUGUSTUS	stop_codon	229498	229500	.	+	0	transcript_id "g31.t1"; gene_id "g31";
# protein sequence = [MGAEIGATTSMFPFNSRMSDYLNATKRGDIAKYAQQFAHNLKADEGAEYDQHIEINLSELEPHINGPFTPDLATPLSK
# FAEEVKKNNWPEELKVALIGSCTNSSYEDMSRSVSIVKEASAHGLDVKSKFTITPGSEQVRATIERDGHIAAFENVWDRQDVKKGEANSIITSYNRNF
# TGRNDANPATHAFVASPDVVTAMAFGGSLTFNPMTDSLIGSDGKPFTFSEPRGDELPPRGYDPGQDTFQPPPTDRASVSVAVDPRVTVFNCYTQNCLI
# GAINAENNTANKVKNQMTGEYGGVPQTAAYYRDHGIKWVVVGDHNYGEGSSREHAALEPRFLGGLAIIVRSFARIHETNLKKQGMLALTFANPEDYEK
# VKPSDRVDILGLDSFAPGKNLTLVLRHEDGSKEEVPSLIPSMRVKLNGSRPALLLIW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g31
###
# start gene g32
Scaffold_18	AUGUSTUS	gene	261999	263697	0.14	+	.	g32
Scaffold_18	AUGUSTUS	transcript	261999	263697	0.14	+	.	g32.t1
Scaffold_18	AUGUSTUS	start_codon	261999	262001	.	+	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_18	AUGUSTUS	CDS	261999	262307	0.14	+	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_18	AUGUSTUS	CDS	262576	263697	0.99	+	0	transcript_id "g32.t1"; gene_id "g32";
Scaffold_18	AUGUSTUS	stop_codon	263695	263697	.	+	0	transcript_id "g32.t1"; gene_id "g32";
# protein sequence = [MVNDFVQRNHQICVVIDALDECTDQSLVSELIQGISGHIWVVITSRNQPQYVETTGSRVISLDNNFKLNQDIDLYLEA
# RLGTLSFRQNLQAEIKDALEEKVNGSGLCHFLIDLEEQVVEQDGQLNPQLDKIIDTTLVSIDSDGYLQFSHASVKEFLVQSHNVVQTMDLFEVNEVLA
# HDIIAQMCIVYLLQWKKNIMHGSVFLLEDYSNKYWVKHIQFIQENHSGPTTTLRDLTKQILVDQSPQYLHWTHMYFKRSTFLPNCNPLCCAAYLGLMQ
# SAADLIEGGSTDMVNVCGCSLGTPLSAAAVAGNKKMMEFLMSKGAKIDFQYGSALQSVAYHTGNISISKWLLDNGANVNVQVGQFGNALQASVWGHHK
# SMIKLLIEYGANINATGGPYGSALQAAGIMGKEDIVELLLDYGADVHAHYGQLDTALQAAACCGNAKIIELLLKHGANVDAQGGKYGNALKAAVYHGK
# EILYIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g32
###
# start gene g33
Scaffold_18	AUGUSTUS	gene	263795	264502	1	+	.	g33
Scaffold_18	AUGUSTUS	transcript	263795	264502	1	+	.	g33.t1
Scaffold_18	AUGUSTUS	start_codon	263795	263797	.	+	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_18	AUGUSTUS	CDS	263795	264502	1	+	0	transcript_id "g33.t1"; gene_id "g33";
Scaffold_18	AUGUSTUS	stop_codon	264500	264502	.	+	0	transcript_id "g33.t1"; gene_id "g33";
# protein sequence = [MLINYRANVNSHDGKYGNALQAAAYYGKKNIVQLLLDHGAHIDAQGGEYGNALQAAAYGGSENIVQLLLDHGADVNIQ
# GGRYGSALQGAVFNGNESILRMLLRNGANINAQCGGLGSVLRTAIFLGKENILQILLDYGANVNAQCGDCLRTAAFLRKQGIVQLLLDNGADVNIRNH
# ASYTVLRTAAYLGHEEIVKVLLDNGADAQDALQTAQALQKTNVGFQRRSIVQLLLDYGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g33
###
# start gene g34
Scaffold_18	AUGUSTUS	gene	265123	265524	0.51	+	.	g34
Scaffold_18	AUGUSTUS	transcript	265123	265524	0.51	+	.	g34.t1
Scaffold_18	AUGUSTUS	start_codon	265123	265125	.	+	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_18	AUGUSTUS	CDS	265123	265524	0.51	+	0	transcript_id "g34.t1"; gene_id "g34";
Scaffold_18	AUGUSTUS	stop_codon	265522	265524	.	+	0	transcript_id "g34.t1"; gene_id "g34";
# protein sequence = [MAGVPPLGDAEDNEPLAGGPSVFFNEWIPLPWIEARRSPRPGWGAGKPKEGGGGGTPEAPGGGGGGGGGGGAPVRAPD
# GGGGGGGGGGGGAAEPAAGGGGGGGGGGPDEGGGGLLGGAGGCDDAGRAGGGGGT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g34
###
# start gene g35
Scaffold_18	AUGUSTUS	gene	267328	268837	0.6	-	.	g35
Scaffold_18	AUGUSTUS	transcript	267328	268837	0.6	-	.	g35.t1
Scaffold_18	AUGUSTUS	stop_codon	267328	267330	.	-	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_18	AUGUSTUS	CDS	267328	267763	0.71	-	1	transcript_id "g35.t1"; gene_id "g35";
Scaffold_18	AUGUSTUS	CDS	267883	268216	0.74	-	2	transcript_id "g35.t1"; gene_id "g35";
Scaffold_18	AUGUSTUS	CDS	268282	268837	0.81	-	0	transcript_id "g35.t1"; gene_id "g35";
Scaffold_18	AUGUSTUS	start_codon	268835	268837	.	-	0	transcript_id "g35.t1"; gene_id "g35";
# protein sequence = [MFSPPSTFSPGPSTPFLPNPQSIGPFSPSSSFGMFSPTGALPGGMPFASPHLGSTGMMSPLSPHSPYLPYPTYATFGG
# FSQGQNQANGSGNPSNGGTMHPMQFLNMLNNTGKGNGASAGSGTEPGGAMSTLSTMSSLNSVTTDSTDSMSPEMTSSPSPAPGTSREEEEKEDGVWLV
# PEMATVSWVVSGVSGTASPKGEIGKEGEGPGENKNNYDSDPEHDIDGEVNELLAGSILKRPESMVGLRRSGSGGSSKSKAKEKLQMSPMKDVGFGNEV
# RDGQQFSDDGLSVASPSSDSGVSSPPPSRLPFTSTTTPNEIDLDADIYSSSSSSSNKSLSESASTESSDSVAETPPIEFTFPSISTWGYSYRTHSAGD
# PNGREQALRTSTDVEATEDPVLEKHATTTTLIHDTDNRGRDHAASGQIESNEYRVRARLIRYYVYRHSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g35
###
# start gene g36
Scaffold_18	AUGUSTUS	gene	269622	270089	0.64	-	.	g36
Scaffold_18	AUGUSTUS	transcript	269622	270089	0.64	-	.	g36.t1
Scaffold_18	AUGUSTUS	stop_codon	269622	269624	.	-	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_18	AUGUSTUS	CDS	269622	270089	0.64	-	0	transcript_id "g36.t1"; gene_id "g36";
Scaffold_18	AUGUSTUS	start_codon	270087	270089	.	-	0	transcript_id "g36.t1"; gene_id "g36";
# protein sequence = [MFSMSYADTTDTSVQSAKCLDLNPALDEERFESIPSSNTPLPKSTSKNIRRKNSNNDKNSSLDNFATNKLNITHGTDV
# SPAILTSSQSMPSSSSYTRSDQSKDTIDISSSTLNVISAPSRAGKPPRFRSQTRQRTQHRAGNILIWSRIFNLDADP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g36
###
# start gene g37
Scaffold_18	AUGUSTUS	gene	270146	270652	0.84	-	.	g37
Scaffold_18	AUGUSTUS	transcript	270146	270652	0.84	-	.	g37.t1
Scaffold_18	AUGUSTUS	stop_codon	270146	270148	.	-	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_18	AUGUSTUS	CDS	270146	270652	0.84	-	0	transcript_id "g37.t1"; gene_id "g37";
Scaffold_18	AUGUSTUS	start_codon	270650	270652	.	-	0	transcript_id "g37.t1"; gene_id "g37";
# protein sequence = [MSNFRTFIRDIFTDIHEDSNFNDASKLQTSRSKERRKRRKDPMKELTKGGKKAKDLAKLLKHVDLPGPSDPSSSSVPN
# SGLHSDFVPAQAPQEPSSNSITSNRNRSGSHSESGTRDFSASLSSRSVSICSAAGASARSGQSGDDHEEQDQEEEIPLTAMPPSPALPRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g37
###
# start gene g38
Scaffold_18	AUGUSTUS	gene	273115	273645	0.87	-	.	g38
Scaffold_18	AUGUSTUS	transcript	273115	273645	0.87	-	.	g38.t1
Scaffold_18	AUGUSTUS	stop_codon	273115	273117	.	-	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_18	AUGUSTUS	CDS	273115	273645	0.87	-	0	transcript_id "g38.t1"; gene_id "g38";
Scaffold_18	AUGUSTUS	start_codon	273643	273645	.	-	0	transcript_id "g38.t1"; gene_id "g38";
# protein sequence = [MSDGLQKIQLGFVGLSEEGWPADALAPPLFAPPLSSKYTLVAVSTTNSQSAQASAAKYSQIRNLSEHTKNIVVKPYHG
# SAEHIALDKDVGMVAVAIKPIYQKDAAMEVIKAGKDLFIEWPVGKNLDETKQIFDAARDRGIKTIVGCQMRFAGFALKVCLHLTDEIIGQHEHSYSRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g38
###
# start gene g39
Scaffold_18	AUGUSTUS	gene	275943	276397	0.46	+	.	g39
Scaffold_18	AUGUSTUS	transcript	275943	276397	0.46	+	.	g39.t1
Scaffold_18	AUGUSTUS	start_codon	275943	275945	.	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_18	AUGUSTUS	CDS	275943	276072	0.47	+	0	transcript_id "g39.t1"; gene_id "g39";
Scaffold_18	AUGUSTUS	CDS	276120	276397	0.99	+	2	transcript_id "g39.t1"; gene_id "g39";
Scaffold_18	AUGUSTUS	stop_codon	276395	276397	.	+	0	transcript_id "g39.t1"; gene_id "g39";
# protein sequence = [MRKSLPDELGWEFTMDAYDVVRKMEYPSEEKIDKYDAFMYTGSAASAYADLEWIHRLIEFTAHLAKDHPKVRIFGICF
# GHQIVSLALGGTCVKNDGKWEIGPTKLRLTNIGESVFGIDNELVREAASSVWSVPTA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g39
###
# start gene g40
Scaffold_18	AUGUSTUS	gene	276500	276817	0.91	+	.	g40
Scaffold_18	AUGUSTUS	transcript	276500	276817	0.91	+	.	g40.t1
Scaffold_18	AUGUSTUS	start_codon	276500	276502	.	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_18	AUGUSTUS	CDS	276500	276817	0.91	+	0	transcript_id "g40.t1"; gene_id "g40";
Scaffold_18	AUGUSTUS	stop_codon	276815	276817	.	+	0	transcript_id "g40.t1"; gene_id "g40";
# protein sequence = [MISTYGTDYIYTPTVESRTSSYPLPSSVSDSPSSIPISDVHIITVQGHPEFTRQIVSTMTAKRANQGLITDALKEDVD
# RRNDALGHRVSGDGELVGRVLWKILGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g40
###
# start gene g41
Scaffold_18	AUGUSTUS	gene	278379	278783	0.75	+	.	g41
Scaffold_18	AUGUSTUS	transcript	278379	278783	0.75	+	.	g41.t1
Scaffold_18	AUGUSTUS	start_codon	278379	278381	.	+	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_18	AUGUSTUS	CDS	278379	278783	0.75	+	0	transcript_id "g41.t1"; gene_id "g41";
Scaffold_18	AUGUSTUS	stop_codon	278781	278783	.	+	0	transcript_id "g41.t1"; gene_id "g41";
# protein sequence = [MTFLFLQDGNILMYDLDDPLSLEVSEPQGDEIEPTIISPTLVFEAHDGRAPFVDLLSISHVLSSDSVGSVAFHPISAR
# LLSSSGSRNFDEGSSDSEDSVSDSDDSLMGTATSVSMRRMKKQPSVRDNSLKLWMF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g41
###
# start gene g42
Scaffold_18	AUGUSTUS	gene	280028	280510	0.66	+	.	g42
Scaffold_18	AUGUSTUS	transcript	280028	280510	0.66	+	.	g42.t1
Scaffold_18	AUGUSTUS	start_codon	280028	280030	.	+	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_18	AUGUSTUS	CDS	280028	280510	0.66	+	0	transcript_id "g42.t1"; gene_id "g42";
Scaffold_18	AUGUSTUS	stop_codon	280508	280510	.	+	0	transcript_id "g42.t1"; gene_id "g42";
# protein sequence = [MFISFDMTYDWAEADMVSLVQTYASSSSYYKWNGNPLVSTFDGDAQDNDFWAGFKTDLGNAGITISLAPAFIDYRDPS
# EAMTVFSTYPSIDGFFNWWSWSALQLSVILFRGFILRSRSRRPADVAADLTTATDLAYQAGISTAGRSGPYIMGRLFQRHMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g42
###
# start gene g43
Scaffold_18	AUGUSTUS	gene	285134	285712	0.97	+	.	g43
Scaffold_18	AUGUSTUS	transcript	285134	285712	0.97	+	.	g43.t1
Scaffold_18	AUGUSTUS	start_codon	285134	285136	.	+	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_18	AUGUSTUS	CDS	285134	285712	0.97	+	0	transcript_id "g43.t1"; gene_id "g43";
Scaffold_18	AUGUSTUS	stop_codon	285710	285712	.	+	0	transcript_id "g43.t1"; gene_id "g43";
# protein sequence = [MNISFNPKDTNTFASACLDRTVKIWSISALSSSTSSPQANFTLEAHEKGVNYVDFYPGNDKPYLVTCGDDKTVKVWDY
# LSKSCVQTMEGHTNNVSFAVFHPSLPVIISGSEDGTVKIWNSNTYRIENTLSYALERAWCVALHRTANEVAVGYDEGVVVIKLGKDEPTFSVDSSGKM
# IYTKSSAVLSANLTLV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g43
###
# start gene g44
Scaffold_18	AUGUSTUS	gene	298291	302882	0.87	+	.	g44
Scaffold_18	AUGUSTUS	transcript	298291	302882	0.87	+	.	g44.t1
Scaffold_18	AUGUSTUS	start_codon	298291	298293	.	+	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_18	AUGUSTUS	CDS	298291	298629	0.87	+	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_18	AUGUSTUS	CDS	298737	302882	0.96	+	0	transcript_id "g44.t1"; gene_id "g44";
Scaffold_18	AUGUSTUS	stop_codon	302880	302882	.	+	0	transcript_id "g44.t1"; gene_id "g44";
# protein sequence = [MELQNTLHAIIHDLVEKKHHIFIIIDALDECRESASVAVFVAGIADNTWIAFTSRYNAEYSLKYKPLEIVMNSGNLNQ
# DINIYMEAEMSNLYFSEGFKDEVKGTLQTKADGRSSVKRAVQTLPPDLEQTYIQAIQKCKQSHESVNAHHILLWLLYAFEPLNKNQLTAMLSIDLQEQ
# VVHPSDGMNLRLEKIIDSTLVTINSDDVIQLAHASVKELLLNRQIFVQTKYLFEINELLAHRTIAQMCLIYLLQWKDMENAEIMRNVMTLGEYTIQYW
# ADHTSLTQEASESHSLGSSLDHLVKEFFQNENLQFWHWTQRYRHSIHFWETPLHGSNPLYCAAYFGLESSVSDLIVQQSANSINKIVGELGTPLSAAA
# YSGKKCIVELLVDYGADVNAQGGKYGNALQVAALRGKEDVVRYLLEKDADINAQEGEYGSALQAATYMGNKSIVKYLLNHGAIVNSQGGEFGTALLAA
# IIESHEDIVKLLIENGANVNIQNEYEYGHALQAASFVGNINIVKYLIERGANINAYGGGYGSALQAAAYGGHKYIVKYLLDHGAIVNAQGGEYGNALL
# AATFKNQEDIVEILIDNGANVNIIDGHEYGSALQVAASEGNMNIIQLLIKKGADININGGGTGHVNALQAAAYNGNKDIVKYLIDQGSNVNAKGGKYG
# NALQAGAHRGNMNIVKYLVANGVDINAQGGKYANPLLAAVHGEHEDIVKYLIENGADINAGGGQYGSALQVAAYEGNTNIVAYLLSCGANVNTQGGEY
# GNALLAAVLQNHENVVENLIENGADVNAQNSEYGHALQAAILSGNVNIVTALLNSGADVNVQGGRFGNALQAAAYERNINMVEYLVKNGANVNAQGGK
# YGNALIAAVIRNHENVVEYLLDNGANVNASSGGHGTALQVAVYKGNYSIVKYLIDHGAYINADGGQYGNALHVAAYRGHKLYFPILHEISVFERRAGW
# ENAPRVADSLNDMNIVKCLLENGAHINVQAGEYGTALQAAAYAGKKDIVIYLLDHGADINAQGGKYGNALQAATTENNEDIIIYLIDHGANVNAQSNE
# QGTALQAAALNGNENIIRYIIKNGADVNAQGGEYGSALQAAAYDGSRDILEYLIDQGANVMVQGGQYGNALQAAAYRGNGIIVEYLIEQGADINVQGG
# KYGNALQAAAYGGFEDIIKYLLDHGADINAQSGEYGNALQAAAIGGNVACVDYLTKNGANVNAQGGYFGNALQAAAYKSNENLVRYLLDNGAEINAQS
# GKYGNALQAAAYWGNESILNCLLQHGASINAHGGHFGSALQAAVIEGNENIVRYLIDNGADVNVQGDQFGNAIQAAAFSGNEDIVKCLFNAGADINTQ
# TPDQADALQAAAWGGHENVVRYLIAEGADVNNQSGPFGNTLQAAAFKGNENIVKYLLENGADVNTQGGNFGNALQAAAFMGRENIVRSLLDAGADVNV
# QGGEHEHALLAARNSSELSSDSQRESIIHLLLEHGAIDTEAFES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g44
###
# start gene g45
Scaffold_18	AUGUSTUS	gene	303163	304610	0.32	-	.	g45
Scaffold_18	AUGUSTUS	transcript	303163	304610	0.32	-	.	g45.t1
Scaffold_18	AUGUSTUS	stop_codon	303163	303165	.	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_18	AUGUSTUS	CDS	303163	304122	0.92	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_18	AUGUSTUS	CDS	304188	304434	0.37	-	1	transcript_id "g45.t1"; gene_id "g45";
Scaffold_18	AUGUSTUS	CDS	304558	304610	0.33	-	0	transcript_id "g45.t1"; gene_id "g45";
Scaffold_18	AUGUSTUS	start_codon	304608	304610	.	-	0	transcript_id "g45.t1"; gene_id "g45";
# protein sequence = [MAVYQATTSAPVNIACIKYWGKRDTTLILPTNSSLSVTLSQDHLRSTTTSRADPAFTETKLWLNGKEEDIKSGGRLER
# CLKELKKMRKERIEDKEPNAPKLSEWNIHVASYNNFPTAAGLASSASGFAALTSSIAALYGLNTFPSSSSAKPSIASPSELSLVARLGSGSACRSLFG
# GFVAWEAGSLPSGTDSLAVEVAPQSHWPTMHALICVVNDAKKGTSSTSGMQRTVETSALLQHRIKHVVPQRMEAIIKAIKEKNFDSFAKITMADSNQF
# HAVALDTAPPIFYMNDVSRSIISIIEELNRVSLEKTGHLLAAYTFDAGPNAVIYTEEKNVKQIIEIIVRYFPQAESNPFPDPFKLFGGKQPAAVPLPE
# GFNENVAKVWEVGSVKGLIHTSIGDGPRVLAEGETLLGVDGLPKTLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g45
###
# start gene g46
Scaffold_18	AUGUSTUS	gene	307049	309409	0.67	-	.	g46
Scaffold_18	AUGUSTUS	transcript	307049	309409	0.67	-	.	g46.t1
Scaffold_18	AUGUSTUS	stop_codon	307049	307051	.	-	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_18	AUGUSTUS	CDS	307049	308609	1	-	1	transcript_id "g46.t1"; gene_id "g46";
Scaffold_18	AUGUSTUS	CDS	308697	309409	0.67	-	0	transcript_id "g46.t1"; gene_id "g46";
Scaffold_18	AUGUSTUS	start_codon	309407	309409	.	-	0	transcript_id "g46.t1"; gene_id "g46";
# protein sequence = [MLRKLFTSELKWSDYQFDEIVGETTSYSLLQIYHEGLYEMHPLVQKWCIDNSNNRHKQGVQGIVAIALQNISWENHQF
# LQYMSSHCMVLQSQGNSDYVVSLAFGELWNALGQYHQALELWVPLVEVFKDHLGPLSIDSLNHMDLVASVYLKSGRYNEALEMQEYLYETCKRGFGQE
# HPNTLVWKAGVAIILEKMGRYNESLYLGQPLLETLKKVLGEEHPDTLNRMQHVALTLKQLGRIQYLAVTLGHVGRYNEALDLQQALLETAKRVFGQEH
# PDTLTKIEGLTYTLIQLERFNEVLDLQEPLLESSKRVLGEGHPDTLTRMHNLALALLYLGRNVEALALVQPLLEISTRVLGEEHPATLFRMNSLADIF
# GQMGLHDEALDIKQSLLETSKRVLGDEHPDTLNKIQSLARTFGKLDQYNEALNLQQFLVESSKRVLGEEHPDTLDRIQTLAYTFTKLSRYNEALDLQQ
# SLLETSKKILGQDHPDTLTQIQNLAVTLEDVGRNVEALDLEQSLFETSKRVLGEEHSDTLIRMENLAQTFWDLNRKSDALDLEQSLLEISKKVLGEEH
# PITLERMQNTASTFAQLGRNNEALELGQYLLVTKKRVLGEEHPDTLRSMQNLSSTFRHLNRCNEALNLQQPLVETSKRVLGEEHPDTLNRMHNMVKTF
# RQLGRYNEALDLQQLLLEISKKVMGEEHRDTLVEIQNLAQTFWDLGRQSDALELAQTLPPALRNFLDKETHINPPMANHNLLRMKKRFGKQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g46
###
# start gene g47
Scaffold_18	AUGUSTUS	gene	309622	310372	0.4	-	.	g47
Scaffold_18	AUGUSTUS	transcript	309622	310372	0.4	-	.	g47.t1
Scaffold_18	AUGUSTUS	stop_codon	309622	309624	.	-	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_18	AUGUSTUS	CDS	309622	310126	0.62	-	1	transcript_id "g47.t1"; gene_id "g47";
Scaffold_18	AUGUSTUS	CDS	310248	310372	0.4	-	0	transcript_id "g47.t1"; gene_id "g47";
Scaffold_18	AUGUSTUS	start_codon	310370	310372	.	-	0	transcript_id "g47.t1"; gene_id "g47";
# protein sequence = [MTHCPTSTSKFTGREDILATLDLFFNSSLPNNSRGIQKCFLLFTKIYFITANTEDSIQASFYDIAMDNGVVDAQEWKS
# GLHWLLTHEEPWLIIMDNADDPKISLERYFPSCDHGNIMITSRNAELQNVVGQSLELQDMIPDDGIELLLKHAVDKPLSSNEQEQVVQIAKELYYFPL
# ALVQAGAYIKQQKCLLTYLKFLRNEHKQLLEKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g47
###
# start gene g48
Scaffold_18	AUGUSTUS	gene	321583	321942	0.57	-	.	g48
Scaffold_18	AUGUSTUS	transcript	321583	321942	0.57	-	.	g48.t1
Scaffold_18	AUGUSTUS	stop_codon	321583	321585	.	-	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_18	AUGUSTUS	CDS	321583	321942	0.57	-	0	transcript_id "g48.t1"; gene_id "g48";
Scaffold_18	AUGUSTUS	start_codon	321940	321942	.	-	0	transcript_id "g48.t1"; gene_id "g48";
# protein sequence = [MVRSVLTCLTLHLVQLIPDHLRLAGANGSIFAIGDCTSTSYAPTAQVASQQGAYLARVFAQMAKKETLTAKLTQLEQA
# SVTVTDPEEKAKFDSDIGTTKKLISNVKVRPFNYSHQGSLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g48
###
# start gene g49
Scaffold_18	AUGUSTUS	gene	324080	324445	0.68	-	.	g49
Scaffold_18	AUGUSTUS	transcript	324080	324445	0.68	-	.	g49.t1
Scaffold_18	AUGUSTUS	stop_codon	324080	324082	.	-	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_18	AUGUSTUS	CDS	324080	324445	0.68	-	0	transcript_id "g49.t1"; gene_id "g49";
Scaffold_18	AUGUSTUS	start_codon	324443	324445	.	-	0	transcript_id "g49.t1"; gene_id "g49";
# protein sequence = [MNIQVIDELGQWPSGTTAPNVIVSTIPASETSFEDEPDRLFYPASLYSYRDGPAIVLDLAYKPVETPLLKLAKMTASN
# WDTAQGVEVLLQQGYAQFEKWTSRKCPQGIVSRKVWEVYYNRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g49
###
# start gene g50
Scaffold_18	AUGUSTUS	gene	324505	325632	0.77	-	.	g50
Scaffold_18	AUGUSTUS	transcript	324505	325632	0.77	-	.	g50.t1
Scaffold_18	AUGUSTUS	stop_codon	324505	324507	.	-	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_18	AUGUSTUS	CDS	324505	325632	0.77	-	0	transcript_id "g50.t1"; gene_id "g50";
Scaffold_18	AUGUSTUS	start_codon	325630	325632	.	-	0	transcript_id "g50.t1"; gene_id "g50";
# protein sequence = [MLALPKLEELSAGVDALEVRVDLLRSKEDIEPLGKHIPSETYVADQIAALRRVTSLPIIFTVRTVSEGGAFPDHAQKE
# AFSLLKLALSLGVEYLDVEMQLPEQTIKQLVARKGATQFIASWHDWSGRLKWNSPEAQAMYNIAAQNGDIVKMVFTASTMQDNFDCQAFALKMNGRPG
# AKPFIAINMGAVGQLSRILNTTFSPVSHPLQPSRAAPGQISFAQVQKALHLIELPAKKFYLFGNPIDHSLSPTLHNNAFETLGLPHTYELLETAEVGE
# DIKNTIASPDFGGASVTIPHKLNIIPLLDTPAAKVMGAVNTIIPTNDGATRILVGDNTDWLGIRGSIAARVAVGQIHAALVIGAGVLLVQLSMHSMIW
# APR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g50
###
# start gene g51
Scaffold_18	AUGUSTUS	gene	326648	328638	0.23	-	.	g51
Scaffold_18	AUGUSTUS	transcript	326648	328638	0.23	-	.	g51.t1
Scaffold_18	AUGUSTUS	stop_codon	326648	326650	.	-	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_18	AUGUSTUS	CDS	326648	327595	0.95	-	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_18	AUGUSTUS	CDS	327764	328318	0.24	-	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_18	AUGUSTUS	CDS	328483	328638	0.58	-	0	transcript_id "g51.t1"; gene_id "g51";
Scaffold_18	AUGUSTUS	start_codon	328636	328638	.	-	0	transcript_id "g51.t1"; gene_id "g51";
# protein sequence = [MVDSSVGGKTAIDTPHGKNLIGAFWQPEFIFIDAALLETLPSREFSNGMAEVTRSDAQKLLLSVIIGSISVKAHIVTI
# DPTEKGLRNLVNFGHSIGHAIEAILTPTILHGECVSIGMILEAELSRQMGILSQVSVGRLTRCLKAYNLPVSLADPRIANLPSAKLITTERLLDIMKV
# DKKNQGNDKKIVLLSRIGATYEQKASVVPDGLISKTLSESVTVVPGIPSFNPVKMTTQDPKGAKFEWEDGGETLVVHGGNGSLSVPPKGKEIYLGNAG
# TAARFLTTVCTLVQKPPTGESETTVITGNARMKQRPIGPLVAALRANGSEISYLESDGCLPLSIRPNGLSGGIIQLAASVSSQYVSSVLLCAPYANEP
# VTLELIGGQVISQPYIDMTVAMMKTFGIEVIRRVEKDTGKLLDIYDIPKGSYQNPSDYSIESDASSATYPLAIAAITGTSCTIQNIGSSSLQGDAKFA
# REVLERMGCEVNQTATETTVQGPPIGQLKAVEEIDMEVMTDAFLTATVLAAVASGKTRIIGIANQRVKECNRIRAMIDELGT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g51
###
# start gene g52
Scaffold_18	AUGUSTUS	gene	331777	333072	0.55	-	.	g52
Scaffold_18	AUGUSTUS	transcript	331777	333072	0.55	-	.	g52.t1
Scaffold_18	AUGUSTUS	stop_codon	331777	331779	.	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_18	AUGUSTUS	CDS	331777	332454	0.95	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_18	AUGUSTUS	CDS	332538	332882	0.57	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_18	AUGUSTUS	CDS	332950	333072	0.72	-	0	transcript_id "g52.t1"; gene_id "g52";
Scaffold_18	AUGUSTUS	start_codon	333070	333072	.	-	0	transcript_id "g52.t1"; gene_id "g52";
# protein sequence = [MTSIILDPGVKELLLKDARDFLESKAWYSERGIPYRRGYLLWGAPGSGKSSLIHALAGELGLDVYVLSLGKAGLDDSS
# LNGLINQLPERCIALMEDVDAVFTHGLSRDSDAVDALANLPNPSRSPTTSTPAPSNNRVTLSGLLNALDGQFDFLNVSLDKLSDYSYLGRILFATTNK
# YSSLDSALRRPGRMDVHIEFKLASKYQARELFLRFFNPRNTPKIVEDNETDSGDYIGSADSGYASTHDTQLTVHSSFRENKLPIEKLKLLADDFAEAI
# PEYGFSMAALQGYLMMYKTQPLEAVEQIGAWLQKEKEEHATKNQEAQTKKVGSLEEEKETLEQEVTKRVEKAVRERLEREKLEKELMEKVEREMTTKV
# ESWLIERPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g52
###
# start gene g53
Scaffold_18	AUGUSTUS	gene	336610	337217	0.68	+	.	g53
Scaffold_18	AUGUSTUS	transcript	336610	337217	0.68	+	.	g53.t1
Scaffold_18	AUGUSTUS	start_codon	336610	336612	.	+	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_18	AUGUSTUS	CDS	336610	336969	0.94	+	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_18	AUGUSTUS	CDS	337026	337217	0.68	+	0	transcript_id "g53.t1"; gene_id "g53";
Scaffold_18	AUGUSTUS	stop_codon	337215	337217	.	+	0	transcript_id "g53.t1"; gene_id "g53";
# protein sequence = [MISYSTCSPKVHAKGAGAHGYFEVTHDLSDITDNALLKSVGKRVRTTARFSTVGGESGSADTARDPRGFAIKLRTEEG
# NWDWVMNNTPVFFIRDPSKFPHFIHTQKRDPQTHLKDADMFWDYLGQNPESIHQIMILFSDRGTPDGFHNMHGYSGHTHKWFKADGSFVYTQLHVRAD
# GGFKVIN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g53
###
# start gene g54
Scaffold_18	AUGUSTUS	gene	341706	342071	0.54	+	.	g54
Scaffold_18	AUGUSTUS	transcript	341706	342071	0.54	+	.	g54.t1
Scaffold_18	AUGUSTUS	start_codon	341706	341708	.	+	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_18	AUGUSTUS	CDS	341706	342071	0.54	+	0	transcript_id "g54.t1"; gene_id "g54";
Scaffold_18	AUGUSTUS	stop_codon	342069	342071	.	+	0	transcript_id "g54.t1"; gene_id "g54";
# protein sequence = [MVYATAMIVELFVRALLADLLLSSTNIPPTTFSVARYLKALSSPNKMSVPPTYIVHGDKDLKVPVEQSRNIVEALKDL
# QKTHVDVEYEYEELPGLDHLFDREPKSQMENMYTFIQNVFNSQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g54
###
# start gene g55
Scaffold_18	AUGUSTUS	gene	343077	344276	0.75	-	.	g55
Scaffold_18	AUGUSTUS	transcript	343077	344276	0.75	-	.	g55.t1
Scaffold_18	AUGUSTUS	stop_codon	343077	343079	.	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_18	AUGUSTUS	CDS	343077	344276	0.75	-	0	transcript_id "g55.t1"; gene_id "g55";
Scaffold_18	AUGUSTUS	start_codon	344274	344276	.	-	0	transcript_id "g55.t1"; gene_id "g55";
# protein sequence = [MCITYLLQWKSTILHSDDFPLEQYAIKYWANHVEIIEQAAAGVSSSEDSLKQLTKEILEDKSSQFLHWTRFNLGTGVS
# MDGSSPLYCAAFHGLIQSTASLIVGTNQVQIDEPSGELGTALSAAAYSGKKSIVELLLMNGANPNIQHGLYGTALQAAAYRGNENIVQLLLDNGAEVD
# SHSGKYGNALQAACMGKQNIVKYLLKRGADINANGGEYGNALQTAAFWGNKAIVQLLLENGVNVNAQSGYPLQAAVLWGNKTIVKLLLNNGTNVNIQG
# GKYGNALQAAALRGDKSIYKFLHEKGADVNADCGQYENALRGAAYIGDADIVKLLLEKGANVNLKGGQYGNALQAAAFRGNQHVFELLISHGADVNAQ
# GGEYGNALQAAALNATENMVKDLLKWG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g55
###
# start gene g56
Scaffold_18	AUGUSTUS	gene	348689	352189	0.24	-	.	g56
Scaffold_18	AUGUSTUS	transcript	348689	352189	0.24	-	.	g56.t1
Scaffold_18	AUGUSTUS	stop_codon	348689	348691	.	-	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_18	AUGUSTUS	CDS	348689	349161	0.95	-	2	transcript_id "g56.t1"; gene_id "g56";
Scaffold_18	AUGUSTUS	CDS	349303	349593	0.77	-	2	transcript_id "g56.t1"; gene_id "g56";
Scaffold_18	AUGUSTUS	CDS	350095	352189	0.26	-	0	transcript_id "g56.t1"; gene_id "g56";
Scaffold_18	AUGUSTUS	start_codon	352187	352189	.	-	0	transcript_id "g56.t1"; gene_id "g56";
# protein sequence = [MDHTVTDYSSLIQKKDDRIAELLQELEQLAVEHQQASKEILELQSDLDTLAVELDAEKADRAQGDVSRARSQAELDEL
# RTLLETKTSEETRRNEVEKSKDLELTNLRSQVVKMQQELTDTRHSALEIQGKLKVDLEQSARDLVSLQGSYDNLVQQESAAQSTVAETHFAISELEKG
# KRGLESELQSLRSRMFESETALAEVQKAKEVSRLNLSFLYPTAYHSFADIQSLDRQLSAAQNKYHGIEDVMLQLERDKTARERQLENIKKQLESETTR
# RSQVEKALSAQKTEIAKLKDHNVKVDRDLNKALKDLKDREWDIKQLESKQDKTIVEHVHVLEEAKRVTDRQLADAQEELQKNAAYIRSLEKAKIRLTS
# EAEDLLRETERERMELRGKEKAVRNQEDRVARAVIDVEQERKARQEVELQVRRLQSELQNTSRHAEELSQQLLITQQSKESLEAELDHLVDETPAADS
# LAKIQRQYQARIVQLEDQVSMSDDARLAALRRLSERIQRQHADIRKLITDTGPSDSTFQSRLLHELQLLDDELKSDLSSRNVPSSKHDARLSTPSSKS
# KRNPSREAPRDITKSSDGQVVALKQQVQVLELQMAASERVRHHLETSIREMTADLENSDGSKQFLQQYRSRLAKENKRLAELLEEEAEARRSAEAAQI
# DGIQAVWSKFQKTIDEERQSYARLEETRKALVICPHPDFCLVVRRTLSEIEKAQTDTVAKLKSNEDLLRAAHQRIKELDKKLQEEGNDSIDLVELNQR
# LAEELEDEKTQHQKDLEEHEFASNQTRKKYQELQSQRDALTRLREDNRKIRSDYDELQLRFDDEVYSSGGWRKEKERLETKIHDVSKAYEASTAAQTE
# QQSQIVSLHSQVRELRGVLDDVEADRALLQKARRALQAELEGIKLDHVDTHKLSTDQTVPEIVSTKARSGEVIGRARRQSGECFRSHEKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g56
###
# start gene g57
Scaffold_18	AUGUSTUS	gene	352292	354070	0.5	-	.	g57
Scaffold_18	AUGUSTUS	transcript	352292	354070	0.5	-	.	g57.t1
Scaffold_18	AUGUSTUS	stop_codon	352292	352294	.	-	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_18	AUGUSTUS	CDS	352292	352920	0.99	-	2	transcript_id "g57.t1"; gene_id "g57";
Scaffold_18	AUGUSTUS	CDS	352978	354070	0.5	-	0	transcript_id "g57.t1"; gene_id "g57";
Scaffold_18	AUGUSTUS	start_codon	354068	354070	.	-	0	transcript_id "g57.t1"; gene_id "g57";
# protein sequence = [MFVLEQEEYSREGIKWDYVNFGLDLQPTIDLIESSGSAGAIGILSCLDEECIMPKATDATFTHKLHSLWAGVGGDPDD
# PQQSHPGREKYEPARFEQGFLVQHYAAKVEYRTDGWLEKNKDPLNDNLTRVFASSTERYVSSLFADHVNTPISGTQTNMFSVGKKRGIKRGAFRTVGQ
# RHKEQLASLMGQLMATQPHFVRCIVPNTNKKPGRVDVPLVLDQLRCNGVLEGIRIARLGYPNRLPFVEFRQRYEVLTPGIIPKGYMDGREACRRMVGA
# LELDEAIFKIGMSKIFFKAGVLADLEERRDMLLFDLFSKLQAVARMWTARRQIKKILNRAVAIRTIQRNARVYGELRDWPWWQLYTKVRMSTRSDEEL
# RRKEAELVLHKERAERDKQEREALENLKMTLEAEKNKVEDQLEAERALNLDKDTLLERSKKHEAELEEEVAELQADIDDLQSHLDRAMTMAKDSEQRH
# AEQRDMFDQAAEHLVRLENEQKQMRLHEEETLAELANQNEEIERLHNDLETLQKVSEDLKRLAVQREEDLSRARDRTDIAVKELEGKLEVEMRNKWVF
# ESAQN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g57
###
# start gene g58
Scaffold_18	AUGUSTUS	gene	356431	357225	0.86	-	.	g58
Scaffold_18	AUGUSTUS	transcript	356431	357225	0.86	-	.	g58.t1
Scaffold_18	AUGUSTUS	stop_codon	356431	356433	.	-	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_18	AUGUSTUS	CDS	356431	357225	0.86	-	0	transcript_id "g58.t1"; gene_id "g58";
Scaffold_18	AUGUSTUS	start_codon	357223	357225	.	-	0	transcript_id "g58.t1"; gene_id "g58";
# protein sequence = [MMRKFDEENFEEAEAQAFKCWTPTVVPSEVRELFTLYSLSKPSSSTSSSFAALISALSQFVQNNPASPQYTSGLLPLT
# SSLPDMKSSTEEYVKLQKLYRAQSEKEKQVFKDYLSKRQVDVDDVTIDVFLKNSHALKVLKGREWKDINPGSKELLGEPVSLLEIHASFDSFRKSRAD
# HWSFFAADKLSTNPKEAAIHLALAAARKLRAQGVLPLLDPTSGPNNTSIKGILDQKNLKDLLTAEVRTFLPPGTELPEADWSIISGEM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g58
###
# start gene g59
Scaffold_18	AUGUSTUS	gene	357490	358137	0.82	-	.	g59
Scaffold_18	AUGUSTUS	transcript	357490	358137	0.82	-	.	g59.t1
Scaffold_18	AUGUSTUS	stop_codon	357490	357492	.	-	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_18	AUGUSTUS	CDS	357490	358137	0.82	-	0	transcript_id "g59.t1"; gene_id "g59";
Scaffold_18	AUGUSTUS	start_codon	358135	358137	.	-	0	transcript_id "g59.t1"; gene_id "g59";
# protein sequence = [MNDSQPLETATTSIQAPSGAPDAKTRRYDRQLRLWAASGQAALESARILVIPATATATSILKNLVLPGLGHFTVMDDK
# AVTGADAGNNFFLDGSKSIGKSRAEEAVKGLMEMNDGVEGVADVRDIDEVLKNDQGWLKSFNIVVAHNVDSDVLDDLAALLWPETHLVVVNSAGFLAE
# FSVHYREHQGNNRSACGYMNHLPIISHRISFGNFCVFTD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g59
###
# start gene g60
Scaffold_18	AUGUSTUS	gene	358363	359733	0.52	-	.	g60
Scaffold_18	AUGUSTUS	transcript	358363	359733	0.52	-	.	g60.t1
Scaffold_18	AUGUSTUS	stop_codon	358363	358365	.	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_18	AUGUSTUS	CDS	358363	358947	1	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_18	AUGUSTUS	CDS	359033	359188	0.54	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_18	AUGUSTUS	CDS	359261	359599	0.98	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_18	AUGUSTUS	CDS	359725	359733	0.99	-	0	transcript_id "g60.t1"; gene_id "g60";
Scaffold_18	AUGUSTUS	start_codon	359731	359733	.	-	0	transcript_id "g60.t1"; gene_id "g60";
# protein sequence = [MTFWNGGWPVELTTDSTGSSSNSLSSTLKNLLGVNTTTNAIGKFSNLLGTGETSSSSDTASGLLSLEDALSNFIGSTD
# SDSQFLNASIGNTSNNVYIAAVSPWFFTHFGKNSFNKNHLYSKRWESLIPAQVPLGTDSDLNATSIQPSISEQVDIVEIISWNDYGESHYMMLNGPNF
# FKFSDVAWLSLTSYYASAFKAGTYPSVSSNEERVVVWSRTHPASADATSDTVGSVPGSELVRGHLSVYYEPFPNNDVQVLDAMWAVTLLSQPANVTLQ
# IIPSSSNSSTDSPLAQQSFSVPAGLSKLTIPISVPDTMDSVSMRTVVERENDTVMDLNAAYMGFAFVKTPQQFNFNAWVGCAGDGCVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g60
###
# start gene g61
Scaffold_18	AUGUSTUS	gene	367053	367604	0.83	-	.	g61
Scaffold_18	AUGUSTUS	transcript	367053	367604	0.83	-	.	g61.t1
Scaffold_18	AUGUSTUS	stop_codon	367053	367055	.	-	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_18	AUGUSTUS	CDS	367053	367604	0.83	-	0	transcript_id "g61.t1"; gene_id "g61";
Scaffold_18	AUGUSTUS	start_codon	367602	367604	.	-	0	transcript_id "g61.t1"; gene_id "g61";
# protein sequence = [MSSPPPLRHPVPTHPAYIPEPPSTPGSPNGYQRFSSSPGPNQQQQPAPLQQQHVPAYMTSPFQHSQQQQQQHSLNPPQ
# LPHQPSFVPQPDFAAWGVNDATAQFGMQLGTSAVAAGQEYVQKNVIVERVCINVLLISFDTVWRNNSSLKRQTPLQRLEFIRYSQTQVSRVSMDAQVM
# VPTCSPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g61
###
# start gene g62
Scaffold_18	AUGUSTUS	gene	369867	370298	0.52	-	.	g62
Scaffold_18	AUGUSTUS	transcript	369867	370298	0.52	-	.	g62.t1
Scaffold_18	AUGUSTUS	stop_codon	369867	369869	.	-	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_18	AUGUSTUS	CDS	369867	370298	0.52	-	0	transcript_id "g62.t1"; gene_id "g62";
Scaffold_18	AUGUSTUS	start_codon	370296	370298	.	-	0	transcript_id "g62.t1"; gene_id "g62";
# protein sequence = [MMRPALTTAFRAAARTPFTARSAPTLVRFAHAHAQESFEQFSARYVSFFQNAEDLFELQRGLNNCFAHDLVPSPEVIE
# AAVKAARRVNDYSTAVRIFEGIKEKVENKVQYEAYLTELKGLREELGAGFIGLSFFNLRLTNLVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g62
###
# start gene g63
Scaffold_18	AUGUSTUS	gene	373011	373310	0.73	-	.	g63
Scaffold_18	AUGUSTUS	transcript	373011	373310	0.73	-	.	g63.t1
Scaffold_18	AUGUSTUS	stop_codon	373011	373013	.	-	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_18	AUGUSTUS	CDS	373011	373310	0.73	-	0	transcript_id "g63.t1"; gene_id "g63";
Scaffold_18	AUGUSTUS	start_codon	373308	373310	.	-	0	transcript_id "g63.t1"; gene_id "g63";
# protein sequence = [MEIYTYASNVVRNGSTILGVQTNNTAIGPNGYVPLNPNGRVILSAGSYGSPRILFLSGIGPSDMLDIVSNDPTYGPQL
# PPQADWIDLPVGYNVSCIAPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g63
###
# start gene g64
Scaffold_18	AUGUSTUS	gene	383419	383898	0.64	+	.	g64
Scaffold_18	AUGUSTUS	transcript	383419	383898	0.64	+	.	g64.t1
Scaffold_18	AUGUSTUS	start_codon	383419	383421	.	+	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_18	AUGUSTUS	CDS	383419	383898	0.64	+	0	transcript_id "g64.t1"; gene_id "g64";
Scaffold_18	AUGUSTUS	stop_codon	383896	383898	.	+	0	transcript_id "g64.t1"; gene_id "g64";
# protein sequence = [MEAKLRELEASKPKHNTEPGTSTLPTSSLPTHPSLPPKPPLTVPNVGVPQSQNPTVSKQSLTASFAPLLRSSSTSNHH
# SPTGSEPLTKKIKLASTSGPPEVAKRKSSGKGLLGVKIVKKWTSPSPMPPSSSDDHIVDHHHNQEPPVSSSSHAPADTRTA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g64
###
# start gene g65
Scaffold_18	AUGUSTUS	gene	385172	386416	0.48	+	.	g65
Scaffold_18	AUGUSTUS	transcript	385172	386416	0.48	+	.	g65.t1
Scaffold_18	AUGUSTUS	start_codon	385172	385174	.	+	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_18	AUGUSTUS	CDS	385172	385807	0.59	+	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_18	AUGUSTUS	CDS	385940	386416	0.57	+	0	transcript_id "g65.t1"; gene_id "g65";
Scaffold_18	AUGUSTUS	stop_codon	386414	386416	.	+	0	transcript_id "g65.t1"; gene_id "g65";
# protein sequence = [MKKYREISSDLQRLTIDFRRWLTFRSACDTNKVNLVYKDLPHPPSGYLALPPFSQTPPVEAPTSYTPGSYVNYAYRSA
# DGSYYNPLIPSMGQAGTPYARSVPGTAQTNLKNLPDPGLVFDTLLKRPTKAEGSGEEEDGFTPHPGGVSSLFFALADLIIHSIFNTKPQNPTVNNTSS
# YLDLSVLYGSSEKEVQSVRRKDDKGRPDGTGRLYEDFVAQRILQINEWNTYKNPESLKAQIDKGSSSAASDEEQTAAAQARIALQAQDDEIFHRSRLV
# NCGFFMKVILGDYVGAILGLARDGSSWRLDPLVEMRRLSHEFSPRGEGNVVSIEFNLLYRWHATLSRQDKKWTEKMFQETLQKDGINVQFDQVNLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g65
###
# start gene g66
Scaffold_18	AUGUSTUS	gene	387003	387606	0.36	+	.	g66
Scaffold_18	AUGUSTUS	transcript	387003	387606	0.36	+	.	g66.t1
Scaffold_18	AUGUSTUS	start_codon	387003	387005	.	+	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_18	AUGUSTUS	CDS	387003	387054	0.42	+	0	transcript_id "g66.t1"; gene_id "g66";
Scaffold_18	AUGUSTUS	CDS	387164	387606	0.5	+	2	transcript_id "g66.t1"; gene_id "g66";
Scaffold_18	AUGUSTUS	stop_codon	387604	387606	.	+	0	transcript_id "g66.t1"; gene_id "g66";
# protein sequence = [MQAEQAKVPGPGAGLCPEICFKFGPPLIAFNLTTWGFADCQYPTAPDGSYGGMLTKLLFRHFPAYYPARSAYAHFPFL
# DPVYMEKELQKRGIADQYIWTRPRPPVGVQEGEVLVINNYEEVTKILSAPQDWRSDYDIKLGTVVAGLKSPNLPDMTLVGTFVTRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g66
###
# start gene g67
Scaffold_18	AUGUSTUS	gene	389519	390885	0.23	+	.	g67
Scaffold_18	AUGUSTUS	transcript	389519	390885	0.23	+	.	g67.t1
Scaffold_18	AUGUSTUS	start_codon	389519	389521	.	+	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_18	AUGUSTUS	CDS	389519	389572	0.57	+	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_18	AUGUSTUS	CDS	389659	390127	0.51	+	0	transcript_id "g67.t1"; gene_id "g67";
Scaffold_18	AUGUSTUS	CDS	390197	390885	0.48	+	2	transcript_id "g67.t1"; gene_id "g67";
Scaffold_18	AUGUSTUS	stop_codon	390883	390885	.	+	0	transcript_id "g67.t1"; gene_id "g67";
# protein sequence = [MLDKRLNDKGKNWRHVFKGSENVVIYFRDNIYVIKTLKEFQYVDEDGKDQGANVRQKAKDITNLLQDESRLRQERRAR
# ASMRDRMIRGATGDGDNEDPDDENDRRRTQEPRASRRNKDEDDLRKAIEESKKSLAQDRMTAEDRDLQQAIKLSEEEEAKRNKAVEDSNASALFDDSN
# NTQINNNPFPTTMTDPMAYTVGLQPQFTQIQPQFTSFNPYQQQMQQMQQEAAQAEFFRQQQELLQQQQAAQQAQLQQEEFMRQQMLFQQQQQQQGLFA
# QQQPLMAQPTGFGFVTHVLHLSYHPDIPNYYRSNNPFAPRPVSSPISQSNTQTPRSSTCKERMITIMQITSRTSVTPPVHFHIHRHLDLRNRKVDDNL
# RSNQRRTKTRSLPICSQIGRVVRIRLEMSDN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g67
###
# start gene g68
Scaffold_18	AUGUSTUS	gene	398204	398995	0.39	+	.	g68
Scaffold_18	AUGUSTUS	transcript	398204	398995	0.39	+	.	g68.t1
Scaffold_18	AUGUSTUS	start_codon	398204	398206	.	+	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_18	AUGUSTUS	CDS	398204	398995	0.39	+	0	transcript_id "g68.t1"; gene_id "g68";
Scaffold_18	AUGUSTUS	stop_codon	398993	398995	.	+	0	transcript_id "g68.t1"; gene_id "g68";
# protein sequence = [MSPPVPLFNYLRSPVLVPPASIRAPSRIASRMNSPHIIDRAPSQIMHQPRPQHLVDLDCISSPSINFHPDLYSAPAIM
# MEFPRDHYEMAHNCPNMTHLIPQWFPGLNHTPHERPYPVFYPNHQYPFPYPVPPEPSCSDTPRFKIEYSSIHWTFLATIKDSDSLKDRKSWVKWNEGV
# WQAVADGFVLGHICDEPSPGTPRTEWNTPLSRLVLPPNPTRKEFEAKLKWDKNDGWTSSILTARLSDEARNHLPPMIDDRGERRTAC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g68
###
# start gene g69
Scaffold_18	AUGUSTUS	gene	401189	402697	0.48	+	.	g69
Scaffold_18	AUGUSTUS	transcript	401189	402697	0.48	+	.	g69.t1
Scaffold_18	AUGUSTUS	start_codon	401189	401191	.	+	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_18	AUGUSTUS	CDS	401189	402697	0.48	+	0	transcript_id "g69.t1"; gene_id "g69";
Scaffold_18	AUGUSTUS	stop_codon	402695	402697	.	+	0	transcript_id "g69.t1"; gene_id "g69";
# protein sequence = [MLVHAGLPLQFWEDAVRTALYIRFRLPTKTLPNNKTPYEMVHKKAPNLSNLRVWGCQCWIQVSEDVRLKFGDKMLEGI
# FVGYEDNRIGWCVRDTKGKDHFSDQVVFNESQFGRLNSPRSTNPAKSIDHSTSVQQTTTSPTPVEHSNPPKGPRPRHTIKLTERGKEWRDGIRKRDEL
# IAERRVHDGLPPNHTTQISNDITGCSLACRITEENLSCLEDDTEFFFAALANIPEPQIPYPTKSTSTSKPRIFDLKKPPSTRREMLQRPDMKDWIAAE
# EKEITGLFELEVFEVTETCPKGKFPIGLKMVYDLKLDGTKKARLVAQGFTQRPEDYGNVHTPVTRMVSYRIVMAWTASMDLELFSFDVKQAFLNAPLM
# EEIYVKQIPGRPISEKPNTVYRLRRALYGLHQASAAWYSTLCEALEELGFTRCECDNAVFIGRWTTSPDPSLTMPVNGDPLIMIIPVHVDDGLVLTNS
# SELYSWFIQKINLRFKVVDLGPTSMFLGIRIY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g69
###
# start gene g70
Scaffold_18	AUGUSTUS	gene	402743	403348	0.66	+	.	g70
Scaffold_18	AUGUSTUS	transcript	402743	403348	0.66	+	.	g70.t1
Scaffold_18	AUGUSTUS	start_codon	402743	402745	.	+	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_18	AUGUSTUS	CDS	402743	403348	0.66	+	0	transcript_id "g70.t1"; gene_id "g70";
Scaffold_18	AUGUSTUS	stop_codon	403346	403348	.	+	0	transcript_id "g70.t1"; gene_id "g70";
# protein sequence = [MELLEQYGLTECVSHDLPLRYKFDGPDLNPSLYADVDSDSLTKIYQALIGCLLFLALCTRLDIAYSVMFLAQFNSKPS
# SRHLIAAKGTLRYLAKTRSWTLQYGGAYRNDLIKTLGITSDMMALSDADWGSNSIDRKSISGFGIFLFGGLVTWSASKQKEYCTIIDRSRIYGSYPRT
# KGTPLDPSIHISSSSSYSTSFSSHI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g70
###
# start gene g71
Scaffold_18	AUGUSTUS	gene	410722	412603	0.2	+	.	g71
Scaffold_18	AUGUSTUS	transcript	410722	412603	0.2	+	.	g71.t1
Scaffold_18	AUGUSTUS	start_codon	410722	410724	.	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_18	AUGUSTUS	CDS	410722	411909	0.23	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_18	AUGUSTUS	CDS	412166	412603	0.23	+	0	transcript_id "g71.t1"; gene_id "g71";
Scaffold_18	AUGUSTUS	stop_codon	412601	412603	.	+	0	transcript_id "g71.t1"; gene_id "g71";
# protein sequence = [MAPERSTSPDPLASYDISPSAPQIALDKAQIASDKPLQRSQTLPSTSHQISLDKGKGRAQPAQSTSYIASRPSPELRS
# VRIRPRTLQERLQVIPEAGTAPQVTGSEHREASIALSTHSHHSSHQIPLQDRISAAPTPPDALEQVRLTAEALGQVVEQYRNNELSPNDAFRALRSLT
# DDPTVVRDFIGQIQEIQRDHLRASRERVAAAKAARVAAAAASKSRISDGPLVSTEKAVNEAAWALMERELAENALQLAAAEAEADQMEQDAHQDRSNS
# LQQALLKLVGQTQSSSSPGTSSGLPPSLLEAAPHLSALTSSDILSPTVSETWKLRMLFTVDSHVDTTVSLLSAQPFTDPLPQSLLKLIVKDRYVDFEK
# IHASITSYTSIFDDSTTFGSEYKLTLLLKELLSARKRPSSSPSTSSASKRRILLVSFGMKGNALPHVQIAASMASVVSVESPTKQLTPNPAMRSLSTV
# DQRVKTALAGPRSLAGTKRAAPESNSGSSNSIPRFRRGYLWSTSSSSSEIIPPSIQSTYTAPPLPSPPEHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g71
###
# start gene g72
Scaffold_18	AUGUSTUS	gene	414942	416968	0.13	-	.	g72
Scaffold_18	AUGUSTUS	transcript	414942	416968	0.13	-	.	g72.t1
Scaffold_18	AUGUSTUS	stop_codon	414942	414944	.	-	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_18	AUGUSTUS	CDS	414942	415603	0.36	-	2	transcript_id "g72.t1"; gene_id "g72";
Scaffold_18	AUGUSTUS	CDS	416414	416773	0.44	-	2	transcript_id "g72.t1"; gene_id "g72";
Scaffold_18	AUGUSTUS	CDS	416833	416968	0.41	-	0	transcript_id "g72.t1"; gene_id "g72";
Scaffold_18	AUGUSTUS	start_codon	416966	416968	.	-	0	transcript_id "g72.t1"; gene_id "g72";
# protein sequence = [MINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHLACYPTAPDLITAISDSDLGGNKDNGKSTTGYIIKI
# GSGAVSWSSKTKPVVTLSSTEAEFVASNAVGKEVLAIRSLLTELGYKVASPTIIHVDNQSSIQVAKNPGTSRTNEAPRSDFLLAQRTIPRLWSEKLCS
# VLVKLGFKRLESDPCVYLFQRGDIKVIVPVWVDDITLASKNSGVLNKFVIELSKELKLRDLGETTFLLGIGIRRDRPNRKLYLNAKQYIIRKLDEFGM
# QDSKPVKTPLNPNVTLSKEIVHKTPEDKEAMINVPYMSAVGSLLFLSMIIRADTAYATGVLTRFNSNPGPAHWLAVKHLLRYLKGTIDYELELGPDLL
# HQTSQLSVIQTWW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g72
###
# start gene g73
Scaffold_18	AUGUSTUS	gene	417747	418133	0.44	-	.	g73
Scaffold_18	AUGUSTUS	transcript	417747	418133	0.44	-	.	g73.t1
Scaffold_18	AUGUSTUS	stop_codon	417747	417749	.	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_18	AUGUSTUS	CDS	417747	418133	0.44	-	0	transcript_id "g73.t1"; gene_id "g73";
Scaffold_18	AUGUSTUS	start_codon	418131	418133	.	-	0	transcript_id "g73.t1"; gene_id "g73";
# protein sequence = [MKLFTLPIPIDESESDSDSNSDVDKANQPNSPRLEHTPGPDIPVTEDESDEQPIAIRRPVRTRKPPGEWWKTKHPHLV
# FLPIMMTLMILMTTTTGMQNLQHQPLPKWNLEIIESNAQFRSIQVGGGYE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g73
###
# start gene g74
Scaffold_18	AUGUSTUS	gene	424191	424565	0.18	+	.	g74
Scaffold_18	AUGUSTUS	transcript	424191	424565	0.18	+	.	g74.t1
Scaffold_18	AUGUSTUS	start_codon	424191	424193	.	+	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_18	AUGUSTUS	CDS	424191	424565	0.18	+	0	transcript_id "g74.t1"; gene_id "g74";
Scaffold_18	AUGUSTUS	stop_codon	424563	424565	.	+	0	transcript_id "g74.t1"; gene_id "g74";
# protein sequence = [MLQYIHHITDTPLSGIATQGPMSSVEPANESLPEVLVRQSPETPAALESTSSVGPHPQVPLFLPEQGSLTSPSPTLPP
# LFGSVANLVIDLTGDDDELYETEEVGAGRFSVTREVIDLAASQDVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g74
###
# start gene g75
Scaffold_18	AUGUSTUS	gene	426198	427922	0.55	-	.	g75
Scaffold_18	AUGUSTUS	transcript	426198	427922	0.55	-	.	g75.t1
Scaffold_18	AUGUSTUS	stop_codon	426198	426200	.	-	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_18	AUGUSTUS	CDS	426198	426948	0.82	-	1	transcript_id "g75.t1"; gene_id "g75";
Scaffold_18	AUGUSTUS	CDS	427321	427922	0.55	-	0	transcript_id "g75.t1"; gene_id "g75";
Scaffold_18	AUGUSTUS	start_codon	427920	427922	.	-	0	transcript_id "g75.t1"; gene_id "g75";
# protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYD
# IKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTATLRGLSSLNKITKKNRYPLPLIGTLVDQLRKAKIFTK
# IDLRAGYNNVRVAQGHEWKTAFRTRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILSQL
# DPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLGAK
# PDALTRRSDVYPKKGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALRIARNEEESSFGRMG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g75
###
# start gene g76
Scaffold_18	AUGUSTUS	gene	429915	431915	0.21	-	.	g76
Scaffold_18	AUGUSTUS	transcript	429915	431915	0.21	-	.	g76.t1
Scaffold_18	AUGUSTUS	stop_codon	429915	429917	.	-	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_18	AUGUSTUS	CDS	429915	431915	0.21	-	0	transcript_id "g76.t1"; gene_id "g76";
Scaffold_18	AUGUSTUS	start_codon	431913	431915	.	-	0	transcript_id "g76.t1"; gene_id "g76";
# protein sequence = [MVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHSSPRNTEVPELLNPGNTATRSPQLRSGTSPTVHALAQNATPPP
# RVNLQTKPLTPVSTQRYQFGEVRMDGAQHSSRISGQDLTARLAPNPVHVPPRLSNPSVIPYQGSVSMQSQAVGTESQRGPNQRRTLAVHEEAVPPQGA
# PFGTPFVTGAQMNRPGMAFESARSQESVAMIQQQARVIETLQEQLREVKKGFTAGEVPTGGPLSKTGNTAGLSGRAPRVMREYTRGGPSPVVPQPRSW
# QATEPISFNRNTPTGARDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPEGGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLS
# QGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNE
# GRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFK
# REFGSKFGPIDEADEARRRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPGCLYRLLPEGRNLDPTTSGPECSRSWTELYVRKRRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g76
###
# start gene g77
Scaffold_18	AUGUSTUS	gene	432882	433511	0.58	-	.	g77
Scaffold_18	AUGUSTUS	transcript	432882	433511	0.58	-	.	g77.t1
Scaffold_18	AUGUSTUS	stop_codon	432882	432884	.	-	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_18	AUGUSTUS	CDS	432882	433511	0.58	-	0	transcript_id "g77.t1"; gene_id "g77";
Scaffold_18	AUGUSTUS	start_codon	433509	433511	.	-	0	transcript_id "g77.t1"; gene_id "g77";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY
# PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g77
###
# start gene g78
Scaffold_18	AUGUSTUS	gene	434915	436335	0.17	-	.	g78
Scaffold_18	AUGUSTUS	transcript	434915	436335	0.17	-	.	g78.t1
Scaffold_18	AUGUSTUS	stop_codon	434915	434917	.	-	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_18	AUGUSTUS	CDS	434915	435312	0.96	-	2	transcript_id "g78.t1"; gene_id "g78";
Scaffold_18	AUGUSTUS	CDS	435394	435526	0.93	-	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_18	AUGUSTUS	CDS	435717	435902	0.22	-	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_18	AUGUSTUS	CDS	435942	436109	1	-	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_18	AUGUSTUS	CDS	436168	436335	0.84	-	0	transcript_id "g78.t1"; gene_id "g78";
Scaffold_18	AUGUSTUS	start_codon	436333	436335	.	-	0	transcript_id "g78.t1"; gene_id "g78";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLEKPVTLRSHVRQVSNLTARQSI
# IDTLCLGHKLFPDIVSDSHFEQHLKFMAFANDAHSFQNTFIRNRLLNRARSVHSDHEASTRADNSRFIRKSKKKATRFASSRDVKREPRSVRFDSDNR
# RGTPYPTGPNKGSNKDEKSAVNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYA
# TRARIAKVIADEACSILKSRQDSGSDSSVSDASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSNELLLHSLVVLLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g78
###
# start gene g79
Scaffold_18	AUGUSTUS	gene	437307	437965	0.51	-	.	g79
Scaffold_18	AUGUSTUS	transcript	437307	437965	0.51	-	.	g79.t1
Scaffold_18	AUGUSTUS	stop_codon	437307	437309	.	-	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_18	AUGUSTUS	CDS	437307	437854	0.93	-	2	transcript_id "g79.t1"; gene_id "g79";
Scaffold_18	AUGUSTUS	CDS	437917	437965	0.52	-	0	transcript_id "g79.t1"; gene_id "g79";
Scaffold_18	AUGUSTUS	start_codon	437963	437965	.	-	0	transcript_id "g79.t1"; gene_id "g79";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTSSPVGGSVPMELDLP
# TIESLAERALSPEKGAESAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g79
###
# start gene g80
Scaffold_18	AUGUSTUS	gene	438562	439266	0.33	-	.	g80
Scaffold_18	AUGUSTUS	transcript	438562	439266	0.33	-	.	g80.t1
Scaffold_18	AUGUSTUS	stop_codon	438562	438564	.	-	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_18	AUGUSTUS	CDS	438562	438998	0.54	-	2	transcript_id "g80.t1"; gene_id "g80";
Scaffold_18	AUGUSTUS	CDS	439059	439266	0.58	-	0	transcript_id "g80.t1"; gene_id "g80";
Scaffold_18	AUGUSTUS	start_codon	439264	439266	.	-	0	transcript_id "g80.t1"; gene_id "g80";
# protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS
# KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE
# DEDEDTAPPPKRLKTTSSISGKIFILHFLSHFINSIRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g80
###
# start gene g81
Scaffold_18	AUGUSTUS	gene	445756	447684	0.31	-	.	g81
Scaffold_18	AUGUSTUS	transcript	445756	447684	0.31	-	.	g81.t1
Scaffold_18	AUGUSTUS	stop_codon	445756	445758	.	-	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_18	AUGUSTUS	CDS	445756	446022	0.88	-	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_18	AUGUSTUS	CDS	447505	447684	0.31	-	0	transcript_id "g81.t1"; gene_id "g81";
Scaffold_18	AUGUSTUS	start_codon	447682	447684	.	-	0	transcript_id "g81.t1"; gene_id "g81";
# protein sequence = [MDTSSVPRALPLNDASNSRTSPTLDPLSSREFGFKESPTAVQPPARSSSSSTIMPSNANVHREDSADPDSLLEALLDE
# LLNDRELDDRKLGEREWDDREWDDSEWDDSERDNSEPSERDNRERDDRKWDDRKLDDHEWDDRELDDHEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g81
###
# start gene g82
Scaffold_18	AUGUSTUS	gene	454065	454607	0.75	+	.	g82
Scaffold_18	AUGUSTUS	transcript	454065	454607	0.75	+	.	g82.t1
Scaffold_18	AUGUSTUS	start_codon	454065	454067	.	+	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_18	AUGUSTUS	CDS	454065	454607	0.75	+	0	transcript_id "g82.t1"; gene_id "g82";
Scaffold_18	AUGUSTUS	stop_codon	454605	454607	.	+	0	transcript_id "g82.t1"; gene_id "g82";
# protein sequence = [MVQYKVAFHHAQKDLRRSQMQLMLQEDEIAENRKFHSDSLHRNKRQVYVIKELGLRLYKSQMEAEVEHREQHLKQLKT
# IEDLERRLGTSENNKYLSNIEELKVQLGREKLLRGNVARILLNEHNPAVAVAESLRLLTPSSEIFSKSTAEGLSIKAEQQPNLFHTAVAKQLLELEDE
# AWRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g82
###
# start gene g83
Scaffold_18	AUGUSTUS	gene	461221	461808	0.95	-	.	g83
Scaffold_18	AUGUSTUS	transcript	461221	461808	0.95	-	.	g83.t1
Scaffold_18	AUGUSTUS	stop_codon	461221	461223	.	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_18	AUGUSTUS	CDS	461221	461808	0.95	-	0	transcript_id "g83.t1"; gene_id "g83";
Scaffold_18	AUGUSTUS	start_codon	461806	461808	.	-	0	transcript_id "g83.t1"; gene_id "g83";
# protein sequence = [MTLPIDEFIVWEPGTGSKRSQWSCLACDDHVWRDANLARRHENGKGHQQAVKHHREASHYSAPDPFVPNPGTSRRVSP
# PLESLLMDLSEGPYETQGHDEPFDFENVQPSSDRNTQPVYGITFDPTEDFTLQPSDVERGMARFAEEMHAWLLEEPDSENSEDEIEECDDLEDDAFGA
# FSHYLPQLCSSQNAIHSWV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g83
###
# start gene g84
Scaffold_18	AUGUSTUS	gene	463233	464012	0.74	+	.	g84
Scaffold_18	AUGUSTUS	transcript	463233	464012	0.74	+	.	g84.t1
Scaffold_18	AUGUSTUS	start_codon	463233	463235	.	+	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_18	AUGUSTUS	CDS	463233	464012	0.74	+	0	transcript_id "g84.t1"; gene_id "g84";
Scaffold_18	AUGUSTUS	stop_codon	464010	464012	.	+	0	transcript_id "g84.t1"; gene_id "g84";
# protein sequence = [MKKPAQVVQKRKSSKKRVSWFDGYGKDERESQDAMDVDEDEEIQVVSTETDDDALGADVLIRGWDSDLTESDEDDFNL
# NSMLANEPDLSADCNAVLSSGYSSITCTIKHCRNFLPLNYTWKCCPTCRKYRRDHQRKRLGCDIEKDKYQGDQSTFVPSSGSASIPLKVHSSSHDVQD
# HRLIAYIFRRSSQKTNWDHTPYTIPQVLSLSEPGYAPSVAASTSFPTKLSTSSSCASLVGFAVLGVPGFGKQERSSRKPCQAW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g84
###
# start gene g85
Scaffold_18	AUGUSTUS	gene	464247	465077	0.75	+	.	g85
Scaffold_18	AUGUSTUS	transcript	464247	465077	0.75	+	.	g85.t1
Scaffold_18	AUGUSTUS	start_codon	464247	464249	.	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_18	AUGUSTUS	CDS	464247	465077	0.75	+	0	transcript_id "g85.t1"; gene_id "g85";
Scaffold_18	AUGUSTUS	stop_codon	465075	465077	.	+	0	transcript_id "g85.t1"; gene_id "g85";
# protein sequence = [MEMLPSLSSPDPGATGELGETENVETNDSEALCDQCTWRRLPPDVRRSRKVEVHRRVRIVLDCERDSTKLHTDGGGPS
# QLKPCIRPNVPVIKLPQRPIPPPKVCFYRTLIRFLIDLDICSILQPRNPTPYPEYQSISHLICDLQSLFKSFIQAQGFYLAFSLTCKQNSTASTGHTN
# KPSEPPHVLNSEAPFSDTTSTNAIHPCNSFNSSKFSNNPSSLSASKLNPIIPRTMSKFAFDGEFSIVAPDFELLERKDEVNEFVTSAMHQIEKVASVK
# FL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g85
###
# start gene g86
Scaffold_18	AUGUSTUS	gene	468319	468757	0.94	+	.	g86
Scaffold_18	AUGUSTUS	transcript	468319	468757	0.94	+	.	g86.t1
Scaffold_18	AUGUSTUS	start_codon	468319	468321	.	+	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_18	AUGUSTUS	CDS	468319	468330	0.95	+	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_18	AUGUSTUS	CDS	468391	468552	0.98	+	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_18	AUGUSTUS	CDS	468614	468757	0.99	+	0	transcript_id "g86.t1"; gene_id "g86";
Scaffold_18	AUGUSTUS	stop_codon	468755	468757	.	+	0	transcript_id "g86.t1"; gene_id "g86";
# protein sequence = [MKTKTTRRSNRKGKAPKSVPMIVDTSSEDEEEVQIIGGDIAMGDSTPPVNNTTSTDSVMSVDSVVPGTTLSVEPMAAS
# TPSIPAPLPANIKFNKNKDKEPIVEVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g86
###
# start gene g87
Scaffold_18	AUGUSTUS	gene	469447	469929	0.96	-	.	g87
Scaffold_18	AUGUSTUS	transcript	469447	469929	0.96	-	.	g87.t1
Scaffold_18	AUGUSTUS	stop_codon	469447	469449	.	-	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_18	AUGUSTUS	CDS	469447	469929	0.96	-	0	transcript_id "g87.t1"; gene_id "g87";
Scaffold_18	AUGUSTUS	start_codon	469927	469929	.	-	0	transcript_id "g87.t1"; gene_id "g87";
# protein sequence = [MHTNTIKNFDFKPGELVLVRNSQVENSLNAKMLPRWMGPCIVIRRTAGGSYVLAEMDGAVFQNKVSPFRVRPYNARHK
# VKLPQALPLLTGISMEALDAIANGPEPDNSEAIELESSRIEESLEIEYENDDSIIEPLIRGELNANSEVDYENELSDDEDDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g87
###
# start gene g88
Scaffold_18	AUGUSTUS	gene	470095	473105	0.92	-	.	g88
Scaffold_18	AUGUSTUS	transcript	470095	473105	0.92	-	.	g88.t1
Scaffold_18	AUGUSTUS	stop_codon	470095	470097	.	-	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_18	AUGUSTUS	CDS	470095	472528	0.98	-	1	transcript_id "g88.t1"; gene_id "g88";
Scaffold_18	AUGUSTUS	CDS	472636	473105	0.93	-	0	transcript_id "g88.t1"; gene_id "g88";
Scaffold_18	AUGUSTUS	start_codon	473103	473105	.	-	0	transcript_id "g88.t1"; gene_id "g88";
# protein sequence = [MNSIVSIILHFQLSFLNYQSEIGDLKPCRTDIYFEPMAVLASRKYKPVAKKVRPIIGELPQKFRIIRDIKGDPLKDMP
# KLSTHPPEFKPTGRYTEARKAIIDKIHGDDFLWPEERKLMHHLMMEQEMGFAWNDEERGKFREDFFPPVDMPVILTLHGSRWFGVLKKDGKSIRLVHS
# LEPLNKVTIQHSGLPPATDELADQFAGYSCGAILICMLDMMKRMLATQSRDFTTFQTPYGALRLTTLPMGWTNSVPIFHDDVTYMLREEIPHVTRPYI
# DDVPIKGPPTRYETKDGSYKVIPENSGIRRFVWEHMQNVNRVIQRVKYCGGTFSGHKAVVCASEFKVVGYRCTYEGRVVDPDLMGVIDRWGPCKNIGD
# VRSFLRTAGLCRMFVKNYAKIAEPINNLRKDNVVFFWGPIEQKAMDELKKAIKESPALRKLDYNSDSNVILSVDSSFKGVGFYVKKDEKDKRKRHYAR
# FGSITYNDREARFSQPKRELYGLYRALQACKYWLFGVRKLTIEVDAKYIKGMLQHPDEVPNAAINRWIEQILMFHFELKHIPGKKHGSDGLSRRDLQP
# GDKIYVNPEEEYQDEPPAFTVTFENGIDTTIPFEAFKDKIDTRTGYTQEIAESVQDFVQLVEEASRNEAKLRAKFVQQYPANGAFLTTLPQIIKPQNF
# ISEERYEEKHRSNKGKEQDNRLLLVRKWLKNPKWKPDNMSENQYLNFKQFARQFFTKDDKLYQRNIEGKHRLVVGKEHRMSIMKAAHDGLGHRGVYAT
# KSLLMEWFWWPELERDANWYVKTCHLCQQRLKDHIRTPPRLTATPSIFQVLHADTMHMPVSNGKKYFVHGRCHVTSWMEGRALRKETSKTIGDWIYEE
# IICRWGCLAVIYTDNGTPFLNAIKYLEERYGIKGIQIAPYRSQANGKIERPHWDVRQALYKAANGIQSRWSYYVVEIMWADRITVRKRLGCSHSLLSQ
# VHTLYCI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g88
###
# start gene g89
Scaffold_18	AUGUSTUS	gene	473504	475784	0.63	-	.	g89
Scaffold_18	AUGUSTUS	transcript	473504	475784	0.63	-	.	g89.t1
Scaffold_18	AUGUSTUS	stop_codon	473504	473506	.	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_18	AUGUSTUS	CDS	473504	474354	0.68	-	2	transcript_id "g89.t1"; gene_id "g89";
Scaffold_18	AUGUSTUS	CDS	474411	474576	0.66	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_18	AUGUSTUS	CDS	474720	475784	0.97	-	0	transcript_id "g89.t1"; gene_id "g89";
Scaffold_18	AUGUSTUS	start_codon	475782	475784	.	-	0	transcript_id "g89.t1"; gene_id "g89";
# protein sequence = [MYDIDEVIAQGEAIARGTMPGTDPMSSVATNASSSYAPPVHIKQEQFQQQINDLISEKIAVLMDTIKISQDQVRQENS
# KQINEFMRTYQQNNVPRGSVPQGYASHQMPAGFEANPVKSQNVEMRDNNKAPYDWHGNLSKVVCYFCSEEGHVANDCHHRQDLLELGRIVLVNGRARL
# PGNYPIPRQPIGAVSEKDRIDYYYLEKEKRDKDNAKQVNLVQSTPNNIPGMINTATMSTYLSNQLSDKDLRIANLEKELQSLNNPASQMMYQMPGQMN
# QFMQQPFYMPQHNPMMQSQFSQVGWNPSSQMNSYIPSTSPTMHMLNSMYQNQNSMTPNYTNMGMHTQPQQSMPTMAEIEAFNWRSREKETLKDIGFDE
# GDIPEIPFINVKDVSELPMKGIQAVDEECMIDQYNRLTINDLVDKILDNDICVKASDLLSTSKPIREELKYRVTQQRVNSGEQPKSTQVKAQFEELQL
# DSDTIDIDSLPSVTWEKKTERTNSGEQISAFVVGDVVLQYLETLAPKETAKQIVVAKDSQSLRSIYPLLNGREHVESLLDSGSQIVSTSQEKAEKAGL
# IWDPDIVIYMQSANKGLEKSLGLARNVPFLIGDMTVLLQVHVIKEPAYDLLLGRPFDALLQTHIQNFADGRQIITLTEPLTNRRITVPTFARGTATIL
# ANSSKMEKATESTTANPVAQGFLASRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g89
###
# start gene g90
Scaffold_18	AUGUSTUS	gene	476117	477756	0.55	-	.	g90
Scaffold_18	AUGUSTUS	transcript	476117	477756	0.55	-	.	g90.t1
Scaffold_18	AUGUSTUS	stop_codon	476117	476119	.	-	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_18	AUGUSTUS	CDS	476117	477072	0.97	-	2	transcript_id "g90.t1"; gene_id "g90";
Scaffold_18	AUGUSTUS	CDS	477597	477756	0.57	-	0	transcript_id "g90.t1"; gene_id "g90";
Scaffold_18	AUGUSTUS	start_codon	477754	477756	.	-	0	transcript_id "g90.t1"; gene_id "g90";
# protein sequence = [MHMVTSEQDIPNHVQHNKTLDPGLALGPQNCIYTSKNLETGQACSTPTSVEIATLRQKQEEQKQQRAQRSARRESYKE
# LSSNISKLTEGSSSSQRIPSPEKKSSTPIETKLCRNCRVLPKTEYNPTWNFNNREQHIAYLTSCTTYPLPNSPELTLRQIEKLPASNSIPGSFDHQAS
# EEEDHSINSEQEQSFVEFENFASTQLFPPEFSESEEGQELELPESSSAVEQIKQEETDSESLFDLEYKEGSKTPPPFAFSFGQAISPGFLNFNPNSQQ
# TSSPRNSLYKTTITMSGSSSTMPRPGSRDAPRLTAEGTDDPMKVRRYFDDLENLFTDCNINNELDKKKWTVRYPEEQVAWECLSTALLQAHLQTSRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g90
###
# start gene g91
Scaffold_18	AUGUSTUS	gene	487411	488815	0.57	+	.	g91
Scaffold_18	AUGUSTUS	transcript	487411	488815	0.57	+	.	g91.t1
Scaffold_18	AUGUSTUS	start_codon	487411	487413	.	+	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_18	AUGUSTUS	CDS	487411	487655	0.57	+	0	transcript_id "g91.t1"; gene_id "g91";
Scaffold_18	AUGUSTUS	CDS	488053	488815	0.94	+	1	transcript_id "g91.t1"; gene_id "g91";
Scaffold_18	AUGUSTUS	stop_codon	488813	488815	.	+	0	transcript_id "g91.t1"; gene_id "g91";
# protein sequence = [MSAVTVDTEESGDEPLTVSLLSPMLEGPAGIVYPPRNLPMEAQVEKEYGIDLDMSSVSKVIQVASKLKKTAIALGGRQ
# MEVCSSDKGGHEGNEGSNEARDGKQEQQQQKKAEAYTAKVEDMVKDHLENRVDRMAHVGKARRGAQVERMSERAREVTGYGAHQKRMGEEETVYDSRS
# GKVPHGNYAESVHDMGGRGNDWNNHYQGNGHRDFRQNESHTRGSYQHSQAYGMPPARLGQPAPTAPAKDKQDLRLAIGVFQGQYATATVGEQIALIAQ
# TVPRSFIPSDARRDDYRFGLLVMTFRSYNDRDAFTQEWSAHYKNSLLEREGLKLRGIGEDF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g91
###
# start gene g92
Scaffold_18	AUGUSTUS	gene	492245	492835	0.89	-	.	g92
Scaffold_18	AUGUSTUS	transcript	492245	492835	0.89	-	.	g92.t1
Scaffold_18	AUGUSTUS	stop_codon	492245	492247	.	-	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_18	AUGUSTUS	CDS	492245	492835	0.89	-	0	transcript_id "g92.t1"; gene_id "g92";
Scaffold_18	AUGUSTUS	start_codon	492833	492835	.	-	0	transcript_id "g92.t1"; gene_id "g92";
# protein sequence = [MWERGREMYFEGDLGFEFELEFEFGFVVDLELELLELELEFVDLELLELELDLEFEFVDLEFVLETEDTPRGLAVAVP
# LLLLTVLVVVVVVEDCCFDPRLPEVDTKNSKTKTHNPFSKNQNQKNNNTHHSSSDVPPSTPHHIRRHIVFRHPAVRPGLSRRGVRSSPFDFKVLRGLA
# DDAEGVPEVDVVVGEGDELR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g92
###
# start gene g93
Scaffold_18	AUGUSTUS	gene	493322	495083	0.49	+	.	g93
Scaffold_18	AUGUSTUS	transcript	493322	495083	0.49	+	.	g93.t1
Scaffold_18	AUGUSTUS	start_codon	493322	493324	.	+	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_18	AUGUSTUS	CDS	493322	494494	0.87	+	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_18	AUGUSTUS	CDS	494763	495083	0.49	+	0	transcript_id "g93.t1"; gene_id "g93";
Scaffold_18	AUGUSTUS	stop_codon	495081	495083	.	+	0	transcript_id "g93.t1"; gene_id "g93";
# protein sequence = [MVEARKARERAEAEAEAKAEAEAKAKAKADAKAKEKEKAKAEVEKKAKAKAKGKTKAKPRAVSDSEEEEVSEEHDEEE
# EDEDEDEEEIVSTLMIPRRGFFRLIRLIRLIRLIKLGLNLTLAPPPLNINTTTTNTASTPSTPRPKFNSGYVLIASTTKTTTKETKGKEKAKEREKDD
# DIDTAKQTRKRSSDKDKDKDFKDKQGVDDSGEFTPYHTHPPSSFRSSHTLCFTLFRPPHLHTHSLSHTLSLRLFFALLTFTHTHTHTYFFHSLDVETH
# TEEMLKSQRARMRRQVSYKSTATITSGGGGAGGGAGGGAGGSAGGGGGAASASKTSATTSGKGNEKEGERKQSKERKAEAEAERKAERKQQRNQNKKE
# PLPTSEDEDPSSSENYSSHSLKLVKPLKSEKSLKNLKYLKLVKSVDGRRKVKGYVVDDEDEDDEDEEEDEEDEDEEEEDKEEEDEEDEDEDGNGKGKE
# KKKKRKRKEQGEGKRKRKTCHPNNDNA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g93
###
# start gene g94
Scaffold_18	AUGUSTUS	gene	497722	500452	0.89	+	.	g94
Scaffold_18	AUGUSTUS	transcript	497722	500452	0.89	+	.	g94.t1
Scaffold_18	AUGUSTUS	start_codon	497722	497724	.	+	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_18	AUGUSTUS	CDS	497722	498396	0.94	+	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_18	AUGUSTUS	CDS	498639	498800	1	+	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_18	AUGUSTUS	CDS	499023	499355	0.94	+	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_18	AUGUSTUS	CDS	499450	499597	1	+	0	transcript_id "g94.t1"; gene_id "g94";
Scaffold_18	AUGUSTUS	CDS	499971	500452	1	+	2	transcript_id "g94.t1"; gene_id "g94";
Scaffold_18	AUGUSTUS	stop_codon	500450	500452	.	+	0	transcript_id "g94.t1"; gene_id "g94";
# protein sequence = [MGKEEERGFGRRLGLMMTKSRGMTSRGDEYEEQEEEYGNEQEDLDLEEGEEEERDSMQLRVSSPAKPMAVAGPMPGPV
# HMDTEIEMEMDVDADMDAEEMDMDVDVDMEVDVEVEEGEIREEDTQGLRRGVGLVEKAVGKVGKVRMVFSRLGGYFDVLIFDCGVERGQEREQQQQHN
# ADPIPHPNSIPDPIPIPDPDPIPEADVEAEADKDKDTHQSIDDDADFDGSNFELRYPDSPADPLPLSLNNDESSTSSRNVDKDVDKDVDKDVDKDVDK
# DVDDVNPPHAPEDEASSFLLQGQQGWQQERKEQQQERQQGQQQEQHQQERKERQQEQEQQQQEQQEQSEQSELEALRRERDTWIKEKQNLQEELQKTI
# AESASALAAKDVLYDELRNPKPTPSNPPSSPPNPTATSSTPNTPPPPPTPPPSTPKISSSSNAPRSPKDWDWDRDWGGGGIGIGSDVGMGGGGGGDGD
# MHMGGDGDGLIHYHDHDHDHERDRSYIPGDPAASASAAPVDSAVDYAAGPAGPAAPAPSFGPTPAPGPASSGPSPASSTPAAPSSTSNPDPNQKVFRC
# EWREDDGPCLFVCETRKVCVLFCFRFVSFVF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g94
###
# start gene g95
Scaffold_18	AUGUSTUS	gene	504128	506063	0.43	-	.	g95
Scaffold_18	AUGUSTUS	transcript	504128	506063	0.43	-	.	g95.t1
Scaffold_18	AUGUSTUS	stop_codon	504128	504130	.	-	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_18	AUGUSTUS	CDS	504128	504809	0.59	-	1	transcript_id "g95.t1"; gene_id "g95";
Scaffold_18	AUGUSTUS	CDS	504919	506063	0.64	-	0	transcript_id "g95.t1"; gene_id "g95";
Scaffold_18	AUGUSTUS	start_codon	506061	506063	.	-	0	transcript_id "g95.t1"; gene_id "g95";
# protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVIAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPV
# DVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRA
# SIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLCLDDRIYVPNHGDLRLQVLRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDF
# VRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSKQAIIPTHDTITSEQLAELFVIHVFSKHGVPNHVT
# SDRGSEFVSATSGSIVPTNKMTGRRYFRSPSSPITHAPNASTGITPFFANKGYHPNNRSAEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQA
# DRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEY
# NVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFLLGCR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g95
###
# start gene g96
Scaffold_18	AUGUSTUS	gene	508211	509149	0.28	-	.	g96
Scaffold_18	AUGUSTUS	transcript	508211	509149	0.28	-	.	g96.t1
Scaffold_18	AUGUSTUS	stop_codon	508211	508213	.	-	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_18	AUGUSTUS	CDS	508211	508443	0.93	-	2	transcript_id "g96.t1"; gene_id "g96";
Scaffold_18	AUGUSTUS	CDS	508562	508998	0.64	-	1	transcript_id "g96.t1"; gene_id "g96";
Scaffold_18	AUGUSTUS	CDS	509127	509149	0.33	-	0	transcript_id "g96.t1"; gene_id "g96";
Scaffold_18	AUGUSTUS	start_codon	509147	509149	.	-	0	transcript_id "g96.t1"; gene_id "g96";
# protein sequence = [MEEEQQFDHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSG
# PGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDAKEWFVPDILDPDLDSLPAWTSP
# SQALVKELQDNFGVYDAQGEAETLVIKMKETENIRNTTSGSTPWLLVPTGILLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g96
###
# start gene g97
Scaffold_18	AUGUSTUS	gene	513730	514862	0.52	-	.	g97
Scaffold_18	AUGUSTUS	transcript	513730	514862	0.52	-	.	g97.t1
Scaffold_18	AUGUSTUS	stop_codon	513730	513732	.	-	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_18	AUGUSTUS	CDS	513730	514814	0.53	-	2	transcript_id "g97.t1"; gene_id "g97";
Scaffold_18	AUGUSTUS	CDS	514853	514862	0.52	-	0	transcript_id "g97.t1"; gene_id "g97";
Scaffold_18	AUGUSTUS	start_codon	514860	514862	.	-	0	transcript_id "g97.t1"; gene_id "g97";
# protein sequence = [MLSICGEECSKQKCVKCIPEGERQDIVDFLMQRTLAEIDLDSDDFSERLITLDCGHMFTAETLDGHCHMKDFYEVDQL
# DQYLSMKAPPTKYQQPPTCPTCRSPITSRRYGRVTKRANLDILEQNVASNLAKALNDVSPTIQILRSRMDGLETSMKDMKYEPAGNVLPDVETIEARR
# GATLHSGSKENEILPAALLTKNAMTEDHGIPAGEAKAWFDSIDTFHGVYMTVARVVNTRSAHVRAYEAALVTLYHLELSELASDPSIDTNSTNPQSLA
# FQNVNKKIGQPPHKADRRYQIESLLLSVELRFMLGSLARTRVDNLPLTSNDEEQRKLRRLWASFTDFLYQSCEEDCRKAISIAENSSSPD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g97
###
# start gene g98
Scaffold_18	AUGUSTUS	gene	517595	518266	1	-	.	g98
Scaffold_18	AUGUSTUS	transcript	517595	518266	1	-	.	g98.t1
Scaffold_18	AUGUSTUS	stop_codon	517595	517597	.	-	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_18	AUGUSTUS	CDS	517595	518266	1	-	0	transcript_id "g98.t1"; gene_id "g98";
Scaffold_18	AUGUSTUS	start_codon	518264	518266	.	-	0	transcript_id "g98.t1"; gene_id "g98";
# protein sequence = [MLLSLLDDDITSNFVRLGSRSSNERIAEYTLDKLEKTFSEKQALDRTVGREYASLKKLEEQMKTILDRIQIPEVTFDG
# ITEHLRESYPSQSEWIHGPPFWIAQLFESLHTPTHEGGQWTQVSHKKRRSEDKQIAETIYGFWKLGQDLEFIRPPNLGPIHMSTTQPKASGRQKKKKK
# KEVQTVVHTVSTDDALAIAEEYRSRMSTFFGKLGFGDQVPMCLRVVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g98
###
# start gene g99
Scaffold_18	AUGUSTUS	gene	518481	519266	0.59	-	.	g99
Scaffold_18	AUGUSTUS	transcript	518481	519266	0.59	-	.	g99.t1
Scaffold_18	AUGUSTUS	stop_codon	518481	518483	.	-	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_18	AUGUSTUS	CDS	518481	519266	0.59	-	0	transcript_id "g99.t1"; gene_id "g99";
Scaffold_18	AUGUSTUS	start_codon	519264	519266	.	-	0	transcript_id "g99.t1"; gene_id "g99";
# protein sequence = [MLTQLEEVVARNGGMYRTKGHNSVMFQVYTNVELSPLKAERKGFTVGLVLDAPPGGARAAGAKDRQDYWKHAGSKRLA
# SGTLVALLLVINNRLDIYLGTVASSNTELVDSSKYHESRVEIRVSFVEPQVELMALRRDKATVNASQFAILIDNSIMFESVRPFLDTLQSVEPTSIPF
# KSYLSQSGNLDKMQLHPPKFATSPRFMFHLDCLARPGKYIHPMKPTDEASIRRARFELKLSSILDASQADAMVDALTREVALIQG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g99
###
# start gene g100
Scaffold_18	AUGUSTUS	gene	530636	531178	0.57	+	.	g100
Scaffold_18	AUGUSTUS	transcript	530636	531178	0.57	+	.	g100.t1
Scaffold_18	AUGUSTUS	start_codon	530636	530638	.	+	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_18	AUGUSTUS	CDS	530636	531178	0.57	+	0	transcript_id "g100.t1"; gene_id "g100";
Scaffold_18	AUGUSTUS	stop_codon	531176	531178	.	+	0	transcript_id "g100.t1"; gene_id "g100";
# protein sequence = [MDRIRKKLGENIPIHLVFPNEGETNVIESAYSRDQPSGPTVTIHWRPLPPLPVEDDSSSQSSTAFSSHTRTRLSNARD
# SLLIQSSRRAHKIKRKPVPKLDLVELEPTGLFLDAESLTRREKERLSLILELPHEHEDEAVMALDSDSRSQNSTWFSDGGEDDISFQNWYQNFLKHEG
# ESSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g100
###
# start gene g101
Scaffold_18	AUGUSTUS	gene	531499	533737	0.5	-	.	g101
Scaffold_18	AUGUSTUS	transcript	531499	533737	0.5	-	.	g101.t1
Scaffold_18	AUGUSTUS	stop_codon	531499	531501	.	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_18	AUGUSTUS	CDS	531499	532344	0.97	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_18	AUGUSTUS	CDS	532392	532720	0.63	-	2	transcript_id "g101.t1"; gene_id "g101";
Scaffold_18	AUGUSTUS	CDS	533556	533667	0.78	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_18	AUGUSTUS	CDS	533720	533737	0.78	-	0	transcript_id "g101.t1"; gene_id "g101";
Scaffold_18	AUGUSTUS	start_codon	533735	533737	.	-	0	transcript_id "g101.t1"; gene_id "g101";
# protein sequence = [MAAPEHKALLASSEASCFINHPVSVLTVQLLSFSGRSYSDKPRXTLSSLVSPPIHPVDFEIIPEFGRVEEDVVDDLVE
# RIAGVTKEDIKACLRRDDGINGNVVKVAYMLLRDQRRQGKDSTLLFACPDEQGSLRLPVSYYAELERDAELAAQDPRNAISPGALSPSGRDVDENPFE
# TNFAEAEDLDEYELELGGYDSNPDVSTFAVLNSSLPDRPVEQQHHLSSYVSAKRSAGSSGGRRHRQGDQHRTKWHFGIRSRSPPMEIVLEIYKTLKVL
# GMEWLEKKTLGGLGGVKTKIVKGEDGSVKIDRVKRLDGLGEVDLRLASSIYFIETRTRVQDVVVCANAQSPFVSLTYLQVLMNLQLYMVDAVNYLVDF
# HHKKSYKASFAQGAGQFDMAVQPAPIIDSAEKDAAKEMEVVSPYVFMDVACRLILELAGGGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g101
###
# start gene g102
Scaffold_18	AUGUSTUS	gene	536075	537355	0.55	-	.	g102
Scaffold_18	AUGUSTUS	transcript	536075	537355	0.55	-	.	g102.t1
Scaffold_18	AUGUSTUS	stop_codon	536075	536077	.	-	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_18	AUGUSTUS	CDS	536075	537355	0.55	-	0	transcript_id "g102.t1"; gene_id "g102";
Scaffold_18	AUGUSTUS	start_codon	537353	537355	.	-	0	transcript_id "g102.t1"; gene_id "g102";
# protein sequence = [MSSDARTSTTIDPSRIRKYTYPQKIKGKDLTLIKSSPHPTLPIMILNYSNDTERSSSWDDLTMAARVLVVERNTGKVV
# SRAFSKFFNWNEKHAYQFPTADAAGHPRDEVVSTTAEEKLDGSIITLFYYRNQWILTSKARFDSVHVEMAQEILKEKYPGIINTRRLNGTLPRDKTYV
# FELIHPKNPTALRYAYKDLVLLSVIGMDGSEPPQDFNWSIYPFPRPKMNDINITDLDAVRRLNRVNEEGLVVKLYLKNDPVHPQRLKVKFESYLDLIR
# SKNYYTPAELAGLYRKKREMIYTFEEGKVRRKMKAEKEIYFEGVRRIADDFGGEKWVNGLIKMWNEVETVFVKAEMELRKIMDRLKEKDQFGDHVGSA
# NAEMRRRFAQTIMKEDTMVKHKNVLFLWFSGAPIEEQIKAFTASVKTREKGGVV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g102
###
# start gene g103
Scaffold_18	AUGUSTUS	gene	552613	553383	1	+	.	g103
Scaffold_18	AUGUSTUS	transcript	552613	553383	1	+	.	g103.t1
Scaffold_18	AUGUSTUS	start_codon	552613	552615	.	+	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_18	AUGUSTUS	CDS	552613	553383	1	+	0	transcript_id "g103.t1"; gene_id "g103";
Scaffold_18	AUGUSTUS	stop_codon	553381	553383	.	+	0	transcript_id "g103.t1"; gene_id "g103";
# protein sequence = [MGQFFYLINLDKRQNKGDFEPFCDCYSILDLLLHKDPKQSWAGDRIIVLGDEIDTRYDVPERWESARPSLRTLCIKAL
# KDDDDDDYDSVEANDEDIEGGSDTEVNEDEEDGSEVKANEDEEDAADKTGKDSGKENKAAMTENAGGDVDDNGTGHELRNQKHTSGEVGKDIISLKSS
# SEAYIEAKDAENQENNFQVEDSKVLSTFTVPPLRGKEIGNNHVLRNLSNFEYVRGNALAVRKCDLDEQPGGKSPIDLLLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g103
###
# start gene g104
Scaffold_18	AUGUSTUS	gene	554786	555593	0.44	+	.	g104
Scaffold_18	AUGUSTUS	transcript	554786	555593	0.44	+	.	g104.t1
Scaffold_18	AUGUSTUS	start_codon	554786	554788	.	+	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_18	AUGUSTUS	CDS	554786	555143	0.44	+	0	transcript_id "g104.t1"; gene_id "g104";
Scaffold_18	AUGUSTUS	CDS	555211	555593	0.9	+	2	transcript_id "g104.t1"; gene_id "g104";
Scaffold_18	AUGUSTUS	stop_codon	555591	555593	.	+	0	transcript_id "g104.t1"; gene_id "g104";
# protein sequence = [MGSTLSTLSTALTKGAESASYNGHPTEQDVVDVREFMLSFLPIEIIDLILDFGEYWPCLRVDSNNEIEAVASGTITGE
# ATWLYLISPPIPPREISGTDSRHRRIRKVTFEMESHDQGWTSTYNGSWSWFEAIIFRPSVSPCWVDLNSGPFNFGATFNAQDIKELFPEPNPNGWLIQ
# TNIVASNESLSHSVTWTEFEDEEAFVDPTSLKGREGLGHELVRSLEPGDRIMLMAKSKVSISSASVFIPC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g104
###
# start gene g105
Scaffold_18	AUGUSTUS	gene	565972	566847	0.75	-	.	g105
Scaffold_18	AUGUSTUS	transcript	565972	566847	0.75	-	.	g105.t1
Scaffold_18	AUGUSTUS	stop_codon	565972	565974	.	-	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_18	AUGUSTUS	CDS	565972	566847	0.75	-	0	transcript_id "g105.t1"; gene_id "g105";
Scaffold_18	AUGUSTUS	start_codon	566845	566847	.	-	0	transcript_id "g105.t1"; gene_id "g105";
# protein sequence = [MSSPPETDKQDLSASMNQKQGALSTEGFDCPANGALQTEWTIGEDRGSEDRQGLAGSEETDDRRATPGTKTVGEGLVK
# DGGHEQDTGPSVEDSRRDGESFNGSADTAGTVVESPKKTKKKAGGQAAPKARAKTVRKSEVGGEKGPSDAKQKPRTRGSTASPAARTLASTLSAATMD
# HDESGDEPLATSLLLSPMSEAPDVIVDSLGNAMMEARVEKEYGINLDMSSVSKVVQVASKLKKTAIAVGGWQMEMRNAFRDETSTLRQDLSKLEERVA
# RVEKGQAGSEKAGEFVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g105
###
# start gene g106
Scaffold_18	AUGUSTUS	gene	571050	571944	0.99	-	.	g106
Scaffold_18	AUGUSTUS	transcript	571050	571944	0.99	-	.	g106.t1
Scaffold_18	AUGUSTUS	stop_codon	571050	571052	.	-	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_18	AUGUSTUS	CDS	571050	571344	1	-	1	transcript_id "g106.t1"; gene_id "g106";
Scaffold_18	AUGUSTUS	CDS	571400	571797	1	-	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_18	AUGUSTUS	CDS	571855	571944	0.99	-	0	transcript_id "g106.t1"; gene_id "g106";
Scaffold_18	AUGUSTUS	start_codon	571942	571944	.	-	0	transcript_id "g106.t1"; gene_id "g106";
# protein sequence = [MLVIWDDSHIAGLKEIVDFAHSQGQKIGIQQLAHAGRKASTVAPWLETNYPATILVGGHNNAVGPSTIPYDEINQFPK
# ALSKSEITEIVISWAQAAKRAVRAGFDVIEIHGAHGFLLHSFNSPVSNARTDEYGVSFENRTRFLVEVIDAVRAVIPRGMPLFVRVSASDRMEELRSV
# PSWGLEDTIKLAPILSAHGTDLLDVSSAGSSMKQSLVDTSAHQKFSKAIKQALADLGFPCWSVLSVESNPVFKQKGICRIASLM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g106
###
# start gene g107
Scaffold_18	AUGUSTUS	gene	579262	579713	0.38	-	.	g107
Scaffold_18	AUGUSTUS	transcript	579262	579713	0.38	-	.	g107.t1
Scaffold_18	AUGUSTUS	stop_codon	579262	579264	.	-	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_18	AUGUSTUS	CDS	579262	579536	0.85	-	2	transcript_id "g107.t1"; gene_id "g107";
Scaffold_18	AUGUSTUS	CDS	579632	579713	0.4	-	0	transcript_id "g107.t1"; gene_id "g107";
Scaffold_18	AUGUSTUS	start_codon	579711	579713	.	-	0	transcript_id "g107.t1"; gene_id "g107";
# protein sequence = [MMEILKRFEENNMEQDELVGEDEDNSEASASPDALWSLLSQVERDKFIEAIQDPSSNLAQELLLSQELQNELAQEPWW
# EMSSITHDADDNPDDTRYGRTPELIDIPQLWSSLCPLGHH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g107
###
# start gene g108
Scaffold_18	AUGUSTUS	gene	597789	598809	0.61	-	.	g108
Scaffold_18	AUGUSTUS	transcript	597789	598809	0.61	-	.	g108.t1
Scaffold_18	AUGUSTUS	stop_codon	597789	597791	.	-	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_18	AUGUSTUS	CDS	597789	598620	0.62	-	1	transcript_id "g108.t1"; gene_id "g108";
Scaffold_18	AUGUSTUS	CDS	598709	598809	0.62	-	0	transcript_id "g108.t1"; gene_id "g108";
Scaffold_18	AUGUSTUS	start_codon	598807	598809	.	-	0	transcript_id "g108.t1"; gene_id "g108";
# protein sequence = [MYPSSTIINLVSIALALSSADAAPLVSYSQRDNSVSVASSAATASATVGLVGGLTNTATGILDGAVTTTGNVVNGVGS
# TVDGLIGLKRDGLVGGVTTTATNVVDGVVDTVGNVVNGVGSTVDGLTGLKRDGLVNGVTSTATGVVDGAVDTVGNVVDDVGSTVDGLTGLKVRDATNV
# TATSASSVPSTPSTGPVGGLTSTATGIVHGVVNTVGDVVNGAGSTVDGLTGLKRDGLVTGVTSTATGIVDGTVDTVGNVVNGVGSTVDGLTGLKRDGL
# GGGVTSTATGIVDGTVNTAGNVVNGVGNTVDNLTGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g108
###
# start gene g109
Scaffold_18	AUGUSTUS	gene	605855	606291	0.74	+	.	g109
Scaffold_18	AUGUSTUS	transcript	605855	606291	0.74	+	.	g109.t1
Scaffold_18	AUGUSTUS	start_codon	605855	605857	.	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_18	AUGUSTUS	CDS	605855	605923	0.74	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_18	AUGUSTUS	CDS	605989	606291	0.96	+	0	transcript_id "g109.t1"; gene_id "g109";
Scaffold_18	AUGUSTUS	stop_codon	606289	606291	.	+	0	transcript_id "g109.t1"; gene_id "g109";
# protein sequence = [MYFLTAIVKLSVVLALSANAAPLIGNDPEGIIPTGIIPTGILPTGILPTGILPTGILPTGILPTGILPTGILPTGILP
# TGILPTGILPTGILPTGILPTGILGLTDSGDSVDSVDGSISGDNL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g109
###
#
# ----- prediction on sequence number 2 (length = 561984, name = Scaffold_20) -----
#
# Predicted genes for sequence number 2 on both strands
# start gene g110
Scaffold_20	AUGUSTUS	gene	3539	4042	0.92	+	.	g110
Scaffold_20	AUGUSTUS	transcript	3539	4042	0.92	+	.	g110.t1
Scaffold_20	AUGUSTUS	start_codon	3539	3541	.	+	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_20	AUGUSTUS	CDS	3539	4042	0.92	+	0	transcript_id "g110.t1"; gene_id "g110";
Scaffold_20	AUGUSTUS	stop_codon	4040	4042	.	+	0	transcript_id "g110.t1"; gene_id "g110";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWVSEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAEKPP
# FGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFTQKFKDIGDRTEMSDIDLREHFFTALLPEIRQHLITVNIAKELLRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g110
###
# start gene g111
Scaffold_20	AUGUSTUS	gene	10844	11548	0.52	+	.	g111
Scaffold_20	AUGUSTUS	transcript	10844	11548	0.52	+	.	g111.t1
Scaffold_20	AUGUSTUS	start_codon	10844	10846	.	+	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_20	AUGUSTUS	CDS	10844	11051	0.72	+	0	transcript_id "g111.t1"; gene_id "g111";
Scaffold_20	AUGUSTUS	CDS	11112	11548	0.68	+	2	transcript_id "g111.t1"; gene_id "g111";
Scaffold_20	AUGUSTUS	stop_codon	11546	11548	.	+	0	transcript_id "g111.t1"; gene_id "g111";
# protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS
# KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE
# DEDEDTAPPPKRLKTTSSISGKIFILHFLSHFINSIRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g111
###
# start gene g112
Scaffold_20	AUGUSTUS	gene	12146	12804	0.6	+	.	g112
Scaffold_20	AUGUSTUS	transcript	12146	12804	0.6	+	.	g112.t1
Scaffold_20	AUGUSTUS	start_codon	12146	12148	.	+	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_20	AUGUSTUS	CDS	12146	12194	0.6	+	0	transcript_id "g112.t1"; gene_id "g112";
Scaffold_20	AUGUSTUS	CDS	12257	12804	0.94	+	2	transcript_id "g112.t1"; gene_id "g112";
Scaffold_20	AUGUSTUS	stop_codon	12802	12804	.	+	0	transcript_id "g112.t1"; gene_id "g112";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTARELFLRSILDLQNAGEDPIVVLEALKTAEPNRRAIT
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTSSPVGGSVPMELDLP
# TIESLAERALSPEKGAESAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g112
###
# start gene g113
Scaffold_20	AUGUSTUS	gene	13915	15397	0.66	+	.	g113
Scaffold_20	AUGUSTUS	transcript	13915	15397	0.66	+	.	g113.t1
Scaffold_20	AUGUSTUS	start_codon	13915	13917	.	+	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_20	AUGUSTUS	CDS	13915	14132	0.89	+	0	transcript_id "g113.t1"; gene_id "g113";
Scaffold_20	AUGUSTUS	CDS	14237	14692	0.72	+	1	transcript_id "g113.t1"; gene_id "g113";
Scaffold_20	AUGUSTUS	CDS	14782	15397	0.77	+	1	transcript_id "g113.t1"; gene_id "g113";
Scaffold_20	AUGUSTUS	stop_codon	15395	15397	.	+	0	transcript_id "g113.t1"; gene_id "g113";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDNNLSTALVHCHSPPY
# GKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNMTIWMTIPAVYRVVSLVTPVAWGPGGPGGPGGPGGPGGPRSPILLTSPTSNELC
# WNSLGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDS
# LGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSD
# FKTGSTNQQNNSQPSGSSAPFTPNLNPSLVVSLTTMVSPRTLRIPANPAVSAPRSTI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g113
###
# start gene g114
Scaffold_20	AUGUSTUS	gene	18857	19444	0.95	+	.	g114
Scaffold_20	AUGUSTUS	transcript	18857	19444	0.95	+	.	g114.t1
Scaffold_20	AUGUSTUS	start_codon	18857	18859	.	+	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_20	AUGUSTUS	CDS	18857	19444	0.95	+	0	transcript_id "g114.t1"; gene_id "g114";
Scaffold_20	AUGUSTUS	stop_codon	19442	19444	.	+	0	transcript_id "g114.t1"; gene_id "g114";
# protein sequence = [MKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVI
# SRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL
# HADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g114
###
# start gene g115
Scaffold_20	AUGUSTUS	gene	22715	23779	0.08	+	.	g115
Scaffold_20	AUGUSTUS	transcript	22715	23779	0.08	+	.	g115.t1
Scaffold_20	AUGUSTUS	start_codon	22715	22717	.	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_20	AUGUSTUS	CDS	22715	22722	0.37	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_20	AUGUSTUS	CDS	22762	22948	0.22	+	1	transcript_id "g115.t1"; gene_id "g115";
Scaffold_20	AUGUSTUS	CDS	23139	23271	0.88	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_20	AUGUSTUS	CDS	23353	23504	0.91	+	2	transcript_id "g115.t1"; gene_id "g115";
Scaffold_20	AUGUSTUS	CDS	23576	23779	0.63	+	0	transcript_id "g115.t1"; gene_id "g115";
Scaffold_20	AUGUSTUS	stop_codon	23777	23779	.	+	0	transcript_id "g115.t1"; gene_id "g115";
# protein sequence = [MLILFRTLSSEIASSIVLVLFIPDHEASTRADNSRFIRKSKKKATRFASSRDVKREPRSVRFDSDNRRGTPYPTGPNK
# GSNKDEKSAVNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTTIHCCYTQLQAAEFEFNANLSPRLWSDSSVSDASFA
# TAQSIPTTGSEDTIVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g115
###
# start gene g116
Scaffold_20	AUGUSTUS	gene	23991	24452	0.99	-	.	g116
Scaffold_20	AUGUSTUS	transcript	23991	24452	0.99	-	.	g116.t1
Scaffold_20	AUGUSTUS	stop_codon	23991	23993	.	-	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_20	AUGUSTUS	CDS	23991	24452	0.99	-	0	transcript_id "g116.t1"; gene_id "g116";
Scaffold_20	AUGUSTUS	start_codon	24450	24452	.	-	0	transcript_id "g116.t1"; gene_id "g116";
# protein sequence = [MQTKLQSYEDLNEKYRHTIKDWDFEPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKV
# GAFRVLPHFTRNEPIELPNNIHELIDLSAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g116
###
# start gene g117
Scaffold_20	AUGUSTUS	gene	28524	29192	0.25	+	.	g117
Scaffold_20	AUGUSTUS	transcript	28524	29192	0.25	+	.	g117.t1
Scaffold_20	AUGUSTUS	start_codon	28524	28526	.	+	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_20	AUGUSTUS	CDS	28524	29192	0.25	+	0	transcript_id "g117.t1"; gene_id "g117";
Scaffold_20	AUGUSTUS	stop_codon	29190	29192	.	+	0	transcript_id "g117.t1"; gene_id "g117";
# protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKVKDIQSFLGFANFYRRFIYNYSDIVVPMTRLTRKGAPGSGTAAV
# KRPSKISKLAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVV
# TDHKNLEYFSTTKVLHADRSDGQNFYINLIWSFASDRGNSARNLIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g117
###
# start gene g118
Scaffold_20	AUGUSTUS	gene	29740	30237	0.89	+	.	g118
Scaffold_20	AUGUSTUS	transcript	29740	30237	0.89	+	.	g118.t1
Scaffold_20	AUGUSTUS	start_codon	29740	29742	.	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_20	AUGUSTUS	CDS	29740	30237	0.89	+	0	transcript_id "g118.t1"; gene_id "g118";
Scaffold_20	AUGUSTUS	stop_codon	30235	30237	.	+	0	transcript_id "g118.t1"; gene_id "g118";
# protein sequence = [MDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKWCPNHVTSDRGSEFVSAFFRALGKAL
# SMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g118
###
# start gene g119
Scaffold_20	AUGUSTUS	gene	33246	33713	1	+	.	g119
Scaffold_20	AUGUSTUS	transcript	33246	33713	1	+	.	g119.t1
Scaffold_20	AUGUSTUS	start_codon	33246	33248	.	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_20	AUGUSTUS	CDS	33246	33713	1	+	0	transcript_id "g119.t1"; gene_id "g119";
Scaffold_20	AUGUSTUS	stop_codon	33711	33713	.	+	0	transcript_id "g119.t1"; gene_id "g119";
# protein sequence = [MSATSMERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ
# GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGEY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g119
###
# start gene g120
Scaffold_20	AUGUSTUS	gene	35596	36603	0.77	+	.	g120
Scaffold_20	AUGUSTUS	transcript	35596	36603	0.77	+	.	g120.t1
Scaffold_20	AUGUSTUS	start_codon	35596	35598	.	+	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_20	AUGUSTUS	CDS	35596	36603	0.77	+	0	transcript_id "g120.t1"; gene_id "g120";
Scaffold_20	AUGUSTUS	stop_codon	36601	36603	.	+	0	transcript_id "g120.t1"; gene_id "g120";
# protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE
# GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG
# ELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDRSAWKTWVLSLERMFGVRPTIYAREKD
# KCASAASHLTGAALSHFDTLNRQRLRGEYTCSKTGQNSNESSVPNSDPSTRRTRQGGGWPG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g120
###
# start gene g121
Scaffold_20	AUGUSTUS	gene	39327	39776	0.66	+	.	g121
Scaffold_20	AUGUSTUS	transcript	39327	39776	0.66	+	.	g121.t1
Scaffold_20	AUGUSTUS	start_codon	39327	39329	.	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_20	AUGUSTUS	CDS	39327	39347	0.68	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_20	AUGUSTUS	CDS	39435	39776	0.66	+	0	transcript_id "g121.t1"; gene_id "g121";
Scaffold_20	AUGUSTUS	stop_codon	39774	39776	.	+	0	transcript_id "g121.t1"; gene_id "g121";
# protein sequence = [MRHPKNLISFVDGTIHKVEFLVTQLHPMALIVLGLPWLRLHNPVIDWKELCLMFQDRNAQISAALASEIVQPGAEGGT
# EELGRGVNNEEIHEGTLQPPPEAPQQPPETPQPPLEAPLRAR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g121
###
# start gene g122
Scaffold_20	AUGUSTUS	gene	40303	40740	0.86	+	.	g122
Scaffold_20	AUGUSTUS	transcript	40303	40740	0.86	+	.	g122.t1
Scaffold_20	AUGUSTUS	start_codon	40303	40305	.	+	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_20	AUGUSTUS	CDS	40303	40740	0.86	+	0	transcript_id "g122.t1"; gene_id "g122";
Scaffold_20	AUGUSTUS	stop_codon	40738	40740	.	+	0	transcript_id "g122.t1"; gene_id "g122";
# protein sequence = [MDRLLREGTPAYFLHISPTKQESPTEEMLRASDSNDPERVQQPKDPESGSPSPEQGGVVKELDKEALKRQETEELKKS
# IPVQYQDYLDIFSPGEARMLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g122
###
# start gene g123
Scaffold_20	AUGUSTUS	gene	45576	46040	0.91	-	.	g123
Scaffold_20	AUGUSTUS	transcript	45576	46040	0.91	-	.	g123.t1
Scaffold_20	AUGUSTUS	stop_codon	45576	45578	.	-	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_20	AUGUSTUS	CDS	45576	46040	0.91	-	0	transcript_id "g123.t1"; gene_id "g123";
Scaffold_20	AUGUSTUS	start_codon	46038	46040	.	-	0	transcript_id "g123.t1"; gene_id "g123";
# protein sequence = [MLDEKNTAETDQQELQKFLALQQGEAVVAAKCKRDCSPLPVAGPSSKKVRSDGSKKHSCRRTPVEGAAQESPRRVQLV
# APPGRSMAASTSTPALPRALPSSMEVSVRDEPVQGPSGLVQLAAAAKAQFDVVQWLVSPPPVTSPIKGTGSDPRGE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g123
###
# start gene g124
Scaffold_20	AUGUSTUS	gene	53868	54758	0.91	+	.	g124
Scaffold_20	AUGUSTUS	transcript	53868	54758	0.91	+	.	g124.t1
Scaffold_20	AUGUSTUS	start_codon	53868	53870	.	+	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_20	AUGUSTUS	CDS	53868	54758	0.91	+	0	transcript_id "g124.t1"; gene_id "g124";
Scaffold_20	AUGUSTUS	stop_codon	54756	54758	.	+	0	transcript_id "g124.t1"; gene_id "g124";
# protein sequence = [MYDDKLTSCDRLKCFEPSALDDSSSESESPSRRPRKRKRSARKREEADAEEQSIGDVQMHEIDGRGDDDDDARSITST
# RSQSRLKKKLKSVPTSPLASTSASVPISAPPTLTTKSTSASASKITSKPRKKRAKAKHDDKPFKPEASPFEDDDDEDMDVDDSASVSTKRKAKRVVRT
# TITGKGKAKASDSTSAVKFPAAGATGSASPSSRSSPNRPDADASGDERRQRRRSQHSHSVSFAPTMGVALDSSTKTASGSVSKLGSKSVSSSSKPRST
# NPRPQAKKRSEEVLTSSLDGET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g124
###
# start gene g125
Scaffold_20	AUGUSTUS	gene	55970	56821	0.56	-	.	g125
Scaffold_20	AUGUSTUS	transcript	55970	56821	0.56	-	.	g125.t1
Scaffold_20	AUGUSTUS	stop_codon	55970	55972	.	-	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_20	AUGUSTUS	CDS	55970	56821	0.56	-	0	transcript_id "g125.t1"; gene_id "g125";
Scaffold_20	AUGUSTUS	start_codon	56819	56821	.	-	0	transcript_id "g125.t1"; gene_id "g125";
# protein sequence = [MESQIYQHSMATFHPQDYIPNHSLSGYWAGHILAHDSKGFYSVQGLIQIFIMDIDSDRKITGVAEAYRGLMNVSGIIS
# LDNKLTLILTFENWEAAFTCEGQYDPKLETLSGKASSTDEESENSDGNDNGREQENSDAVDEDELEANKEGEHHTNQAGDRASGETNTFFFTRTPAFA
# WRFHSVLDQRSNSARERWVFAIGAVLDQVQRTQYSWNYLKSRNIERRRFLALVLRREVAQSLSPANPLKKDERLEFRLLIAKLHPTDARFYYSLIPSL
# ANVEFITHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g125
###
# start gene g126
Scaffold_20	AUGUSTUS	gene	58740	59754	0.82	-	.	g126
Scaffold_20	AUGUSTUS	transcript	58740	59754	0.82	-	.	g126.t1
Scaffold_20	AUGUSTUS	stop_codon	58740	58742	.	-	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_20	AUGUSTUS	CDS	58740	59273	0.94	-	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_20	AUGUSTUS	CDS	59371	59754	0.84	-	0	transcript_id "g126.t1"; gene_id "g126";
Scaffold_20	AUGUSTUS	start_codon	59752	59754	.	-	0	transcript_id "g126.t1"; gene_id "g126";
# protein sequence = [MGYTSCGASHIDFRFSIHQPIVGYRSFKEGISSLKQVTGRAQRDVQRYLIPLISGAVIPKFITALRALMDFRYAGQAP
# RFNQASTLRVQTALNEFHENKDIIQDLKARLIPKEFLSSTGRSQNWNSCKIGNNHDFEVQICRHLDRQSRVRRFDLVTAMVDAGVDFRLDDIEGDEGR
# GDIGHDREERDEEDEEVDAKISSSEELMTRLHPVSQKLFGSFRPKQNFFLKARLLKQDASALLPLRIFTDNISGEISAFKVNRDPDLKTLTIEQVSNL
# YSLPDFSGACLDFLERIQAKTQTFVIGGSDP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g126
###
# start gene g127
Scaffold_20	AUGUSTUS	gene	61482	63794	0.33	-	.	g127
Scaffold_20	AUGUSTUS	transcript	61482	63794	0.33	-	.	g127.t1
Scaffold_20	AUGUSTUS	stop_codon	61482	61484	.	-	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_20	AUGUSTUS	CDS	61482	62825	0.51	-	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_20	AUGUSTUS	CDS	63381	63794	0.49	-	0	transcript_id "g127.t1"; gene_id "g127";
Scaffold_20	AUGUSTUS	start_codon	63792	63794	.	-	0	transcript_id "g127.t1"; gene_id "g127";
# protein sequence = [MWTRGDPNVGANANPKVKLGPNVSLRVDVDARADWMARVDANGKANANVDANPNPNVDANANPNADPNVDANANLNVD
# ANVNPNPNVDAKANPNVDANPNPKVDGNTNPNANLNANLNANLNANANPNLNPKVDVDARTGKKRLVKRLPDFPLPPLLLQPPPLPLPPQQPPLAKPL
# PLPPQPLPPPPPQLPSPPPQLPPPPPKPLPPSPKPPPQLQPPPPPQLPLLPPPPPKPPPLPPQPPPQLLPPPPKPPPLPPKPPPLPPQPPPQLLPPPP
# KPPPLPPQPLPQLPPPPPPPPPPPPPPRPPLLPKPPPKLLPQPLPQLPPPPPPQPPPPPPQPPPPPPQPPPPPPRPPLLPKPPPKPLPQLPPLPPLPL
# LPLPPQLLPLPPQPPPPPPPQPPLPLPLPQPPQPPLQPPLLLQPPPAALPPQRPPPPRLVEIKDAVRNSSEDDWSSAEDGVISVEEVEDTEADNEDGE
# MATTNTTMKMMKMKMTKHSFPLNIAQTMEGWSPPTSSSLTVADIDSASPTFLGSSSSSTPTPDSTSPISTNANSGSNAASTNAGSVPTTDLSSHCLHY
# LHHSHNYCLYHFRLTAG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g127
###
# start gene g128
Scaffold_20	AUGUSTUS	gene	66066	66623	0.59	+	.	g128
Scaffold_20	AUGUSTUS	transcript	66066	66623	0.59	+	.	g128.t1
Scaffold_20	AUGUSTUS	start_codon	66066	66068	.	+	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_20	AUGUSTUS	CDS	66066	66623	0.59	+	0	transcript_id "g128.t1"; gene_id "g128";
Scaffold_20	AUGUSTUS	stop_codon	66621	66623	.	+	0	transcript_id "g128.t1"; gene_id "g128";
# protein sequence = [MNHSQLLVHPSEDIQKFSGPFKDLKQSLEETLRWVSEKVSETSLHELLCISNVSLKVLQIHPDTFHEISATVDLLPLQ
# DTSPASPFTSIVFNINVSTLAHRDKNDKSACICITVGNPQGGELGLYEPKLLLETCNGDVVVFHSDRYTHFNLPYSGTRGSIVIHADKTGVSYQKDGF
# GWFDNIYFK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g128
###
# start gene g129
Scaffold_20	AUGUSTUS	gene	69680	70697	0.34	+	.	g129
Scaffold_20	AUGUSTUS	transcript	69680	70697	0.34	+	.	g129.t1
Scaffold_20	AUGUSTUS	start_codon	69680	69682	.	+	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_20	AUGUSTUS	CDS	69680	70318	0.37	+	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_20	AUGUSTUS	CDS	70440	70697	0.48	+	0	transcript_id "g129.t1"; gene_id "g129";
Scaffold_20	AUGUSTUS	stop_codon	70695	70697	.	+	0	transcript_id "g129.t1"; gene_id "g129";
# protein sequence = [MGRGSTASSGGSHYHGSQPGPVVGFGSGNANLDGYGGGHGRNYGGYSGDYNRGYENSYGQGGRSDKVDDGGYIAGHRR
# SLSGVQGYGEGYCGVDGVDTEGDIVVDMEMDTEVNMEVDMEADMEVDTEADMEVDTEANMEVDTEANMEVDTEVDTNIGGMVPPFHADGVNMEALVGV
# HKEVSYASSPVDNIPNQEQSQMSFHSEGTGSKRLKECVEGETEVLKKRKRNLPKPPNPAILKIHSKSHVPTTEEDFINEELAEFEHDRYADDEDDENA
# DAEDEDADNNGEDVTLTSREYKRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g129
###
# start gene g130
Scaffold_20	AUGUSTUS	gene	75406	77137	0.31	+	.	g130
Scaffold_20	AUGUSTUS	transcript	75406	77137	0.31	+	.	g130.t1
Scaffold_20	AUGUSTUS	start_codon	75406	75408	.	+	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_20	AUGUSTUS	CDS	75406	75931	0.71	+	0	transcript_id "g130.t1"; gene_id "g130";
Scaffold_20	AUGUSTUS	CDS	75982	76090	0.38	+	2	transcript_id "g130.t1"; gene_id "g130";
Scaffold_20	AUGUSTUS	CDS	76138	77137	0.39	+	1	transcript_id "g130.t1"; gene_id "g130";
Scaffold_20	AUGUSTUS	stop_codon	77135	77137	.	+	0	transcript_id "g130.t1"; gene_id "g130";
# protein sequence = [MTDPRSYTYPKKLSWLSLPLPSPSEMHWLNTLYSTALLLSIAQHMQQSSAQLVQIPSIKSFSRSVSNFVVDTSIQIVV
# DVDFAHNFTGGFPTLVGFAQTFREDLISVTGFSNISEVQTGKVSADATTSTVFLTLGPSSSSNLTLFNGKSTGEGYEFEVAQKLYTIRGVEAIGAWWG
# TRTFLQQVVLSIVNGSKPAMIPTGSGEDNPGWEIRGYLTITFRLLAVPGCLTILSADLCVYASFFKINEFHIHASDFFYDPSFLYGEDWRELYTGFRF
# QPSSDSPIFNLVPELNESWTQTQFSTLQTTCSNHGVTLIPEIDTPAHSLVITKWKPELMISGTPDLLNLSYPETIPTLKSIWDEILPWFTSSEISIGA
# DEYSASLADDYITFVNEMDEYISGSSGKSIRIWGTSEPSTTESISTNVTIQHWWFPGGSIPVQLMDQGYSIINSDQVFLYLDGKFSDGGQFPWTLNIT
# KMWSGAPDGQGWAPNIFSADDPTNNTSIENPLLRGSIMALWNDWGTMQRHRWRCITSSHRVWQYLLRRHGRVQE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g130
###
# start gene g131
Scaffold_20	AUGUSTUS	gene	81154	82323	0.97	+	.	g131
Scaffold_20	AUGUSTUS	transcript	81154	82323	0.97	+	.	g131.t1
Scaffold_20	AUGUSTUS	start_codon	81154	81156	.	+	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_20	AUGUSTUS	CDS	81154	82323	0.97	+	0	transcript_id "g131.t1"; gene_id "g131";
Scaffold_20	AUGUSTUS	stop_codon	82321	82323	.	+	0	transcript_id "g131.t1"; gene_id "g131";
# protein sequence = [MTLADVTPIRARPWSITEALIREHAQLKNATPLALIPAPHAKISNSPPGFQRHGKKQIMALSGSLGSISEVSSMFVAL
# RNQADGGLEGDSTPSSAFTSVFSHSEDTESVSEIDTPVPAIGDSGNEATSPCPSNTPLLPSRLDMPPTRATTNYTNGTATIYPHAHHHSNFDNIEVEV
# EIPIYAQELFAGFDRVGLDFGMDGALDLPSNTTTTSSAPETPNQIPKQSKHIALPSVFLTPPRRSPRSSGSLKGRAPNLKPSVSLGSLQPASHSQLRL
# ERERASLLSIPESSSMLSLSSSRNSFAPSRFGNGTFVKEDNTFPLSTVLSPPLEIRSNAPANVTPNEDSGNSNHTQSSPSSKVTRLKRKLSARLSLTV
# FGSPTKTLKKKELDYMG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g131
###
# start gene g132
Scaffold_20	AUGUSTUS	gene	89716	90063	0.98	+	.	g132
Scaffold_20	AUGUSTUS	transcript	89716	90063	0.98	+	.	g132.t1
Scaffold_20	AUGUSTUS	start_codon	89716	89718	.	+	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_20	AUGUSTUS	CDS	89716	90063	0.98	+	0	transcript_id "g132.t1"; gene_id "g132";
Scaffold_20	AUGUSTUS	stop_codon	90061	90063	.	+	0	transcript_id "g132.t1"; gene_id "g132";
# protein sequence = [MVLELTIEASSDAKGGLGGKVEWGTIFKGGLEGEGEEEEAELATAPAVEQDEAGDTELELAAIVIDDETDGDEYVSGY
# STEVSKGSTGELDRERMSIGDAALSPGLWYKFGVGES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g132
###
# start gene g133
Scaffold_20	AUGUSTUS	gene	90523	91653	0.94	-	.	g133
Scaffold_20	AUGUSTUS	transcript	90523	91653	0.94	-	.	g133.t1
Scaffold_20	AUGUSTUS	stop_codon	90523	90525	.	-	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_20	AUGUSTUS	CDS	90523	91653	0.94	-	0	transcript_id "g133.t1"; gene_id "g133";
Scaffold_20	AUGUSTUS	start_codon	91651	91653	.	-	0	transcript_id "g133.t1"; gene_id "g133";
# protein sequence = [MIPGYEQDSNAQISPRRVSVANTAHSNSDDLRKMALIGAHFHGNQRHHNHPAIETQLINNPQPLPSSSNSILQYPSTN
# RDLQNHPVAGPSGQANQFERNAGEQLRFFHPQGYGGPGSASDELENTINWGMMNQQLAEQMSVSNNDAWTNSQAVAAALASHQNSYSKSSPQAVLPSS
# QPHSHAQQLGYHAPDAFGTTASQSPSTSSFPRVYGWMPRSEEDLKPIARIYSRYQPAHAVTPLVPSTPQQHSSTNTRRTSMTTRPTVPVTARSIAIPI
# HNTERHSGSIPVGSSQTLQTKGAGSSRRVFAPSPLDSSLSSPVPATPSTSTSPARHSRVSDKRWDQGQSTQKAHPSQGAAQSPPRIRNANLNVRCPYV
# LPSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g133
###
# start gene g134
Scaffold_20	AUGUSTUS	gene	94255	94737	0.46	+	.	g134
Scaffold_20	AUGUSTUS	transcript	94255	94737	0.46	+	.	g134.t1
Scaffold_20	AUGUSTUS	start_codon	94255	94257	.	+	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_20	AUGUSTUS	CDS	94255	94737	0.46	+	0	transcript_id "g134.t1"; gene_id "g134";
Scaffold_20	AUGUSTUS	stop_codon	94735	94737	.	+	0	transcript_id "g134.t1"; gene_id "g134";
# protein sequence = [MQTTVHEGQDSESYSGPYDTGHVQSSHQSQSLLLDESISRPNFNQAPISRFITTLSSSTSTSAPIPMTTKRISRARME
# EVEAAEAAEKARAIEILSGLRHSIEEGNFDTGDADAVSTASVRKVREGALSTNEAMCQPAGWDGIKGENGNPGAISAPGSGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g134
###
# start gene g135
Scaffold_20	AUGUSTUS	gene	95159	96184	0.63	-	.	g135
Scaffold_20	AUGUSTUS	transcript	95159	96184	0.63	-	.	g135.t1
Scaffold_20	AUGUSTUS	stop_codon	95159	95161	.	-	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_20	AUGUSTUS	CDS	95159	96184	0.63	-	0	transcript_id "g135.t1"; gene_id "g135";
Scaffold_20	AUGUSTUS	start_codon	96182	96184	.	-	0	transcript_id "g135.t1"; gene_id "g135";
# protein sequence = [MLCDFAQGVFVEPLNLRTRPRNGRGPGGPGRRPGGPEGPHRPSDKTFPLPSNFHYESSYTQSLNVNSSALPSSGLDGA
# IYSGSWHRYYPGDTRIQLDLTRLVSFYDTELVPSLVTERYGKERIKHRLLGISSEDLQTVVRKIEELTAVADLGSGIDWATLIRLIVKRYSERLEMVQ
# YVLNSSNPNSVSENKALAENVQINLIAMLQPYMLYTIKPSPDLPTSTKWVSPMYELCATTYTKYIITSSLHLRLTDSENLILNGIQETTKEICRVVTG
# MWVDGAMAGLEPDFYQPSEEVDAVQLELLTVLVERAYLRSHEVVRLECMVEMSSCVWIRSGCPKLPT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g135
###
# start gene g136
Scaffold_20	AUGUSTUS	gene	103267	103728	0.37	-	.	g136
Scaffold_20	AUGUSTUS	transcript	103267	103728	0.37	-	.	g136.t1
Scaffold_20	AUGUSTUS	stop_codon	103267	103269	.	-	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_20	AUGUSTUS	CDS	103267	103728	0.37	-	0	transcript_id "g136.t1"; gene_id "g136";
Scaffold_20	AUGUSTUS	start_codon	103726	103728	.	-	0	transcript_id "g136.t1"; gene_id "g136";
# protein sequence = [MGAIGDLDHLNKDWQDILDRLGEAQEGESETITQKREEHLNLAKKAWWKTEKINEFHTDISKLWNLPNDRIIGEVVHA
# EPIAASVGPQKLPEDWALIALHENKFEWDKFKGNLVYIGTLFFLFRSVLFEVLTITLLPCRRKSLQCRIRQDYVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g136
###
# start gene g137
Scaffold_20	AUGUSTUS	gene	105105	106139	1	-	.	g137
Scaffold_20	AUGUSTUS	transcript	105105	106139	1	-	.	g137.t1
Scaffold_20	AUGUSTUS	stop_codon	105105	105107	.	-	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_20	AUGUSTUS	CDS	105105	106139	1	-	0	transcript_id "g137.t1"; gene_id "g137";
Scaffold_20	AUGUSTUS	start_codon	106137	106139	.	-	0	transcript_id "g137.t1"; gene_id "g137";
# protein sequence = [MNAPSNVTCLAGPSSTESGRGIILGARVTGDWTRALNNYADAESKAIQVQNAIWVADKKKAASNDEHSSLSDQSIPLA
# EVPVQVMLDGPYGGCSLDLGQYETVLLIAGGSGATFTIGVLDDIVGRCARLGRPNNERTRRIEFVWCLRSYGGINWFTSVIMPIADLVAECPDLDLHV
# SIYVTCLCNPEAVPPIPNSDVLMLAQRPDTSKILLDLTTPPLKKADCCCASGSDGEDVKCTCGSGCGGSADANKEKRAPSPSGSSVDDLEIEQVPRKN
# LARDPEACAALAEASAKLQWVGLGGGVAVCASGPGSLTREASNAVAKLSLTRGVELGGSGCIRKCLVYNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g137
###
# start gene g138
Scaffold_20	AUGUSTUS	gene	110402	111661	0.59	-	.	g138
Scaffold_20	AUGUSTUS	transcript	110402	111661	0.59	-	.	g138.t1
Scaffold_20	AUGUSTUS	stop_codon	110402	110404	.	-	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_20	AUGUSTUS	CDS	110402	110810	0.99	-	1	transcript_id "g138.t1"; gene_id "g138";
Scaffold_20	AUGUSTUS	CDS	110919	111272	0.63	-	1	transcript_id "g138.t1"; gene_id "g138";
Scaffold_20	AUGUSTUS	CDS	111492	111661	0.74	-	0	transcript_id "g138.t1"; gene_id "g138";
Scaffold_20	AUGUSTUS	start_codon	111659	111661	.	-	0	transcript_id "g138.t1"; gene_id "g138";
# protein sequence = [MWAETEEPPRLRVAADIMEILNARDLLIMMGSCGVSLRDDESDIPTDDDVNMEPEVSAKDVDWSSVDDITHKYSLNLT
# ADSIKETIALERAKIQENMKNATPVVVATVFNRGDNPHSADSPAHSVPGNAFKVTVPPPPPPPLSVPEAHLFLSPAHSVGVGNHSCVYRVEWDCLARG
# TLKLQEKRTPSLAFAFSKFDFDYAELDKSRAQLDENLLHKLEDDNEITYIDYTGSVSTIHVDTVPWYDPASTMPPPCSHLAQSSVSGSLPGSPPPTAQ
# VSVVAKLSLPGDAHLEREAVNYQRIWNTVFTALDRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g138
###
# start gene g139
Scaffold_20	AUGUSTUS	gene	112853	113368	0.57	-	.	g139
Scaffold_20	AUGUSTUS	transcript	112853	113368	0.57	-	.	g139.t1
Scaffold_20	AUGUSTUS	stop_codon	112853	112855	.	-	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_20	AUGUSTUS	CDS	112853	113188	0.69	-	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_20	AUGUSTUS	CDS	113240	113368	0.6	-	0	transcript_id "g139.t1"; gene_id "g139";
Scaffold_20	AUGUSTUS	start_codon	113366	113368	.	-	0	transcript_id "g139.t1"; gene_id "g139";
# protein sequence = [MYAEPFNDDGTLASNVFFETIGPTYIDLALQAASAADPNAKLYINDFNIEGEGAKATAMENLVTDLKSRGIPIDGIGL
# ESHFILGEIPTTLQAQMEAFTALGVEVAVTELDIRMTLPETDALLAQQQTDYQTVVSACTAVADCVGVCIVFGYEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g139
###
# start gene g140
Scaffold_20	AUGUSTUS	gene	117080	118047	0.41	-	.	g140
Scaffold_20	AUGUSTUS	transcript	117080	118047	0.41	-	.	g140.t1
Scaffold_20	AUGUSTUS	stop_codon	117080	117082	.	-	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_20	AUGUSTUS	CDS	117080	117621	0.69	-	2	transcript_id "g140.t1"; gene_id "g140";
Scaffold_20	AUGUSTUS	CDS	117915	118047	0.44	-	0	transcript_id "g140.t1"; gene_id "g140";
Scaffold_20	AUGUSTUS	start_codon	118045	118047	.	-	0	transcript_id "g140.t1"; gene_id "g140";
# protein sequence = [MSHDAKEQLFPAIGTIADRADQLPENEASANSDEDRPMQEIESLSRSDLNRQIVRSANASIVIPELQLTLPSSARGQL
# TTVEGLIRDIVSDLGIDQPLRRVQDEDSYTKIQSLIDKLVEILGDNEVEDEAEDDQNNASVRAASEKDLPMPAFTVKLDDPSGNSWIEFIGSMSDPKW
# NMRNYPRTLQQNIELGLVAAPDESASASCFCFFYIINCSCYRRRTRRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g140
###
# start gene g141
Scaffold_20	AUGUSTUS	gene	124583	125011	0.45	+	.	g141
Scaffold_20	AUGUSTUS	transcript	124583	125011	0.45	+	.	g141.t1
Scaffold_20	AUGUSTUS	start_codon	124583	124585	.	+	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_20	AUGUSTUS	CDS	124583	125011	0.45	+	0	transcript_id "g141.t1"; gene_id "g141";
Scaffold_20	AUGUSTUS	stop_codon	125009	125011	.	+	0	transcript_id "g141.t1"; gene_id "g141";
# protein sequence = [MEVIYSSLLVDFRLPPFPAVSYEEFQKATEAELRPTKVHENTLVFMFESSMMWTISDWAMKRSGKLHGKFCTSATVQT
# TIENIYPIEHEPKMWDNLKGQFMNHLEEVEEDLRKAGLPGLGHTRVDSGQNGSEMKGNGHMNGH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g141
###
# start gene g142
Scaffold_20	AUGUSTUS	gene	125630	125881	0.5	-	.	g142
Scaffold_20	AUGUSTUS	transcript	125630	125881	0.5	-	.	g142.t1
Scaffold_20	AUGUSTUS	stop_codon	125630	125632	.	-	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_20	AUGUSTUS	CDS	125630	125881	0.5	-	0	transcript_id "g142.t1"; gene_id "g142";
Scaffold_20	AUGUSTUS	start_codon	125879	125881	.	-	0	transcript_id "g142.t1"; gene_id "g142";
# protein sequence = [MSSDNKDQLPGEHFEPRQTATSDDYTPDQAKSLPLEPARQRLVDDILALYSCKPTVERVKRYSSDCVYDDQFVYANDR
# YKMAA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g142
###
# start gene g143
Scaffold_20	AUGUSTUS	gene	132287	133064	0.77	-	.	g143
Scaffold_20	AUGUSTUS	transcript	132287	133064	0.77	-	.	g143.t1
Scaffold_20	AUGUSTUS	stop_codon	132287	132289	.	-	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_20	AUGUSTUS	CDS	132287	132782	0.98	-	1	transcript_id "g143.t1"; gene_id "g143";
Scaffold_20	AUGUSTUS	CDS	132895	133064	0.77	-	0	transcript_id "g143.t1"; gene_id "g143";
Scaffold_20	AUGUSTUS	start_codon	133062	133064	.	-	0	transcript_id "g143.t1"; gene_id "g143";
# protein sequence = [MSSSPSSNGLSNNTLHLEQIQTNLASLRNGILELEAVSRTAGGSHSQVEAVKLLRKHLDIIVAPTPNKPDPFSSLTSP
# SNASLAPLIGTPPPRSPSPSIPDYNGPFTPYTDDPQRPPSPPSPNALLQTQKQLIDTQDTHLSALSDSISRHHNLSLQINSELDTHHGLLQELDTELD
# QTEGRLSGARRRLDRVGRGLKGNGSTVCIGVLILVLLVLIIAFKT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g143
###
# start gene g144
Scaffold_20	AUGUSTUS	gene	133481	134494	0.34	+	.	g144
Scaffold_20	AUGUSTUS	transcript	133481	134494	0.34	+	.	g144.t1
Scaffold_20	AUGUSTUS	start_codon	133481	133483	.	+	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_20	AUGUSTUS	CDS	133481	133939	0.34	+	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_20	AUGUSTUS	CDS	134114	134494	0.65	+	0	transcript_id "g144.t1"; gene_id "g144";
Scaffold_20	AUGUSTUS	stop_codon	134492	134494	.	+	0	transcript_id "g144.t1"; gene_id "g144";
# protein sequence = [MSSSSRRPKSPTRAQLSSKLAYEKKVPKFLQRLKNQVEGKLDTSSYDNDDEDYQDSTYRNPDRDEYRRDVGRNEYGRD
# DNGRDEFGRERRIPNGGYNDEEFEYINDGSGRPPIPRRPRSSSPQRQGRPPIPTRPDDDPGSADEDSNDEKPQVVGLPPLPDPDKLQPTSSSASLKTN
# SNIKSQSAKDKESKSLSFSSKPSSIKATDNFNALKRKVLSGSNEDEDDGNEGAVRGRHGDANHKGVDETTKKRKKDGPGRKDTGKKEGKKKEKKTLLS
# FGDDA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g144
###
# start gene g145
Scaffold_20	AUGUSTUS	gene	140393	140962	0.83	-	.	g145
Scaffold_20	AUGUSTUS	transcript	140393	140962	0.83	-	.	g145.t1
Scaffold_20	AUGUSTUS	stop_codon	140393	140395	.	-	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_20	AUGUSTUS	CDS	140393	140962	0.83	-	0	transcript_id "g145.t1"; gene_id "g145";
Scaffold_20	AUGUSTUS	start_codon	140960	140962	.	-	0	transcript_id "g145.t1"; gene_id "g145";
# protein sequence = [MTLSSQSQHAQKHYSPGNSGWSMLDLSDEIRTSQQKQKLEEQGQPMSCDSSFVLPTYNREENSFMDVDVLPGQQQNQS
# QFQSMYTPSQDFTHSTFSQPHEASVEPVIMMLNSLEPQPSFWKAIEMDVRAFPRPNLRAGLVFPTKRDASANTPLGGSGNVYTSQGTRLNKPDITKAS
# ASKNERWRRLFQW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g145
###
# start gene g146
Scaffold_20	AUGUSTUS	gene	142812	143441	0.91	+	.	g146
Scaffold_20	AUGUSTUS	transcript	142812	143441	0.91	+	.	g146.t1
Scaffold_20	AUGUSTUS	start_codon	142812	142814	.	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_20	AUGUSTUS	CDS	142812	143441	0.91	+	0	transcript_id "g146.t1"; gene_id "g146";
Scaffold_20	AUGUSTUS	stop_codon	143439	143441	.	+	0	transcript_id "g146.t1"; gene_id "g146";
# protein sequence = [MANREKTVFCLGSDGSQQEGNDAEAARLAVAQNLNIKLFIDDNDVTIAGHPSEYLKGFEVGKTLEGHGLKVVTVDGED
# IDALWGGIASIVSYSGPAAVISKRKMAPGIAEIEGSPHGHDVIPVKAAIKYLEGRGYPNFGEILLNIKPVPQPYLYIGCTKEVGANRVVFGEAVNGVL
# DRLGKEEAAKKVMVIDSTFSPILTNEYSWYLYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g146
###
# start gene g147
Scaffold_20	AUGUSTUS	gene	144864	148282	0.51	-	.	g147
Scaffold_20	AUGUSTUS	transcript	144864	148282	0.51	-	.	g147.t1
Scaffold_20	AUGUSTUS	stop_codon	144864	144866	.	-	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_20	AUGUSTUS	CDS	144864	145615	0.95	-	2	transcript_id "g147.t1"; gene_id "g147";
Scaffold_20	AUGUSTUS	CDS	145702	148282	0.52	-	0	transcript_id "g147.t1"; gene_id "g147";
Scaffold_20	AUGUSTUS	start_codon	148280	148282	.	-	0	transcript_id "g147.t1"; gene_id "g147";
# protein sequence = [MPVQSAPRWTAHITLHFSFVEVPHFTEVVDAIEKEISQLEPFSLKFDGVGHFALQGYETVHLSVSDDANIRQLWAVVA
# KALNYTGRPLTPHLTIGQAPHNDPTALSFLHRKAQKILESVSSFEWPVRSVLFLKKDENDGGTMKRCHELYIARESRSSYVLPPWFPTVHHDNTSWKF
# CDQSMDKGVLPSTLSIATYNILHDDRFPIPNRLPYIIQAILSSNADIICLQEVTDESLPVILSSTSIHSRFKYSSRHPDVILENERNILILSRYPFSW
# YKLDIGGKHKPAFIATFINPFGWKNSKFVLAATHLSRASPYMEQKTAEMEALIKHLHGTHLDADWVIAGDINWPENFGATPAEELFEDCGLVIPHGPS
# FDPSTNPLAAATMQTSPHSQRYDRVYVKRIGGWALQNTQLFGNGDSPPSDHYGLAVGFQCRVVPTKIAVESDVGLGAESHPITLLSPTGKLTTTELVE
# LTRAQSWLPSAEQERKMSIVIETLRSFICPSSEFPTTSTGHVQIRIECVGSYALGVHTSASDVDCLAVGNVSSSTFWALMKHKLRRNAKALENGYGLD
# VRLRRFVKDAVVQMMNLEVEWTKVDLQYCPARGLVEKSRRSSLKSRSRNMADATIQYRWGNIQSLPSDSPLFLLPHSSLVTLNAYRDVLTILKFLQPP
# SLLSAFRTAHRAIKLHLVAQGLFGSRFGFLGGFHLTILLSRVTLTLVSSGGSEELESHHLVRQFFLTYRHWNWERDAVSAIPYRELGPATGVSRRSST
# KAAMVVLSIERPTSNLTSNASRNSVDVMRRAFEKADKMLEECRNWVEVCGLEPEGEAPYQVFLKQHKVFIKLDIHFWGGSNLKGRAIIGWLESRIVTV
# PSISVRFWPVRFADTETIDSTDDARNLHGFYLFGLSPFSSASPSKLQEIELAALTQCIRSFEADLQSNVKYYDSQTTFISLGIMTQKSLKKETGLTNI
# IPDSFTWSDNGFDPVDDDEENIEEKDDEFDIPGPEQSMISASQRKKALAASTRNKATLYTPTPGKLRTSADVMNRLLWDPVLGKKEYIVGYEDRFLGI
# QELKLRDWVMKEVEHESFVRIYLFVPEHLFSNCTIRSLSIESCISSTSQTEK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g147
###
# start gene g148
Scaffold_20	AUGUSTUS	gene	149483	151778	0.21	-	.	g148
Scaffold_20	AUGUSTUS	transcript	149483	151778	0.21	-	.	g148.t1
Scaffold_20	AUGUSTUS	stop_codon	149483	149485	.	-	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_20	AUGUSTUS	CDS	149483	150415	0.33	-	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_20	AUGUSTUS	CDS	150474	151778	0.45	-	0	transcript_id "g148.t1"; gene_id "g148";
Scaffold_20	AUGUSTUS	start_codon	151776	151778	.	-	0	transcript_id "g148.t1"; gene_id "g148";
# protein sequence = [MEDVSLGIEDLPYDLAGEIFRHLPSSADLLHIAQASKSLYYVAIRILYRDIHYETLSDFYHNLPFWTHNVPQNIAQVP
# RSVLIGRELGQSFCQNPHGLALPRSPRAILALSGVDGSKSEESFPPAFLPLRELLLSFPKLQRLTFRQARLTHEIHSFLGELPATIRSLAFEQCSFIS
# KPILSSRSAPTTFTQLPVKELCITGTHTGRYQPLGNVLHNLPVNLLIPPVAGSTNALNERLVQLDMYHILTRSPKIQALCLDWNITCAGRFSRHPGLP
# PPAFSCLDHLEVRHGMRSHAVWNGEANSTENKLLLMSAFAKLLAPCNSLTELVLFGYIPGLGDNGTAKPILPALMSYTGPTDFLKSSLRHCEMLQKLI
# FPDAIKDIDTVMLEALPYNARESVRFLDITVGHWDIEVLYAISMELPRLEVLKIKYEVGYPDQDMLISFGPEFFSRIPHLTIFHLYRPEIEYDELRCL
# GVHSHLSKFVVPSSQARKSVKPKLKLPSKSRAPSPRGSGPAVADHPNTDTDSDSDFTVGSTTSASNSMVSSTASISTSASSINSNQSITTGSASAGQS
# SSTGTVGSVPDISQGPSIVTANSVAGTSQSSGIGTVTGTAYTSQGPVSTTANSAAGLHATVYHTVHPIHHPHHIGPQYTTGHRWRCICQNRPLPKIPV
# PDLGPCGQPDAHEYMASWEKYAPGLREVRLVDAFVWRRAGVGDEWCRRDLKDPIDEEEQELGNDGYCRCNPDVDDESFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g148
###
# start gene g149
Scaffold_20	AUGUSTUS	gene	165353	166102	0.93	+	.	g149
Scaffold_20	AUGUSTUS	transcript	165353	166102	0.93	+	.	g149.t1
Scaffold_20	AUGUSTUS	start_codon	165353	165355	.	+	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_20	AUGUSTUS	CDS	165353	166102	0.93	+	0	transcript_id "g149.t1"; gene_id "g149";
Scaffold_20	AUGUSTUS	stop_codon	166100	166102	.	+	0	transcript_id "g149.t1"; gene_id "g149";
# protein sequence = [MQITRQGPLPNDPSIISANRTRKTHKDAETISRISKLPIESRLRINFNKQTRNASRRERVFEGNDDVSDVSSYLSIPE
# EEYDKMLKDQDYFDKVKSWLSAHTISWLVDKRKSLRLRTREGDDTSVEASSTQPTKRFRANDDLNEIGSHFSSKCFFATKPSLTSGPLRLTTSLSLCS
# HQQNIEFLNNNSISFHRTKISHIEGKPQLLDLADVIKKVKGSREGGPTQDLAMEHFEWLEATANFFVINPAIC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g149
###
# start gene g150
Scaffold_20	AUGUSTUS	gene	169829	170107	0.41	+	.	g150
Scaffold_20	AUGUSTUS	transcript	169829	170107	0.41	+	.	g150.t1
Scaffold_20	AUGUSTUS	start_codon	169829	169831	.	+	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_20	AUGUSTUS	CDS	169829	170107	0.41	+	0	transcript_id "g150.t1"; gene_id "g150";
Scaffold_20	AUGUSTUS	stop_codon	170105	170107	.	+	0	transcript_id "g150.t1"; gene_id "g150";
# protein sequence = [MFMVIVSALEAVELLIAGVTPEVVAAIGGWTSLAFLLYWRRFEDILPTHVLKAYDSSQISRLKRSLDDFQKANGLSNS
# LIDACIMGIDITEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g150
###
# start gene g151
Scaffold_20	AUGUSTUS	gene	172143	172604	0.42	+	.	g151
Scaffold_20	AUGUSTUS	transcript	172143	172604	0.42	+	.	g151.t1
Scaffold_20	AUGUSTUS	start_codon	172143	172145	.	+	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_20	AUGUSTUS	CDS	172143	172604	0.42	+	0	transcript_id "g151.t1"; gene_id "g151";
Scaffold_20	AUGUSTUS	stop_codon	172602	172604	.	+	0	transcript_id "g151.t1"; gene_id "g151";
# protein sequence = [MNALCCSLVEYPHCLVITDDTTAAQQLSLSSKDYGHYLQEHLPVKVAEMSGLGKYKGYDRRNLIIKSFPSDKDVSALG
# EIQALRLMGDLVDFGKDSEGKPIIIMKRQDGSLLEELEAYKTANDEQKRKIREETFKLACSKAASEAVHKGVWHK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g151
###
# start gene g152
Scaffold_20	AUGUSTUS	gene	181961	182275	0.89	+	.	g152
Scaffold_20	AUGUSTUS	transcript	181961	182275	0.89	+	.	g152.t1
Scaffold_20	AUGUSTUS	start_codon	181961	181963	.	+	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_20	AUGUSTUS	CDS	181961	182275	0.89	+	0	transcript_id "g152.t1"; gene_id "g152";
Scaffold_20	AUGUSTUS	stop_codon	182273	182275	.	+	0	transcript_id "g152.t1"; gene_id "g152";
# protein sequence = [MDAESLNLTGDADDLVAQAVNSSSNVVVVIHATGAVNIEKWADNPNVTAIIAAYLPGQESGAGLVPVLYGDVSPSGKI
# PWTWGKSLDDYPVTSYISTTFYCSTE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g152
###
# start gene g153
Scaffold_20	AUGUSTUS	gene	187585	188126	0.36	+	.	g153
Scaffold_20	AUGUSTUS	transcript	187585	188126	0.36	+	.	g153.t1
Scaffold_20	AUGUSTUS	start_codon	187585	187587	.	+	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_20	AUGUSTUS	CDS	187585	187801	0.36	+	0	transcript_id "g153.t1"; gene_id "g153";
Scaffold_20	AUGUSTUS	CDS	187840	188126	0.76	+	2	transcript_id "g153.t1"; gene_id "g153";
Scaffold_20	AUGUSTUS	stop_codon	188124	188126	.	+	0	transcript_id "g153.t1"; gene_id "g153";
# protein sequence = [MRRPNTSSPGDGSRTITITSTPTSEDEGSSNDAPRSAVGALKLRATTRKPRQKVVWREDVVDNEGAGKKSSKIDDFET
# TVCCIYHKPKAYDESSDEDESDSDSSCDHNHAGHSRDHHHAHNSNDHRRDGEGLQNRDSGSSIQHLEHEEPSHNAYEIIPSKKGKHRAT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g153
###
# start gene g154
Scaffold_20	AUGUSTUS	gene	192267	192644	0.77	-	.	g154
Scaffold_20	AUGUSTUS	transcript	192267	192644	0.77	-	.	g154.t1
Scaffold_20	AUGUSTUS	stop_codon	192267	192269	.	-	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_20	AUGUSTUS	CDS	192267	192644	0.77	-	0	transcript_id "g154.t1"; gene_id "g154";
Scaffold_20	AUGUSTUS	start_codon	192642	192644	.	-	0	transcript_id "g154.t1"; gene_id "g154";
# protein sequence = [MFGFDMITNGIRGESLDEVAMTDEELEVFGLDWEGLRDEALLRSLRRNYSNEGSGSWLGQRGPPPELNRVVVDPPPGL
# FTSEQVAYMDEQLQGLAHGPQAEDVVRLWTTALAIARSMSGSSPDLF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g154
###
# start gene g155
Scaffold_20	AUGUSTUS	gene	194735	195343	0.91	+	.	g155
Scaffold_20	AUGUSTUS	transcript	194735	195343	0.91	+	.	g155.t1
Scaffold_20	AUGUSTUS	start_codon	194735	194737	.	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_20	AUGUSTUS	CDS	194735	195343	0.91	+	0	transcript_id "g155.t1"; gene_id "g155";
Scaffold_20	AUGUSTUS	stop_codon	195341	195343	.	+	0	transcript_id "g155.t1"; gene_id "g155";
# protein sequence = [MEVNKDFQNSDEGPDILPTSLRLLGSLPLTSGSSRDDDLEWPRPFPFTTWEEALGLSDLFDFHQVLHSDSKGFTDGDG
# DPASQVNTCASCMGCYITVSQNTAFIQPDYDSTLPPLADQVDWYSNIATPVDWDALLYPQVGNATAEDIAPLSSLPNGPSIMDSQAHSSFTDFQDIEV
# ADVTSQFSPPGISLASGNVCRSSIQH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g155
###
# start gene g156
Scaffold_20	AUGUSTUS	gene	201921	202403	0.82	+	.	g156
Scaffold_20	AUGUSTUS	transcript	201921	202403	0.82	+	.	g156.t1
Scaffold_20	AUGUSTUS	start_codon	201921	201923	.	+	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_20	AUGUSTUS	CDS	201921	202403	0.82	+	0	transcript_id "g156.t1"; gene_id "g156";
Scaffold_20	AUGUSTUS	stop_codon	202401	202403	.	+	0	transcript_id "g156.t1"; gene_id "g156";
# protein sequence = [MPTIANDDEDALKQAHVKSLKILLISCSPLLMIALEHGLTTAEAVTLAQQLVNCEKTKTRLINDGFNRYSLNAKDGLP
# SWFLDDETKHYKPNIPVTKEAIAVLRAKQRALDARLIKKIAEAKAWKKYKAAQKLEKAMKKAEGVNDTSDMSECELLLIVPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g156
###
# start gene g157
Scaffold_20	AUGUSTUS	gene	204416	205814	0.46	+	.	g157
Scaffold_20	AUGUSTUS	transcript	204416	205814	0.46	+	.	g157.t1
Scaffold_20	AUGUSTUS	start_codon	204416	204418	.	+	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_20	AUGUSTUS	CDS	204416	204550	0.48	+	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_20	AUGUSTUS	CDS	205134	205814	0.52	+	0	transcript_id "g157.t1"; gene_id "g157";
Scaffold_20	AUGUSTUS	stop_codon	205812	205814	.	+	0	transcript_id "g157.t1"; gene_id "g157";
# protein sequence = [MKVASDSHLMRTGRGGHEGAMEGQVEWDEEENWRVDEYGKFYMHSISPVNKCESFDEQRPILFTNVDSPSVALSYSRT
# MKRSVRPLKRAAKWERSTSNTLIVKGPIRRSPRNASKASQSSQATSMDFEPSLLQTPSDPEPFVVPDGFIKDGIQLSFPPSRDRYLPAIFSVHSHPRI
# PEDVRSEINRILIIPWPANNPSYNKFFFHYIKENVKIPGGRNASIPSTGKVLIIIPLDIVDLSPKAGENSFRVISYLFGIFQDQETHWMIYLKEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g157
###
# start gene g158
Scaffold_20	AUGUSTUS	gene	206279	206813	0.48	+	.	g158
Scaffold_20	AUGUSTUS	transcript	206279	206813	0.48	+	.	g158.t1
Scaffold_20	AUGUSTUS	start_codon	206279	206281	.	+	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_20	AUGUSTUS	CDS	206279	206307	0.48	+	0	transcript_id "g158.t1"; gene_id "g158";
Scaffold_20	AUGUSTUS	CDS	206393	206813	1	+	1	transcript_id "g158.t1"; gene_id "g158";
Scaffold_20	AUGUSTUS	stop_codon	206811	206813	.	+	0	transcript_id "g158.t1"; gene_id "g158";
# protein sequence = [MFLGLVLMTILTAFLEPTSIESLFFFGGVHIDKKDSNGGRTKILSFPDLPDGWEGGRFHLVEFGLYVELDGLIIANFS
# GLRLHGGTPPLAPTGAEIPAWAYRSVVVLYPQGPILDGQVVMNISADEDGIPIQLTPKMRNLTLRHPIAEM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g158
###
# start gene g159
Scaffold_20	AUGUSTUS	gene	213985	214917	0.8	-	.	g159
Scaffold_20	AUGUSTUS	transcript	213985	214917	0.8	-	.	g159.t1
Scaffold_20	AUGUSTUS	stop_codon	213985	213987	.	-	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_20	AUGUSTUS	CDS	213985	214917	0.8	-	0	transcript_id "g159.t1"; gene_id "g159";
Scaffold_20	AUGUSTUS	start_codon	214915	214917	.	-	0	transcript_id "g159.t1"; gene_id "g159";
# protein sequence = [MSSDAYRLLGELLSSPQGQELMRLHSQPVAGLQVPTSQPSLSGYSQSASLLSSSSVPLHPSAQSSTPQLPQPSALPSS
# SVQPMLNSSSVSPQIQSSVSQIQSSVSQPIQPSLVSLAASQPLQQSSSQSEHSLSLSQAQPQPINIPDRTVFPPPPSQCRPYSSLQMLASLGGSYSAG
# SGSIATSGHPRVTTSSGFPSMTTITRSNQTRLEHASTSLPHNPRKKTRGKAVRPPSIGQPSLPAVRNCISQAEGGVEVANLDFLVYPPMPPTSIQNVR
# YHINMLWEINSFDFPQIHSILDYHDTHMFIAEMPKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g159
###
# start gene g160
Scaffold_20	AUGUSTUS	gene	220018	220507	0.58	-	.	g160
Scaffold_20	AUGUSTUS	transcript	220018	220507	0.58	-	.	g160.t1
Scaffold_20	AUGUSTUS	stop_codon	220018	220020	.	-	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_20	AUGUSTUS	CDS	220018	220280	0.59	-	2	transcript_id "g160.t1"; gene_id "g160";
Scaffold_20	AUGUSTUS	CDS	220417	220507	0.96	-	0	transcript_id "g160.t1"; gene_id "g160";
Scaffold_20	AUGUSTUS	start_codon	220505	220507	.	-	0	transcript_id "g160.t1"; gene_id "g160";
# protein sequence = [MGFFKGSLTPVRRNSQATTHAKEISANNIAALVGGLLGFTLADRARTSLPSHSLIPTGGATKPTYGSPEDFGKAIEEL
# KRTFPGEDIVSTDPEDVYNHGFSVNDYHPGALTLLISPL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g160
###
# start gene g161
Scaffold_20	AUGUSTUS	gene	226038	226864	0.87	-	.	g161
Scaffold_20	AUGUSTUS	transcript	226038	226864	0.87	-	.	g161.t1
Scaffold_20	AUGUSTUS	stop_codon	226038	226040	.	-	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_20	AUGUSTUS	CDS	226038	226637	0.99	-	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_20	AUGUSTUS	CDS	226697	226864	0.88	-	0	transcript_id "g161.t1"; gene_id "g161";
Scaffold_20	AUGUSTUS	start_codon	226862	226864	.	-	0	transcript_id "g161.t1"; gene_id "g161";
# protein sequence = [METEEAGGTTEIVKDEIVGDKSGTTDTNITGSTNDPTHDPLESQKNVIGNEPAIGSPQRSQSKPRPGSRRLKTRPHAP
# TLSSMPALTDLSLHSPSNIVGTPFTVNSAPFEYPFPPNTTQSSEGLFPPLTPPSLLSASLSLSGPTVALSTSPPFGPDARSYSPTHPKMRTVDPPVPP
# GLAKKRQRWSLTLARRESSFLSQTSEGSTSSGSGTRSHRAFSLDDPPPAVHQQVAPSSPEQDLSRKTSPEPGTTDDNGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g161
###
# start gene g162
Scaffold_20	AUGUSTUS	gene	229381	229851	0.44	+	.	g162
Scaffold_20	AUGUSTUS	transcript	229381	229851	0.44	+	.	g162.t1
Scaffold_20	AUGUSTUS	start_codon	229381	229383	.	+	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_20	AUGUSTUS	CDS	229381	229851	0.44	+	0	transcript_id "g162.t1"; gene_id "g162";
Scaffold_20	AUGUSTUS	stop_codon	229849	229851	.	+	0	transcript_id "g162.t1"; gene_id "g162";
# protein sequence = [MTAVVFTSKTTSGSFQIDVVPVALHNIGANNQNIPVIDEGISIEDGHPRLNRNSVRVNVLGKETAVILKKIDELVDSG
# SWNDIPVMIMRGKGGKPLGITAVYEQANKAQKKSLEEQVKKMTCDKVVSVAKKHQILNRCVGRVILLFRLKLSKMHAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g162
###
# start gene g163
Scaffold_20	AUGUSTUS	gene	233210	233446	0.31	-	.	g163
Scaffold_20	AUGUSTUS	transcript	233210	233446	0.31	-	.	g163.t1
Scaffold_20	AUGUSTUS	stop_codon	233210	233212	.	-	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_20	AUGUSTUS	CDS	233210	233446	0.31	-	0	transcript_id "g163.t1"; gene_id "g163";
Scaffold_20	AUGUSTUS	start_codon	233444	233446	.	-	0	transcript_id "g163.t1"; gene_id "g163";
# protein sequence = [MAKSSSIIATSSSVDPVPYEDRITDSGLASPSDADHTGLDELCGRDLGIDEEDIAVEIELSDSSMPEAFRSGGNVLER]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g163
###
# start gene g164
Scaffold_20	AUGUSTUS	gene	238138	240085	0.13	-	.	g164
Scaffold_20	AUGUSTUS	transcript	238138	240085	0.13	-	.	g164.t1
Scaffold_20	AUGUSTUS	stop_codon	238138	238140	.	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_20	AUGUSTUS	CDS	238138	238779	0.81	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_20	AUGUSTUS	CDS	239095	239490	0.6	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_20	AUGUSTUS	CDS	239543	239783	0.87	-	1	transcript_id "g164.t1"; gene_id "g164";
Scaffold_20	AUGUSTUS	CDS	239887	239928	0.35	-	1	transcript_id "g164.t1"; gene_id "g164";
Scaffold_20	AUGUSTUS	CDS	240039	240085	0.36	-	0	transcript_id "g164.t1"; gene_id "g164";
Scaffold_20	AUGUSTUS	start_codon	240083	240085	.	-	0	transcript_id "g164.t1"; gene_id "g164";
# protein sequence = [MDNSIANLGRISSSKATVKISWVDAMYFPVVFLVTVHDPICTESGNLDNALYGSFLPVPAQSVFPNSTPDDYASEKAP
# GAVVARKERIVINKGRERIKLRVTNNGDRPVQIGSHYHFIETNRLLSFDRAKAYGKRLDIPAGTAVRFEPGDVKTVTLCSIAGGKIISGGNALASGVV
# NPDRTEEIINSLMQKGFGHVPEPGALEVTDDTDIGREAYISMFGPTTGDRIRLGDTELWIEVEHDKADIGVKDGLIVGIGKAGNPDVMANVHPSLIIG
# SSTEVIAGEKLIITAGAIDAHVHYICPQQVEEALAAGTTTMIGGGTGPSAGTNATTCTSSPFYMRHMLAATDGLAMNFAFTGKGNDAGRKALEDIVKA
# GAAGLKLHEDWGSTPATIRNCLDVGDDYDVQVNFLASIVCHILRYSLNLLCRSISILIPLTKVVSLRVSHPLPTAPRLPIKTN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g164
###
# start gene g165
Scaffold_20	AUGUSTUS	gene	244248	245668	0.67	+	.	g165
Scaffold_20	AUGUSTUS	transcript	244248	245668	0.67	+	.	g165.t1
Scaffold_20	AUGUSTUS	start_codon	244248	244250	.	+	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_20	AUGUSTUS	CDS	244248	245087	0.7	+	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_20	AUGUSTUS	CDS	245207	245668	0.89	+	0	transcript_id "g165.t1"; gene_id "g165";
Scaffold_20	AUGUSTUS	stop_codon	245666	245668	.	+	0	transcript_id "g165.t1"; gene_id "g165";
# protein sequence = [MALSATYTQASQNQAQAKLAERNRREAELKKRRLEQEKKDREREAQLRLKHFEQQKKEEEQKKKKKEERKAIEAVERR
# KAAEREALLHGPAKKTSSHRASQVRRKAPADNDDDNDGLKSEPLTREELRERKLQAELRRQFTSVKRSTTTGGYQRHGRHLPGGAVDVTTTGPPAPSS
# SGQSVKARLAAMPNTLTKLNTVKRDTRTIDEILQDRAKAKEQKILDGHEALAFDDWFGTKKKEQTRPSSIGPASGENTPKSTASVARESIVSHDPNLT
# DDGWAQSEKYSSSKLARPNASSSTSRPSTSISKKRARSSSRSESPRPKRRAISSEELDDVDNESLDVSGLIWGIMGKNRSHYVNMDVFSDDEDMEADA
# SALEREEKRRYILHHSLSLTCWFNDDFLAPVSLKKKNSLPWKKRGATKKIRDAVRCEFEPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g165
###
# start gene g166
Scaffold_20	AUGUSTUS	gene	264481	267356	0.56	-	.	g166
Scaffold_20	AUGUSTUS	transcript	264481	267356	0.56	-	.	g166.t1
Scaffold_20	AUGUSTUS	stop_codon	264481	264483	.	-	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_20	AUGUSTUS	CDS	264481	267262	0.99	-	1	transcript_id "g166.t1"; gene_id "g166";
Scaffold_20	AUGUSTUS	CDS	267352	267356	0.56	-	0	transcript_id "g166.t1"; gene_id "g166";
Scaffold_20	AUGUSTUS	start_codon	267354	267356	.	-	0	transcript_id "g166.t1"; gene_id "g166";
# protein sequence = [MSFVDDNSGPLQDIPTHIFGLDAQGRGQIYDQAEISSREEADSATVVKSAVDLVSNVKGTTGSDGSSNTTVAATDYIQ
# HAMTVMDSLADLGKVVPFVAPAFAIIKAIIAVEQRARDVDVKCTDLVQRVTFMLSHLPALKKIDVTNSTRQVIDRMNDTLKKSAALIQTYRKQSTIAR
# RLSVHNKDRFTSCASLLSQCTNDLMISLQIHQSTQLDILTRPVPFDLEDEAATKFVATHGGIDAVKGNEALVKQFASEMKLTVDENVMEQLNTNISVV
# LQQNQDRLEQSLNESVSASVIEGIRGLAAQMNESAKEQTFVCVQCDKEYKESTSGEKSCSFHRTEYDSWSKSYRCCGSANPCQAGRHRSEHHDQYPYG
# NFFVFARNITGYTDTTEKWTELEDSNLETSKKMTVSVARLLRWKSRGAQPELPTVLIRVGSVSISEPYLFRTYNTKDLEVITKVVDITHQTVIFRTSH
# SEQEFAMAEWVLSVAGVIIGVKITAKAATSFDPFIQVCPIDITSCTLSGDVRSLSEGGLRSYKPSTPYVLPDIQRVSATIHEDAPREVRIDFKTCTTP
# NLPIVMKPVSNPPLVANPQYANPETDYFAGTISVFNKHKVSSMEPISIASVAAFYRLVGEEKYQPVKSVELLDGITLPYSIDPRQTLTLQFGVVVPRS
# EDDVKVGTRWWNRAFVARQRPLRIKLVLTDIDEEECSLVLDYVCPVSNLETADKEDLAYFYVDDPLTWKRYGVHIAKDSRMGPEAVKIGNESRGADWM
# KSIVYKALKTGESEIALDVGADNDQGMPTAWSWKTWALVDLSCRRLYAFKILLTKCHGTAQSYACMGYVKCPVYGGFYEESRPIRYATEVTKFPELKP
# YVPSRILLDDEFDTFVPSEALKPTVASSSTQLAIPDEVQQRLVSIENSLSRLAISIELLVEIMKTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g166
###
# start gene g167
Scaffold_20	AUGUSTUS	gene	269388	270043	0.21	+	.	g167
Scaffold_20	AUGUSTUS	transcript	269388	270043	0.21	+	.	g167.t1
Scaffold_20	AUGUSTUS	start_codon	269388	269390	.	+	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_20	AUGUSTUS	CDS	269388	269463	0.3	+	0	transcript_id "g167.t1"; gene_id "g167";
Scaffold_20	AUGUSTUS	CDS	269673	270043	0.78	+	2	transcript_id "g167.t1"; gene_id "g167";
Scaffold_20	AUGUSTUS	stop_codon	270041	270043	.	+	0	transcript_id "g167.t1"; gene_id "g167";
# protein sequence = [MLAELPMLNVEAMTMLSLSKTGLTIKPPVREGRVQPQQSGTIQPQVNTVRGGGTFRGRGGMRGGVPNGGGGTGNMGMA
# NMGMGNMGMNMSNMMGNMMGNVGMGNMGMSNMGMGGFMGGGGAFSRGGGMMPRGGGMMARGGMMGLGTSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g167
###
# start gene g168
Scaffold_20	AUGUSTUS	gene	270943	272074	0.58	-	.	g168
Scaffold_20	AUGUSTUS	transcript	270943	272074	0.58	-	.	g168.t1
Scaffold_20	AUGUSTUS	stop_codon	270943	270945	.	-	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_20	AUGUSTUS	CDS	270943	271936	1	-	1	transcript_id "g168.t1"; gene_id "g168";
Scaffold_20	AUGUSTUS	CDS	271998	272074	0.58	-	0	transcript_id "g168.t1"; gene_id "g168";
Scaffold_20	AUGUSTUS	start_codon	272072	272074	.	-	0	transcript_id "g168.t1"; gene_id "g168";
# protein sequence = [MISTPSALLVAVLAMSAVTTFGAPIPFTPGTAVTREAHSVDARYADAVLPDKRAEAVDIGRRFPRRALYDYHTNVARE
# EAAKREPAPEPAKKTKKKRSNKKGRKAKRSLATREKGSCPCSSGSGSSSGATSTTGASSGDNSSTGSAAGSSASSTSSSDSGSGSSSSSSSGSMTGSC
# GSSSSGSSSTDTGSATSASGAAGSTDSGSSTDSGSAASATGAADSGSATSTASGTSATGSTDSGSGSTATGAANSTDTGSSTDSASGASASGSTDSGS
# ATSAASGAASTDAASGSADSGSATGTAAAAGSTATDASSASTPAAAAAGASASASSSASAGRREIKSRVTRRSYSPVGPWRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g168
###
# start gene g169
Scaffold_20	AUGUSTUS	gene	273580	274044	0.73	-	.	g169
Scaffold_20	AUGUSTUS	transcript	273580	274044	0.73	-	.	g169.t1
Scaffold_20	AUGUSTUS	stop_codon	273580	273582	.	-	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_20	AUGUSTUS	CDS	273580	274044	0.73	-	0	transcript_id "g169.t1"; gene_id "g169";
Scaffold_20	AUGUSTUS	start_codon	274042	274044	.	-	0	transcript_id "g169.t1"; gene_id "g169";
# protein sequence = [MYHTSQERTSVCFRLISILSSNSAPLTKGNEGTTFSESVEGLNLTGAAQDEAFVNFIGHLVIDNSTLTTDIYDKMLTL
# WPANDPLLGAPFNTGDSLFDRAEAWYTDQMFLSPRRLFFENGASLQPMFAYYFREFIPGQNPALGGRFVSSNEATC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g169
###
# start gene g170
Scaffold_20	AUGUSTUS	gene	275875	276588	1	-	.	g170
Scaffold_20	AUGUSTUS	transcript	275875	276588	1	-	.	g170.t1
Scaffold_20	AUGUSTUS	stop_codon	275875	275877	.	-	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_20	AUGUSTUS	CDS	275875	276588	1	-	0	transcript_id "g170.t1"; gene_id "g170";
Scaffold_20	AUGUSTUS	start_codon	276586	276588	.	-	0	transcript_id "g170.t1"; gene_id "g170";
# protein sequence = [MSKSHGQRAEDKTDELKQLNRSIFRPVITFNKDAKRRAQEAKIQDRYEEERQERERTMLDVRETQDRLGRAATYGRGN
# DDENLLYSGPPGGVGEEGISGGGNGRFRKSEQQRVRNRELNSRYRFEATASDDELEDELDENLDEISDVTKRLKALGSAMSQELDSQNRRIDNITSKT
# DGVDMKLANLTRRVSISTVSPDFMNLMIHFFHQYSKRNSDLPAQYTTTSKFLIKGTLFLYT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g170
###
# start gene g171
Scaffold_20	AUGUSTUS	gene	276640	277224	1	-	.	g171
Scaffold_20	AUGUSTUS	transcript	276640	277224	1	-	.	g171.t1
Scaffold_20	AUGUSTUS	stop_codon	276640	276642	.	-	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_20	AUGUSTUS	CDS	276640	277224	1	-	0	transcript_id "g171.t1"; gene_id "g171";
Scaffold_20	AUGUSTUS	start_codon	277222	277224	.	-	0	transcript_id "g171.t1"; gene_id "g171";
# protein sequence = [MPSFFRKEKNLIPPVEPSTSNSSTRSKSPSVLSKSSLPSYRSNASTYVASRDGDPYSATLPPPSVPAQSNDNGGESYI
# DRYRRGNSVGDVYSRGNAQPDQDRSELFAGYNPQKSGSGRFFDGPGAGRDPAPGEENDEDVEGIKTQTRFIKQESVNSTRNALMMARQAEEAARGTLS
# KLGDQSGSQYLSLSKCLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g171
###
# start gene g172
Scaffold_20	AUGUSTUS	gene	277428	278829	0.65	-	.	g172
Scaffold_20	AUGUSTUS	transcript	277428	278829	0.65	-	.	g172.t1
Scaffold_20	AUGUSTUS	stop_codon	277428	277430	.	-	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_20	AUGUSTUS	CDS	277428	277754	0.78	-	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_20	AUGUSTUS	CDS	277867	278829	0.83	-	0	transcript_id "g172.t1"; gene_id "g172";
Scaffold_20	AUGUSTUS	start_codon	278827	278829	.	-	0	transcript_id "g172.t1"; gene_id "g172";
# protein sequence = [MRKQPFYLYVPPWSWDKASAGLGTACLPMFSHLFSDEAANGGSAGKKDASADVIKNIVLSFLDVAEDDFSMSTPLTSY
# GLDSLSAGHLSVALRPYLQIAQMQLLSDITTEDIVNLTQGDGDEDDEGSSSAPASKLAPVIYNASSVQEKRYDWQIPPNQPGETLIKMIDRPGETPLI
# FTHGGGGNLLTFVPLQEQFTSALWGVQVTPETPLESVERTAKFYYEKIKEAQPHGPYRIGGYCASALIAYELVYQFQQAGDEISQWVMLDFSPAIFGS
# YHFTAGLDEETIRTKVPTKDVIGIGIRLMDRMTELDTNEGAKTVITEHRAFSGIGLGALDLFFTLAGNDEKILRDPAALEQRMIEWAARVKVPMQLVL
# PRQSGARSLFPDGDASWEMLGTERFAKNFERFDVNGGHLTMMEDPKLAQFLEFGARK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g172
###
# start gene g173
Scaffold_20	AUGUSTUS	gene	278895	280790	0.29	-	.	g173
Scaffold_20	AUGUSTUS	transcript	278895	280790	0.29	-	.	g173.t1
Scaffold_20	AUGUSTUS	stop_codon	278895	278897	.	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_20	AUGUSTUS	CDS	278895	279335	0.58	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_20	AUGUSTUS	CDS	279483	280790	0.29	-	0	transcript_id "g173.t1"; gene_id "g173";
Scaffold_20	AUGUSTUS	start_codon	280788	280790	.	-	0	transcript_id "g173.t1"; gene_id "g173";
# protein sequence = [MEAVAQRFWPRLPVRSWKRRNCAKARDIFSKPSAVAELSIVEYPTNANVNPNSLLALQTTFSQLRQSGPKELWLHANS
# DEASGSAAGFSRVLRVEVPDLQLYMVFFDSAWDVERRTAFIRSIAHLQNLDKEFEVDDSGTILVPRYVPSAIPNASLNDESTVSLDSVVPPTLIPEQY
# ILVEVLTASEVHAGFKGVVGRVIKSKASQWKEGKDVVGVVTVTQKDFPTPYIVAHEGQFASLQDSSIEPDTSAFLALSMAIIGIALGITSIRDIKRLQ
# RRKIGVVGIMNKDICELLLALGVNAKVASTNPEENSLTVLRGSDFVIASGLDKNDAQVIRGSVRPQTSVFIWDDPATGLATELSRNPWLIGDIIAEFY
# THHKPTIETHSIPAKVNVIESQTSKTLFRADRSYLLVGGIGSMGLKIALWMYEVGSFFTFHGRQLEACDGASAGAMTNLISSLSLPLAGVMLLSASIN
# DRLFSAHDEDSWSSPFVSKVHVFKALEASCSLESLDFIIMFSSATILGSLGQANYAGANSAVDFLVRKLPNAFSIVCPAILDSALFEATNELNTDVTR
# WSTWGMTCSGKHFI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g173
###
# start gene g174
Scaffold_20	AUGUSTUS	gene	282126	283184	0.59	-	.	g174
Scaffold_20	AUGUSTUS	transcript	282126	283184	0.59	-	.	g174.t1
Scaffold_20	AUGUSTUS	stop_codon	282126	282128	.	-	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_20	AUGUSTUS	CDS	282126	283184	0.59	-	0	transcript_id "g174.t1"; gene_id "g174";
Scaffold_20	AUGUSTUS	start_codon	283182	283184	.	-	0	transcript_id "g174.t1"; gene_id "g174";
# protein sequence = [MQLSVILLAKPLCFMPSGATSKALALEIAIARGLAVAELEALEGSMVAFSCDPIVADDIINEVRASIDAPKMILDVAC
# YNAETAVVLAGHVLLLEKAKEIAKARNIMVNQIATRVPFHSTMMEACKASYLKRVSEVFAKYRAEDCIPKIPAYSTMTGEIWNGAFTADYFWDNARSP
# VEFLSAINSILVDMPNATFLEISPHPVLSSYVSSIRGSADVVFCGMRRKREYPQFGEYTQMMETIGGLAVTGYDSIDIRALTGVRSPPIPSPFKYPFS
# KKEVPVYSDVCRTSLDHMDATYRGPLCSSPLRINSSTHPDLTQHVINSQPIMAAAGFLEMVRLIYSFVSVSDSDITGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g174
###
# start gene g175
Scaffold_20	AUGUSTUS	gene	283456	283998	0.38	-	.	g175
Scaffold_20	AUGUSTUS	transcript	283456	283998	0.38	-	.	g175.t1
Scaffold_20	AUGUSTUS	stop_codon	283456	283458	.	-	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_20	AUGUSTUS	CDS	283456	283998	0.38	-	0	transcript_id "g175.t1"; gene_id "g175";
Scaffold_20	AUGUSTUS	start_codon	283996	283998	.	-	0	transcript_id "g175.t1"; gene_id "g175";
# protein sequence = [MASLCKVLWIFQDRLVPPNVKLNKLNQKVKWKQWKLRVPTEIEPIEPRHPSGKLLISMNSSGIGGSNAHVLVESHELN
# VALPNEIPSNYPVLLLAGALSDSSTSAVAKQLVTLADGNKDIAALSLAFGRRSMQMNWRSFSVTLPGATPIFSSPDSSHGIDLPLYGCVQVCPSITDI
# ISRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g175
###
# start gene g176
Scaffold_20	AUGUSTUS	gene	307165	308691	0.84	-	.	g176
Scaffold_20	AUGUSTUS	transcript	307165	308691	0.84	-	.	g176.t1
Scaffold_20	AUGUSTUS	stop_codon	307165	307167	.	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_20	AUGUSTUS	CDS	307165	308691	0.84	-	0	transcript_id "g176.t1"; gene_id "g176";
Scaffold_20	AUGUSTUS	start_codon	308689	308691	.	-	0	transcript_id "g176.t1"; gene_id "g176";
# protein sequence = [MQAQYGGPDAQTTSNYCRKYRTQPSDTSQLRSAPHRYTHSKSTQLFHPSIYLLILPVQDMPIDFTDSTKTTLLSNVSL
# QNGEKAKKPHFVIPLPSYNPKSKRRPAKPNTIDRLRKMTYDPREGETITPFSTAPWRRTERDWEGRLTIRGTLGQDKKDAAKEHKERMLDITKLDSHL
# VLYSDGSQQLEEGRLLTGYGFVGYRRGEEIFSRMGGMGTTAEVYDAEMAGLAHGAAKSVHYAIDSPSIHHILIFADNSSAITTIYDQKPVAACQSYAQ
# RFRHSIEQFLESDQRNTVEIAWCPGHEDIVGNERADGLAKEAGKLWAPTFHTFTHAKRRAKAKALEDWKKEHARRPPRGGFALADGLPPCWKPRDYFN
# NTPREVYGRLIQCRTRHAFLGEYYAKFVPTESIQCPCGARTQTRDHIIQTCEIYDDYRDLLWDVSDDLDMGEILGTEEGIEALAEFIEKSGAFKKTGQ
# LTPEIREPRPEDAMVEEGNEEDWEEDGRIAEEASDDED]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g176
###
# start gene g177
Scaffold_20	AUGUSTUS	gene	310252	311628	0.9	-	.	g177
Scaffold_20	AUGUSTUS	transcript	310252	311628	0.9	-	.	g177.t1
Scaffold_20	AUGUSTUS	stop_codon	310252	310254	.	-	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_20	AUGUSTUS	CDS	310252	311628	0.9	-	0	transcript_id "g177.t1"; gene_id "g177";
Scaffold_20	AUGUSTUS	start_codon	311626	311628	.	-	0	transcript_id "g177.t1"; gene_id "g177";
# protein sequence = [MAYTKRRPDYKITLRSDLARDLDIQIIDIMQGTHPVTTIVNLYSQPRARSSHGRRKPDASERLQKIQLPTTTPVIISG
# DTNQHHNDWSLSRVTPTLKTQQFVNWLTDGGFTLMNEKGVPTYFEHSSRGASSTIDLTFVNPVAHALDAAKEWTVDAENSCGSDHHALRWVIDFGGVE
# VENVFGLKYNFEKTDPTEWKTAFSKEIQAHEERWMNVKRLNQPRSAAQLDEDVQTITDALKTATAQTTPERQPNARAVPYWSKKLDEANAARADLRRH
# QLDYRRRWGHNNPALQSQIRTANNYFRKLLRHHKHGWINKTLEEITPEEIFDIRKWTQGSRTYPSPAIKRTGQEPAVDMEEKQEALRNVLFQPGFAVP
# PQDPPNLTEDLPGDIPHERLTRTEVKEAIYDQSPSKAPGDSQITFRAIRWAWEAEEDLIFSVMHHCIEAGHHPQPWRRAIQCSRAP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g177
###
# start gene g178
Scaffold_20	AUGUSTUS	gene	313998	315395	0.53	+	.	g178
Scaffold_20	AUGUSTUS	transcript	313998	315395	0.53	+	.	g178.t1
Scaffold_20	AUGUSTUS	start_codon	313998	314000	.	+	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_20	AUGUSTUS	CDS	313998	315395	0.53	+	0	transcript_id "g178.t1"; gene_id "g178";
Scaffold_20	AUGUSTUS	stop_codon	315393	315395	.	+	0	transcript_id "g178.t1"; gene_id "g178";
# protein sequence = [MNAIEQPPEKRSNVFSGSPPRNNPNPNVNVNTNPPPTTNSAKPPSSGTHSQPQPKPLNAPTQPPAGQPAQPVPPSNLA
# NLPPPNSTQKIPWPGIGNLTPNELFQRLRHFEDMRRRTDAVLTQAINSGDSSKVEMVKQQTAQWEPMFFKVRNMVSHYITALRRAGMAGPGAPGGAPG
# QVQASTSTGVGAPTNNLNPNPGNTDISSQPPTTQSNPHPNPPSSSNVASSPATKPNDSLMPVNSSITSATSPGLSAPALSSSTPSSKSPSKPSPKPSA
# IKPSPKPKPKGSPIKNAALTVSTAPSIGASSTAGSSTSTNPAVDGSGPNLASGLPIPSSLPPEAALQMQKLMEQGGRGHPRDMAMGSMGQVSPNVTAA
# GVAPQPSPQGMQGMMPGQGQSGQQPQVGGVVGPAGVGAMSSGSVSNTPSTSAGGQNGGIPAWTGGLFYPGEPNGTRKDFRISVMAMSANHLEW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g178
###
# start gene g179
Scaffold_20	AUGUSTUS	gene	315896	316672	0.77	+	.	g179
Scaffold_20	AUGUSTUS	transcript	315896	316672	0.77	+	.	g179.t1
Scaffold_20	AUGUSTUS	start_codon	315896	315898	.	+	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_20	AUGUSTUS	CDS	315896	316672	0.77	+	0	transcript_id "g179.t1"; gene_id "g179";
Scaffold_20	AUGUSTUS	stop_codon	316670	316672	.	+	0	transcript_id "g179.t1"; gene_id "g179";
# protein sequence = [MPGGLLGRLPGGVSGESIGAPPAGGAGGGGPTPGTNIGPPNILAILQSFRVPPDLTARILQMPPERQIMALKSLAQTK
# AQLRGQGPGQGGAASGSGQAGIAGMHKSGGSNVNITAAAAAMALRMQQSGGIGIPQGMQGGMQGTSGLNMAGIQRQLSGQDGNKPNPQGAANIAALIN
# GMRGNMGGMGGMNAANMGGTAAGNMFQQQMAQMQQMQQNRSIFGGPAGTGAGGVGGKNLSLDMIQSFMHRNGQEGQGGGQGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g179
###
# start gene g180
Scaffold_20	AUGUSTUS	gene	328307	328648	1	+	.	g180
Scaffold_20	AUGUSTUS	transcript	328307	328648	1	+	.	g180.t1
Scaffold_20	AUGUSTUS	start_codon	328307	328309	.	+	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_20	AUGUSTUS	CDS	328307	328648	1	+	0	transcript_id "g180.t1"; gene_id "g180";
Scaffold_20	AUGUSTUS	stop_codon	328646	328648	.	+	0	transcript_id "g180.t1"; gene_id "g180";
# protein sequence = [MNSNQQNEDEREQGGNHDRQTRAQVEQETHTRREAPLEPEQEEIRISRRARSGLEEHEDAEASDSQKKPKANVGKFKW
# NDANSFLESIFTLTPAHQMVWEQVRNYVADIKESL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g180
###
# start gene g181
Scaffold_20	AUGUSTUS	gene	335839	336426	0.93	-	.	g181
Scaffold_20	AUGUSTUS	transcript	335839	336426	0.93	-	.	g181.t1
Scaffold_20	AUGUSTUS	stop_codon	335839	335841	.	-	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_20	AUGUSTUS	CDS	335839	336426	0.93	-	0	transcript_id "g181.t1"; gene_id "g181";
Scaffold_20	AUGUSTUS	start_codon	336424	336426	.	-	0	transcript_id "g181.t1"; gene_id "g181";
# protein sequence = [MNTNLAYGSNISSGTSPQARGTPIALELQGRQPGNDKPTAPMGAHSPSQTAQIRFVEKYGHAESGAPQGFKAGAPNCV
# DELLKWMFENWQPNTQYALTYVNSFYEVLSDGFAQPPDIFEFYVSGFAECFAKTAFVQDPKNPRKSIPPPPSCRVVVKSNKLKGKITVYQEDMKKGTS
# MLFSKELPENLWRPGKTIY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g181
###
# start gene g182
Scaffold_20	AUGUSTUS	gene	343508	344509	0.61	+	.	g182
Scaffold_20	AUGUSTUS	transcript	343508	344509	0.61	+	.	g182.t1
Scaffold_20	AUGUSTUS	start_codon	343508	343510	.	+	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_20	AUGUSTUS	CDS	343508	344509	0.61	+	0	transcript_id "g182.t1"; gene_id "g182";
Scaffold_20	AUGUSTUS	stop_codon	344507	344509	.	+	0	transcript_id "g182.t1"; gene_id "g182";
# protein sequence = [MTRIRTTLTTTTTHSNPARLSAKVRKLMNASVAAKTQSRKRNNITEFLDWAHQQHLHAKDVLPASEITLCEYAAEFGG
# KLAGSSVKAKLSAIKGWTITKGYAWQGSDRLRKVLASIERSAPPSSFRPEREPVKKSHLSMLHEDLDLSDTNGLDCCIAAAADLMFYSQLRAGEVLPT
# NSSIAQYDFKAMPRVSDLSKANNAGSKKLFLPKTKTSQMRGDKVMVPVQQGSTNPIHSLDNHIHVNKLAPSDPLFAYMDTKGTKHILTKTLFLRRCNA
# IWKRHSISRRTGHCFRIGGTTHYLLAGVNPDVVQVFGRWKSSAFLKYWRNRVTCFTTFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g182
###
# start gene g183
Scaffold_20	AUGUSTUS	gene	353865	354992	0.99	-	.	g183
Scaffold_20	AUGUSTUS	transcript	353865	354992	0.99	-	.	g183.t1
Scaffold_20	AUGUSTUS	stop_codon	353865	353867	.	-	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_20	AUGUSTUS	CDS	353865	354992	0.99	-	0	transcript_id "g183.t1"; gene_id "g183";
Scaffold_20	AUGUSTUS	start_codon	354990	354992	.	-	0	transcript_id "g183.t1"; gene_id "g183";
# protein sequence = [MAQTTLPETHRILQLTSTSEPLQLKTVPTPQAGPGSAVVKVLAAGILSYSADIYNGKRQYPFPKPLVPGSSAIGRIVA
# VGPDATTLVPGQLVFLDCTIRGRDNSEAVILSGISEGFIEASKKLMHGEWRDSTYAEYTKFPLENCIPLDEQRLLGPVEAGGLGYCVEDLMHISKLVV
# PYGGLNDIGLKPGETVIIAPATGPFGSAAVRVALAMGAGRVIAMGRNETMLHKLSTLDTRIFTVRITGNEKTETDALKKLGPIDVFFDISPFMAANST
# HFKSAIAALRHSGRISLMGGVYADMSFPYLSFMHRNLTMKGTWMFSREQMFAFVKLLESGLLPLGEKNGLSVGGKFELEEWEEAFEKARVAGAGEVVV
# IVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g183
###
# start gene g184
Scaffold_20	AUGUSTUS	gene	358220	359962	1	+	.	g184
Scaffold_20	AUGUSTUS	transcript	358220	359962	1	+	.	g184.t1
Scaffold_20	AUGUSTUS	start_codon	358220	358222	.	+	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_20	AUGUSTUS	CDS	358220	359962	1	+	0	transcript_id "g184.t1"; gene_id "g184";
Scaffold_20	AUGUSTUS	stop_codon	359960	359962	.	+	0	transcript_id "g184.t1"; gene_id "g184";
# protein sequence = [MTSLLTKPTNQTSDSSPSVILADLRPRREGLRSSVRASGPKPSSHSASSSSSEEFDPSHIAHTPPDQILTPIPVPDIP
# TRTCSPISSDEDIMTARLNESGNVELCHGKYGPCVKPTAVLSPEDLDDLYEDARRFAKLHSGDNIENVREVIADAFSPRVHRDWFRAEKNTHLALALE
# VKDPNNQTSPPTFPFLDALCRKFCGHDWAQVHAARRDDLRMSIGGVGCFDEYLSQVEGCNNRLKGVGNYLTPAQLLTILARGISATLTAILSEQGIVI
# DETTIYKDWITSCHDLEVRFKTRLASADRTNRRGNFPTNGGPNNVPPHKRTATSKPTGHPNKRSTNDGSGAGPFYMRAFSKMPEAMQKEQRELLSCIS
# ACVKCRTAWGTCASNLDKCTGATLSVPWRPLTKEMVDWAIAAHKSTGRPILYNAILKQANSNTSVASVLGPPLEDISAYVTNETVCAPPAAAIYGTRA
# VAHVARDDNVYGNYAGPSMRRSSASSSSFSSRVVAPVVGQYRLTHDNAEEDVDWSDGSVSPSPSSRTRPIANIEKELSSGSEEDELRTSNKVRVPAML
# FELPHFVWTQRV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g184
###
# start gene g185
Scaffold_20	AUGUSTUS	gene	360100	362808	0.28	+	.	g185
Scaffold_20	AUGUSTUS	transcript	360100	362808	0.28	+	.	g185.t1
Scaffold_20	AUGUSTUS	start_codon	360100	360102	.	+	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_20	AUGUSTUS	CDS	360100	361757	0.28	+	0	transcript_id "g185.t1"; gene_id "g185";
Scaffold_20	AUGUSTUS	CDS	361878	362808	1	+	1	transcript_id "g185.t1"; gene_id "g185";
Scaffold_20	AUGUSTUS	stop_codon	362806	362808	.	+	0	transcript_id "g185.t1"; gene_id "g185";
# protein sequence = [MSEGTPQIFEATHFCKLSLEDPSGGWSSHVVRALVVPSLCYPMVLGIPFLAHNFLITDYAARTIMDKTSGFDLMNPHI
# PVPPLPSLSPRDRRREIFHTYEDTLEKKKIVLVELHAYFRDHPRLYRSDPVLPINVAAAIRSRIEHLSALEDLEKRSTELKLRFNDVFGDIPHIDELP
# ADITCNISLKDANMTMQSRGYASPRKYREAWSVLIEKHLQAGRIRPSSSQFSSPAFLIPKSDPTALPRWVNDFRKLNANTIPDRHPLPRIDSILADCA
# KGQIWGKMDMTDSFFQSRMSPESVPLVSVQTPLGQYEWLVMPQGLRNAPAVQQRRVTQALREYIGHFCHVYFDDIIIWSKDVEEHAHHVELILEALRS
# AKLYCNPKKCQFFQLELDFLGHHISRHGVEAQSSKCEAILHYPSPTSASEVRRFLGMVRFVAGYLENLAEHTRILTPLTKKECEKHFPLWTREHEHAF
# ISIKTLVLSRQVLTTIDHDNPGDNHIFLVTDASDWRHGAVLMWGPTLDTARPVAFDSAQFSKAELNYPVHEKELLAIVRSLRNQFDLEIAYIRGDDNP
# AADALSRIRAGALPSDPMNCVSEPSVNVDSWKANLFMCASILSLTADKEFLRRIKEGYVSDPFVLKLVEGGSLIPNVTHQNGLWFVAGCLVIPAYSSL
# CEDLFHLAHDTCGHFGADKSYAMLADSYYWPHMRHDLCKYYVPGCEECQHNKGRTAKNRKGPLHPLPVPEGCCDSVAMDFIGPLPRDQGFDCILTMTD
# RLGSDLKIIPTTVDITAPALAKLVFDHWYCDNGLPLEWVSDRDKLFVSDFWSTLNKLTGVKIKMSSSFHPETDGSSERSNKTVNQCIRFYVECNQMGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g185
###
# start gene g186
Scaffold_20	AUGUSTUS	gene	362839	363615	1	+	.	g186
Scaffold_20	AUGUSTUS	transcript	362839	363615	1	+	.	g186.t1
Scaffold_20	AUGUSTUS	start_codon	362839	362841	.	+	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_20	AUGUSTUS	CDS	362839	363615	1	+	0	transcript_id "g186.t1"; gene_id "g186";
Scaffold_20	AUGUSTUS	stop_codon	363613	363615	.	+	0	transcript_id "g186.t1"; gene_id "g186";
# protein sequence = [MNSVNSSTWFIDVPTTLWPLPTSSPSPAGGSLSDVPNPSTDALAAREFLDQIQLTVREARDNLTLAKVVQSYQADKHR
# GPCELFEEGDLVMLSTYHRREVFKKAGEKRAAKFFARFDGPYEVIQAFPATSHYTLDMPNQLNAFPSFYVDQLKRFVPNSSTLFPGRQQRIPTPTIVD
# GHKEFDIERILDSRRRGCGWQFLVRWVDQSPSEDRWLPYNALHECEALDDWVRNGGDGPPCFLTRWIWIELVFIASDFATNS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g186
###
# start gene g187
Scaffold_20	AUGUSTUS	gene	364688	364963	0.67	-	.	g187
Scaffold_20	AUGUSTUS	transcript	364688	364963	0.67	-	.	g187.t1
Scaffold_20	AUGUSTUS	stop_codon	364688	364690	.	-	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_20	AUGUSTUS	CDS	364688	364963	0.67	-	0	transcript_id "g187.t1"; gene_id "g187";
Scaffold_20	AUGUSTUS	start_codon	364961	364963	.	-	0	transcript_id "g187.t1"; gene_id "g187";
# protein sequence = [MRLPPTKGERYEFHFPGIDITGNQYSLLGASNFEKNFLGEGMDFASDDGMDSDWVPTSDNDTSSSESDLEANSEISDD
# ELEEYKSLPSWFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g187
###
# start gene g188
Scaffold_20	AUGUSTUS	gene	368598	369155	0.96	-	.	g188
Scaffold_20	AUGUSTUS	transcript	368598	369155	0.96	-	.	g188.t1
Scaffold_20	AUGUSTUS	stop_codon	368598	368600	.	-	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_20	AUGUSTUS	CDS	368598	369155	0.96	-	0	transcript_id "g188.t1"; gene_id "g188";
Scaffold_20	AUGUSTUS	start_codon	369153	369155	.	-	0	transcript_id "g188.t1"; gene_id "g188";
# protein sequence = [MALLSDKELISLLQEESYEGDVEQLQDDNELLQEEYEELGRENMKCKAVYSHYCKLLNLGQNPSMIGSVSTLGTSSSH
# IQYTVAPSTIMVPVRCTHSVWSLNVLTSKRLITVCRDWYKAGIEFLYTDIAIYWMQQLFSLLWTLQSRPHLALKLVSIDIGCFVPPDDAETFDGALGS
# LASTCPKLT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g188
###
# start gene g189
Scaffold_20	AUGUSTUS	gene	373766	374194	0.37	+	.	g189
Scaffold_20	AUGUSTUS	transcript	373766	374194	0.37	+	.	g189.t1
Scaffold_20	AUGUSTUS	start_codon	373766	373768	.	+	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_20	AUGUSTUS	CDS	373766	374194	0.37	+	0	transcript_id "g189.t1"; gene_id "g189";
Scaffold_20	AUGUSTUS	stop_codon	374192	374194	.	+	0	transcript_id "g189.t1"; gene_id "g189";
# protein sequence = [MHRLLTFKGYRFRDFARPSQSQPTAANANLKSAVELEEEDRAAQSAKLQELIRRGTPRDLAAAQELMKSLAGADPEAK
# PDYKTQALHEINKLESKVVLMNEMLDNVDMERGEKFVEGDAYDQVAEILRAARPKLQNGRAKWM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g189
###
# start gene g190
Scaffold_20	AUGUSTUS	gene	374607	375139	0.28	+	.	g190
Scaffold_20	AUGUSTUS	transcript	374607	375139	0.28	+	.	g190.t1
Scaffold_20	AUGUSTUS	start_codon	374607	374609	.	+	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_20	AUGUSTUS	CDS	374607	374612	0.28	+	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_20	AUGUSTUS	CDS	374708	375139	0.92	+	0	transcript_id "g190.t1"; gene_id "g190";
Scaffold_20	AUGUSTUS	stop_codon	375137	375139	.	+	0	transcript_id "g190.t1"; gene_id "g190";
# protein sequence = [MPFPSSAPVVASTPPIGVMHGTGGAGMGMGMNSALGYGSPFGPSGNVGPRNSSPAPAAPHTPNYFSGPAGSGTVGVNM
# GMGMGVARIGTPSTPQTMQPMNVMGSMQSSQSSQLMQTQLPAQNGSSMSSQPPATQAKDPFADLAGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g190
###
# start gene g191
Scaffold_20	AUGUSTUS	gene	378772	379434	0.89	-	.	g191
Scaffold_20	AUGUSTUS	transcript	378772	379434	0.89	-	.	g191.t1
Scaffold_20	AUGUSTUS	stop_codon	378772	378774	.	-	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_20	AUGUSTUS	CDS	378772	379434	0.89	-	0	transcript_id "g191.t1"; gene_id "g191";
Scaffold_20	AUGUSTUS	start_codon	379432	379434	.	-	0	transcript_id "g191.t1"; gene_id "g191";
# protein sequence = [MLIQPIPITPTFTSTAFTPTFIGSPTALIAIARTSRDGDGYRYGDGDRYWDVVVPQPIELPRLLVFGDGMEVDDVVDD
# AGDSDGDDDVDVVDVVLDADADSDSDSESTTSTTSHISDISSMTSVSSSSSIAKSSPAAAGVVYVPPPMRMYKHSTTKSFTKSSPESESALESEYEFD
# FESSIPSHRLLSRSRFQHSSKSYPIPIPNPQIHIQIHIQIQIPV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g191
###
# start gene g192
Scaffold_20	AUGUSTUS	gene	387335	388252	0.97	+	.	g192
Scaffold_20	AUGUSTUS	transcript	387335	388252	0.97	+	.	g192.t1
Scaffold_20	AUGUSTUS	start_codon	387335	387337	.	+	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_20	AUGUSTUS	CDS	387335	388252	0.97	+	0	transcript_id "g192.t1"; gene_id "g192";
Scaffold_20	AUGUSTUS	stop_codon	388250	388252	.	+	0	transcript_id "g192.t1"; gene_id "g192";
# protein sequence = [MYGGVGCVGTPIVRTDAAALWATGKTWWQVPRMIRVELKGRLRAGVTGKDVIVALCGAFGKDEVLNGAVEFCGEGVES
# LTVEERLTIANMTTEWGALSGVFPVDRTLVDYYDGVVDKLERRTFGGEGIPPPPEHPRLNRTRVDSLRRTHSTSFTSDPAATYALRLSFDLSSLVPHV
# SGPNSVKIATPLPKLEDKSVQVNKAYLVSCTNSRVGDLKSAADVFRGYETPSSSASPVSASASPDVSTIKHHVHPSVQFYIAAASSVVQAESEARGDW
# DVLVRAGAKVLPAGCGPCIGLGVGLLEEGEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g192
###
# start gene g193
Scaffold_20	AUGUSTUS	gene	388899	389924	0.56	+	.	g193
Scaffold_20	AUGUSTUS	transcript	388899	389924	0.56	+	.	g193.t1
Scaffold_20	AUGUSTUS	start_codon	388899	388901	.	+	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_20	AUGUSTUS	CDS	388899	389234	0.56	+	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_20	AUGUSTUS	CDS	389559	389924	0.97	+	0	transcript_id "g193.t1"; gene_id "g193";
Scaffold_20	AUGUSTUS	stop_codon	389922	389924	.	+	0	transcript_id "g193.t1"; gene_id "g193";
# protein sequence = [MSRSQMGEVVLENYSQNASGVLQTLRRSLIEPWVHPTTAAEALTTNTTSPSSTSTTSSPKSTPSTTPSTSSSMTSNAN
# PNSTTISAPLLISGFNFGTGSSREQAATSLLAAGRNAINNGLICLECPSLVDYLTSTYSTQLEGGRRSAGAGNGVMIYDSAKAHNANADNNMSSSGLK
# LGLEVDMAEGVMMLSDGKKESKFTFKSVGTSVQELWICGGLEGLVLKELREAREGKA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g193
###
# start gene g194
Scaffold_20	AUGUSTUS	gene	390191	390541	0.71	+	.	g194
Scaffold_20	AUGUSTUS	transcript	390191	390541	0.71	+	.	g194.t1
Scaffold_20	AUGUSTUS	start_codon	390191	390193	.	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_20	AUGUSTUS	CDS	390191	390541	0.71	+	0	transcript_id "g194.t1"; gene_id "g194";
Scaffold_20	AUGUSTUS	stop_codon	390539	390541	.	+	0	transcript_id "g194.t1"; gene_id "g194";
# protein sequence = [MVVKSLNHLPIPTSANNGPRSVSTRRYVAGVVFGIFFSLQLGRYAFDLGKNLDITVDDVTSWTHNVNVAHFCPQVTAL
# YPQSSVNAETWTEFGELLETEKFKTLAIEKLSGLIQIP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g194
###
# start gene g195
Scaffold_20	AUGUSTUS	gene	399467	400357	0.55	-	.	g195
Scaffold_20	AUGUSTUS	transcript	399467	400357	0.55	-	.	g195.t1
Scaffold_20	AUGUSTUS	stop_codon	399467	399469	.	-	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_20	AUGUSTUS	CDS	399467	400357	0.55	-	0	transcript_id "g195.t1"; gene_id "g195";
Scaffold_20	AUGUSTUS	start_codon	400355	400357	.	-	0	transcript_id "g195.t1"; gene_id "g195";
# protein sequence = [MLSNKSSQRRSPIADRSCNLSKFSGPSQSENEGSTPEPDLCTCTPGEKHLCWDVDYEVYGVIHNNDIGCITCNDFASH
# IHHSRQQKVRGIEEAYAKMHEHHDILWRRGLKEGARRYSSTAPLDDLQVLEEDLNIAQMKQAKAEEELKYLTRVVLGQISLVEFLSTFTHPTFATREE
# FWLSISDTAAANTTKYLWNDDVNVENLILAQDSSLRHITPDFQLKSSAKVSDIRHRADTSLHTSLQVSTDNHKCDHSSSSSAIPRASPVPNILPSRAT
# SLIFVLEKIFRVTMRAIFGQET]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g195
###
# start gene g196
Scaffold_20	AUGUSTUS	gene	401487	402516	0.68	-	.	g196
Scaffold_20	AUGUSTUS	transcript	401487	402516	0.68	-	.	g196.t1
Scaffold_20	AUGUSTUS	stop_codon	401487	401489	.	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_20	AUGUSTUS	CDS	401487	401972	0.97	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_20	AUGUSTUS	CDS	402032	402268	0.98	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_20	AUGUSTUS	CDS	402343	402516	0.71	-	0	transcript_id "g196.t1"; gene_id "g196";
Scaffold_20	AUGUSTUS	start_codon	402514	402516	.	-	0	transcript_id "g196.t1"; gene_id "g196";
# protein sequence = [MASLASRSATQALRNTARRAAPRMVSAPIKSQAASYSLLAKAAVAANATSSQKTSSIEGARGIKTLDFAGTKEVVYER
# SDWPLAKLQDYFKDDTLALIGYGSQGHGQGLNARDNGLNVIVGVRKDGESWKQAMEDGWVPGETLFPIEEAIKKGTIIMNLLSDAAQSQTWHEVAPLI
# TKGKTLYFSHGFSIVYKEDTKVIPPSDVDVILVAPKGSGRTVRTLFKEGRGINSSVAVFQDVTGKAKEKAIALGVGIGSGYMYDTTFEKEVYSDLYGE
# RGVVSPTLLLSSSTHRCSRMIFLP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g196
###
# start gene g197
Scaffold_20	AUGUSTUS	gene	402908	403798	1	+	.	g197
Scaffold_20	AUGUSTUS	transcript	402908	403798	1	+	.	g197.t1
Scaffold_20	AUGUSTUS	start_codon	402908	402910	.	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_20	AUGUSTUS	CDS	402908	403798	1	+	0	transcript_id "g197.t1"; gene_id "g197";
Scaffold_20	AUGUSTUS	stop_codon	403796	403798	.	+	0	transcript_id "g197.t1"; gene_id "g197";
# protein sequence = [MHPQLSRAQVLSNLAVTPDCIGLEEQPSASIEREKLQTVLTTQSSSNTAIDGIQSDDTRILLALSTPLGLHLAHGLAY
# TVGSALGCVPPSVEECLVAFTTTNRVNLTAGARAWSKHAHRSFVESDSQVLQLSQSLDAGDRDAFTEQQQKEETAATHGLVGNTSGPVATINENALHL
# FWKIIGNASWRNLHWLPHSVLVYEVRVKMGYGMRWSQDRSQLDQGRQSGPLAVQIIDMPRRSDDGPDKEVARGLRAKVMNMNDRGDADDGLDTDHPPW
# IFRGFVEPMMEDGHEKGWRHAP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g197
###
# start gene g198
Scaffold_20	AUGUSTUS	gene	405409	406188	0.49	+	.	g198
Scaffold_20	AUGUSTUS	transcript	405409	406188	0.49	+	.	g198.t1
Scaffold_20	AUGUSTUS	start_codon	405409	405411	.	+	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_20	AUGUSTUS	CDS	405409	406188	0.49	+	0	transcript_id "g198.t1"; gene_id "g198";
Scaffold_20	AUGUSTUS	stop_codon	406186	406188	.	+	0	transcript_id "g198.t1"; gene_id "g198";
# protein sequence = [MKYRLDRIKKRYKSLQESLLVADMQHKRVSDEIEKYQGLALGDTAIGHICAAFHGYADRDLPTTPNVLDTLDHKRSIH
# SSNIPSPSSITDANLVDVSLIKITDPSFIPKNTCIQLFESIQELRPGQEVSLDCNAVSKEQSGEVGLLKGYFGLPDFNPNPNPNPVVLGAADDNEKQK
# SREAQYFVQEYAVSESGFSAAGSSGAIVYTDGFAAVGMAVGHFVSLIPMCIVLPLDRLVGSVESAAGVELEFVPPIFEEEEGM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g198
###
# start gene g199
Scaffold_20	AUGUSTUS	gene	407082	409070	0.5	-	.	g199
Scaffold_20	AUGUSTUS	transcript	407082	409070	0.5	-	.	g199.t1
Scaffold_20	AUGUSTUS	stop_codon	407082	407084	.	-	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_20	AUGUSTUS	CDS	407082	409070	0.5	-	0	transcript_id "g199.t1"; gene_id "g199";
Scaffold_20	AUGUSTUS	start_codon	409068	409070	.	-	0	transcript_id "g199.t1"; gene_id "g199";
# protein sequence = [MLVQNWTKLRNKVKMVSCASTLLVQLKLIYPPPAEEIANLRKEAESFAQVRAAIRNSTAAPDAVPAARMIFDKIFNTD
# IKRLLSMSDMWNHRAKPVPLDFDLIMQETEVGNGEKEESVALKDQKKLTTKENLELFISSVSALSARLSPSSSTKETVIEFDKDDPDTLDFVTATSNL
# RSLAYGIPQKSKWEVKEMAGNIIPAIATTNAIIAGLIVLQGVHLVAAKLGSPAGSSSTSPSTSPSFTSTTTNSSSYTALRNIHIQLKPSVPLSAITTS
# RPNPACGICRDVYTVVRCDPLRATLRDVVQGVLGGTPTPTPTSNYSFSTTTSTPTSTSTTPPTPSISHFTIFASSPSAPSATRILADPDWDDNLDRTL
# GSLNVRCGMFVNVVYEGDEDDDEGGEGTNHGEGEGGDQENDEGGGAGNERENEKWQWEWKTLSIGIGGLPPNYHPLDYHPLHPVDENGEGNLGWLMLP
# DPLPRLVSRKVKVNVTKEVNKNKRKEERVTPSGGGGKNAVAPPLVERASLKRSLGDEDGGDGDIIILDDDNSTYPPAAKRRKTSQSTNANGSSSTNAN
# GSPSTPPKSNPPSSKHPHPLGHTLAHPLARGPSKSPSKKSKSPSKKRKLEEDGLVLMESAEEVLDDDLLDGGDGNGGIGAMGMLSLLIDYNSFD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g199
###
# start gene g200
Scaffold_20	AUGUSTUS	gene	414687	415226	0.26	-	.	g200
Scaffold_20	AUGUSTUS	transcript	414687	415226	0.26	-	.	g200.t1
Scaffold_20	AUGUSTUS	stop_codon	414687	414689	.	-	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_20	AUGUSTUS	CDS	414687	414823	0.75	-	2	transcript_id "g200.t1"; gene_id "g200";
Scaffold_20	AUGUSTUS	CDS	414879	415040	0.5	-	2	transcript_id "g200.t1"; gene_id "g200";
Scaffold_20	AUGUSTUS	CDS	415142	415226	0.27	-	0	transcript_id "g200.t1"; gene_id "g200";
Scaffold_20	AUGUSTUS	start_codon	415224	415226	.	-	0	transcript_id "g200.t1"; gene_id "g200";
# protein sequence = [MLFANDMHLGQIKCSILFHATSMESYLTFLHTLETWDSTFVDGDDGQTPELLANSNPLANGPGVRTPAGSFYYGGVNH
# GNGLDQDQVSVGDEDPGNSENEIEEADLDGHLGCSLRMRMMMLDVSNVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g200
###
# start gene g201
Scaffold_20	AUGUSTUS	gene	423484	425937	0.87	-	.	g201
Scaffold_20	AUGUSTUS	transcript	423484	425937	0.87	-	.	g201.t1
Scaffold_20	AUGUSTUS	stop_codon	423484	423486	.	-	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_20	AUGUSTUS	CDS	423484	425937	0.87	-	0	transcript_id "g201.t1"; gene_id "g201";
Scaffold_20	AUGUSTUS	start_codon	425935	425937	.	-	0	transcript_id "g201.t1"; gene_id "g201";
# protein sequence = [MTQYRKELASLGSKLSEDEFSITLLTSLPDSWDSFIQGVNTTSLSDSTKLVSRILEQSRRKFAKPSSDDIALPANRFK
# GKAGKSSTALNSACHGCGRSGHFISNCRDTAAGKTYTAQQKKENYEHTMRNRSRPNKSHRAHIVQEDQSAETDYAFMGQHTDNSLPADTWLIDSACTK
# HIIQNKSHFSTYFETPGHSVKGFGESPAIGQGTATVATHVGKHAFNITLQNALHVPNAPFNLISVGCITQAGFTVKFTTNSISVISSGPSPREIIHGR
# RVGNLYVVKITRGTACLSPSQHHPQSVPNNAETLAFPSLPTARSWKEWHCTLGHITAKSVKLLHDKGMVTGMVVDTTSELDFDCDACTRAKQHVQPFP
# KEAERKYTEIGEMTFTDVWGPARTYGINRERYFVSFTDGASRRTMIYFLKQKSEVEGKTKSYIEYILTQTGKRCKAFRFDNGGEYISTAIRNYLSSKG
# IRLEYTAAHSPQQNGVSERLNCTIIEHARAMLAHYDLPLFLWPEAVAYAVYLKNRSPTQALTKYITPEEAFWKKKPDISTLQEFGSPCWVLRQDGQNQ
# KLISKSRPFRFTGLSDESRAWRYYNPESRRIQTSRNVVFNSKGAKTESTEIIPTPALEGEQKESTISENQSVESPPSELNQNTLTESLQPSTPSPITP
# PRPLSPLTPLPSPSPSPSPSISTAYQKPKAPRDISSTISTENIISGKRTARSAPTLNYRLLNNPDSHSPKRPDAWKIRVPGPELDSDPNTVAIAFPSF
# QQTSVSEPLTVTEARSVLIGQNGKKQWILKLNNSKISILTGSHHVHLTCPNHK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g201
###
# start gene g202
Scaffold_20	AUGUSTUS	gene	426753	427862	0.76	+	.	g202
Scaffold_20	AUGUSTUS	transcript	426753	427862	0.76	+	.	g202.t1
Scaffold_20	AUGUSTUS	start_codon	426753	426755	.	+	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_20	AUGUSTUS	CDS	426753	427862	0.76	+	0	transcript_id "g202.t1"; gene_id "g202";
Scaffold_20	AUGUSTUS	stop_codon	427860	427862	.	+	0	transcript_id "g202.t1"; gene_id "g202";
# protein sequence = [MSTVPVPAPSDPRSIASPVSTPPPPPNPPFTTERVDVDKLASAVEDPPLGQLTLFKSVFGVGVSLARYIVDDPLWPIL
# AAAGLPSSFCVRGKKSGSCSVVPHLACCSNCDNKKLCVLGRLARFRYFAHRCSRDLSFARRFLEAHRDPGQRTRFSLLPEQWRTIADKIESRTSSTQA
# LLELSPLDDQDRLEEDRLGLQDFICHQPKVPTVAEPVPSGSRLPVVPDKVLSIPKRRKWVVRMGEASSSKCKRSVEQDLGVVDADYRRVVLVLSPQMV
# SRPEVMEPRTPSRGDAPNKPSHPLPSPGAPLPLSPRAGTSYGGQTTQSGSFGQFIPPTLTAAMSGDWIKSPPFSQVSSLLFSFVPRAENHAFHPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g202
###
# start gene g203
Scaffold_20	AUGUSTUS	gene	440364	441441	0.21	+	.	g203
Scaffold_20	AUGUSTUS	transcript	440364	441441	0.21	+	.	g203.t1
Scaffold_20	AUGUSTUS	start_codon	440364	440366	.	+	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_20	AUGUSTUS	CDS	440364	441015	0.28	+	0	transcript_id "g203.t1"; gene_id "g203";
Scaffold_20	AUGUSTUS	CDS	441161	441441	0.51	+	2	transcript_id "g203.t1"; gene_id "g203";
Scaffold_20	AUGUSTUS	stop_codon	441439	441441	.	+	0	transcript_id "g203.t1"; gene_id "g203";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP
# FGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI
# SVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTICQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAAT
# PSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g203
###
# start gene g204
Scaffold_20	AUGUSTUS	gene	446058	447494	0.44	-	.	g204
Scaffold_20	AUGUSTUS	transcript	446058	447494	0.44	-	.	g204.t1
Scaffold_20	AUGUSTUS	stop_codon	446058	446060	.	-	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_20	AUGUSTUS	CDS	446058	447494	0.44	-	0	transcript_id "g204.t1"; gene_id "g204";
Scaffold_20	AUGUSTUS	start_codon	447492	447494	.	-	0	transcript_id "g204.t1"; gene_id "g204";
# protein sequence = [MDRLLREGTPAYFLHISPTKEEPPTEEMLRASDSSAPEGVQQPKDPESGDSSPEQGGVVKELDKEESKRQETEELKKS
# IPVQYQDYLDVFSPGEARTLPPHRPYNIKIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPTGAPVLFAKKKDGTLRLCVDYRALN
# KITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILI
# YSDNEKSHVEHIRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDLEKVRAVMDWLKLRTVKELQAFLGFANFYRRFIDNYSGITKVFTK
# LLQKDLVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVILECDASDLAIAGILSQLDPETGEIHPIALHARSMISAELNYDIYDKELLAIVDCFKQ
# WRAYCEGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g204
###
# start gene g205
Scaffold_20	AUGUSTUS	gene	447899	448501	1	-	.	g205
Scaffold_20	AUGUSTUS	transcript	447899	448501	1	-	.	g205.t1
Scaffold_20	AUGUSTUS	stop_codon	447899	447901	.	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_20	AUGUSTUS	CDS	447899	448501	1	-	0	transcript_id "g205.t1"; gene_id "g205";
Scaffold_20	AUGUSTUS	start_codon	448499	448501	.	-	0	transcript_id "g205.t1"; gene_id "g205";
# protein sequence = [MRHPKNLVDLTNSIPLELFDGQPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRLHNPVIDWKE
# LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHEGTLQPPPETPQQPPEAPQPPPEAPQQPPEAPLRAPKTGVKLEEVKDEEYEANQPD
# PHELFPLDKNLGQTTQSLWGSTNG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g205
###
# start gene g206
Scaffold_20	AUGUSTUS	gene	450479	452063	0.5	-	.	g206
Scaffold_20	AUGUSTUS	transcript	450479	452063	0.5	-	.	g206.t1
Scaffold_20	AUGUSTUS	stop_codon	450479	450481	.	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_20	AUGUSTUS	CDS	450479	450926	0.55	-	1	transcript_id "g206.t1"; gene_id "g206";
Scaffold_20	AUGUSTUS	CDS	451051	452063	0.5	-	0	transcript_id "g206.t1"; gene_id "g206";
Scaffold_20	AUGUSTUS	start_codon	452061	452063	.	-	0	transcript_id "g206.t1"; gene_id "g206";
# protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQCLMSIPEQSFGDETASNVRTPEGCQPAVQ
# EPPPVKPGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGMRGPPPGPVLQLDMESASNVGGRVSSQVAAIERIQGESTDPLTVQQQEKLPERRVSPAV
# SEQSWTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNMPNWEHTHTIHHSRTNFPVQLLSEMTLRLEDIIRIQECIPEDVAMVLREVLESMGIEI
# LGDGLEFSDLWVQFLTVGTQLEIRPPREGPAVADDPSKSIRLSLVVQRPVGPREDVGTVRGRGISGAVRFEPPPSRVNIPNYQAIQILQNANLAAAAA
# KIDEESNEDANAIAAKNHRRRRYTTAHLLAPVESMPDQDSPVRVRSGQTVYTYMPMRHMHQLLVRSEESEAMLCFAGDPTPDITSGIRHSDAVGRTFW
# IKSRKGLGIPSQTSRG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g206
###
# start gene g207
Scaffold_20	AUGUSTUS	gene	455203	456291	0.82	+	.	g207
Scaffold_20	AUGUSTUS	transcript	455203	456291	0.82	+	.	g207.t1
Scaffold_20	AUGUSTUS	start_codon	455203	455205	.	+	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_20	AUGUSTUS	CDS	455203	456291	0.82	+	0	transcript_id "g207.t1"; gene_id "g207";
Scaffold_20	AUGUSTUS	stop_codon	456289	456291	.	+	0	transcript_id "g207.t1"; gene_id "g207";
# protein sequence = [MHTESLAYSSLVQKNSTLLDSACTNHIVNDRFYTYDVNGATAVQTANSGILSTQALGTCYFETLIEGTNNKLILEMHN
# CLYAPDAPVSLISIGAMLEHGFTFTILSNIVEIHPNPNNHFIADVQNCLCLLRGNFILPQKDFSDPIQLAMPVFIPRIPNGALFHERFRHPGVDLTNQ
# LLTGMSATGLDEWNGTKMRGICDSCLKGKHPCFAYPYQGNRAAAPLELIHMDTCGPIGTMSNHHNSHFNIIVNDYMSALTGGCFAKENQALRIIKTTI
# STWENLMFPIKSKISDSMVRKNSMDQRLICILKRKEFWFRKQQLTLTNKNRKAEQWVRIIENDAMTMLVHAGLPLQFWEDTVRTALYI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g207
###
# start gene g208
Scaffold_20	AUGUSTUS	gene	465817	466695	0.94	+	.	g208
Scaffold_20	AUGUSTUS	transcript	465817	466695	0.94	+	.	g208.t1
Scaffold_20	AUGUSTUS	start_codon	465817	465819	.	+	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_20	AUGUSTUS	CDS	465817	466695	0.94	+	0	transcript_id "g208.t1"; gene_id "g208";
Scaffold_20	AUGUSTUS	stop_codon	466693	466695	.	+	0	transcript_id "g208.t1"; gene_id "g208";
# protein sequence = [MLIQPIPISTTFTSTAFTSTSFHPYCFHPYYVHRLTHRIDCDSENVEGWDGWKYRHRYGDGDGDRDRYWDVVPIELPR
# LLVFGDGMEVDDAGDGDGDGDVDCDVDVDEDSDSDSESTTSTSTTSSTTSTTSHISDISSMTSVSSSSSIAKSSTAAGVVYVPPHKLSTTKSESEFDS
# GGSIPSHRLLSRSRSQHSSKFYPIPKSQSKSSTHVNRYKYQGGETGVMTGGVMLGSTTRSPFTPTPARASTRSPFTPTRPTLARPTKRGIARTLILGP
# DSSSSLDWRRPRVPSLFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g208
###
# start gene g209
Scaffold_20	AUGUSTUS	gene	481342	481575	0.49	-	.	g209
Scaffold_20	AUGUSTUS	transcript	481342	481575	0.49	-	.	g209.t1
Scaffold_20	AUGUSTUS	stop_codon	481342	481344	.	-	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_20	AUGUSTUS	CDS	481342	481575	0.49	-	0	transcript_id "g209.t1"; gene_id "g209";
Scaffold_20	AUGUSTUS	start_codon	481573	481575	.	-	0	transcript_id "g209.t1"; gene_id "g209";
# protein sequence = [MKEQRAAEEVRVLNVQPIDDDEYEGYGGYETTNPIHLPTILSHAGGEAEAGAKDLEEDDWEECADVYQELLDGCRRM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g209
###
# start gene g210
Scaffold_20	AUGUSTUS	gene	484918	485838	0.9	-	.	g210
Scaffold_20	AUGUSTUS	transcript	484918	485838	0.9	-	.	g210.t1
Scaffold_20	AUGUSTUS	stop_codon	484918	484920	.	-	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_20	AUGUSTUS	CDS	484918	485838	0.9	-	0	transcript_id "g210.t1"; gene_id "g210";
Scaffold_20	AUGUSTUS	start_codon	485836	485838	.	-	0	transcript_id "g210.t1"; gene_id "g210";
# protein sequence = [MLDKVNGIDVGVSAVNKEMQKAEVGVDAANIRLEEKLNQVELDISMCHTPIYEGKCLVNFASIEEIRKLTSPPSTPTR
# SRKVKYIPSPKNIHAAPRSPLPATSNSQSIQEVIASPSKQNISLIWISSEDEADYPDDSEDSDSDDSGDGWVPQSAADVSSDEDEPLPGLGGVTASEA
# RARKTSKSGGFIEKTYLVYYGRNNSDGLYFEWQGTNGATGALELTDGFPDAIHKSFSNRKLAAKAYKECKRTGVLDILKTPVHAKENLIVVKGENPGV
# YNRRYVSFLSSFPNAQRNFQYADETRALLAWG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g210
###
# start gene g211
Scaffold_20	AUGUSTUS	gene	488454	489517	0.48	-	.	g211
Scaffold_20	AUGUSTUS	transcript	488454	489517	0.48	-	.	g211.t1
Scaffold_20	AUGUSTUS	stop_codon	488454	488456	.	-	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_20	AUGUSTUS	CDS	488454	489140	0.65	-	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_20	AUGUSTUS	CDS	489224	489517	0.48	-	0	transcript_id "g211.t1"; gene_id "g211";
Scaffold_20	AUGUSTUS	start_codon	489515	489517	.	-	0	transcript_id "g211.t1"; gene_id "g211";
# protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFSGLSVKR
# SPWNFTIPLDIIRKPMGKLSFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEF
# PIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKL
# DRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPGP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g211
###
# start gene g212
Scaffold_20	AUGUSTUS	gene	491269	491997	0.91	-	.	g212
Scaffold_20	AUGUSTUS	transcript	491269	491997	0.91	-	.	g212.t1
Scaffold_20	AUGUSTUS	stop_codon	491269	491271	.	-	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_20	AUGUSTUS	CDS	491269	491997	0.91	-	0	transcript_id "g212.t1"; gene_id "g212";
Scaffold_20	AUGUSTUS	start_codon	491995	491997	.	-	0	transcript_id "g212.t1"; gene_id "g212";
# protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINTLLQRSLF
# RYRNLRRRFHRQFWRPLLGTHLALALAPALGLTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAAR
# AADRSSTTPTVPPLHPSIPEEYEFADVFDEIAADSLPEHRPYDLKIDLEEALRRLSAVFILCLKRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g212
###
# start gene g213
Scaffold_20	AUGUSTUS	gene	492329	494014	0.29	-	.	g213
Scaffold_20	AUGUSTUS	transcript	492329	494014	0.29	-	.	g213.t1
Scaffold_20	AUGUSTUS	stop_codon	492329	492331	.	-	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_20	AUGUSTUS	CDS	492329	493036	0.97	-	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_20	AUGUSTUS	CDS	493117	493138	0.71	-	1	transcript_id "g213.t1"; gene_id "g213";
Scaffold_20	AUGUSTUS	CDS	493264	493682	0.29	-	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_20	AUGUSTUS	CDS	493805	494014	0.99	-	0	transcript_id "g213.t1"; gene_id "g213";
Scaffold_20	AUGUSTUS	start_codon	494012	494014	.	-	0	transcript_id "g213.t1"; gene_id "g213";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEENNNSIQHLPAVRETTP
# TSAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELL
# SGFKGSIETLGTVLAALGRPLTALNPRARSRSQSGSAKEWFDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLA
# ERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNS
# SNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g213
###
# start gene g214
Scaffold_20	AUGUSTUS	gene	495784	496352	0.36	+	.	g214
Scaffold_20	AUGUSTUS	transcript	495784	496352	0.36	+	.	g214.t1
Scaffold_20	AUGUSTUS	start_codon	495784	495786	.	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_20	AUGUSTUS	CDS	495784	496076	0.36	+	0	transcript_id "g214.t1"; gene_id "g214";
Scaffold_20	AUGUSTUS	CDS	496148	496352	0.53	+	1	transcript_id "g214.t1"; gene_id "g214";
Scaffold_20	AUGUSTUS	stop_codon	496350	496352	.	+	0	transcript_id "g214.t1"; gene_id "g214";
# protein sequence = [MGLCQSPVTGVLSCDSTPAPIGQAEQAHRPIVTLGVSEKSLAKATSALKAKLLNEAISQLQIEQEEKGDGFGQSHGER
# LVGSKNLLELPNTIGRGGKQHLLIPVIGRRYKAKISEIRRAAELDDDLQLAKTDPDKLKILMDELEEHQQAKKDVARTRTKQCNEGY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g214
###
# start gene g215
Scaffold_20	AUGUSTUS	gene	496995	497330	0.83	+	.	g215
Scaffold_20	AUGUSTUS	transcript	496995	497330	0.83	+	.	g215.t1
Scaffold_20	AUGUSTUS	start_codon	496995	496997	.	+	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_20	AUGUSTUS	CDS	496995	497330	0.83	+	0	transcript_id "g215.t1"; gene_id "g215";
Scaffold_20	AUGUSTUS	stop_codon	497328	497330	.	+	0	transcript_id "g215.t1"; gene_id "g215";
# protein sequence = [MDKREYKKFMQQLDQDKAAGLEVEIPRKGRSDIGGKHRKATAKRPGENDTEEPPAKRKRTSSSTKRMHIREHESDEDD
# ENSDIGRSVNFARGSGDENEDEDEDEDVDELDD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g215
###
# start gene g216
Scaffold_20	AUGUSTUS	gene	508509	509675	0.55	-	.	g216
Scaffold_20	AUGUSTUS	transcript	508509	509675	0.55	-	.	g216.t1
Scaffold_20	AUGUSTUS	stop_codon	508509	508511	.	-	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_20	AUGUSTUS	CDS	508509	509675	0.55	-	0	transcript_id "g216.t1"; gene_id "g216";
Scaffold_20	AUGUSTUS	start_codon	509673	509675	.	-	0	transcript_id "g216.t1"; gene_id "g216";
# protein sequence = [MSNHQSSHFNIILDDYTSALSGGCFAKKNQALRIIKSTISTWENLMSPHKVKNIRLDGAKEFHGSEATTYFEEKGILV
# QKTAAYSHQQNGKAERWVRIIENDAMTMLVHSGLPLQFWEDAVRTAIYVRFRLPTKTLPDNKTPYEMVHGHLPNLSNLRVWGCQCWIQVSEDIRLKFG
# DKMLEGIFVGYEDNRVGWRVRDINGKEHFSDQVVFNESQFGRLRSPRSSKSTTAPLISTSPTSNSPMTISASKPTPPNGPRPRRMTKLTERGKEWREG
# IRRRDELIQERRITEGLSPLRDKQIDLDIIGCSLASRILEDNVECIEDDSEFFFAALANIPSPFLPIKPTSTSTSKPRIFDLRKAPSTRREMLLRSDL
# NDWLRPKTEKYLVYLI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g216
###
# start gene g217
Scaffold_20	AUGUSTUS	gene	510688	511708	0.34	-	.	g217
Scaffold_20	AUGUSTUS	transcript	510688	511708	0.34	-	.	g217.t1
Scaffold_20	AUGUSTUS	stop_codon	510688	510690	.	-	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_20	AUGUSTUS	CDS	510688	510975	0.5	-	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_20	AUGUSTUS	CDS	511133	511708	0.35	-	0	transcript_id "g217.t1"; gene_id "g217";
Scaffold_20	AUGUSTUS	start_codon	511706	511708	.	-	0	transcript_id "g217.t1"; gene_id "g217";
# protein sequence = [MHQPRPHHVVNLDHISASAQILPEIQSAPAIMSEFPQEYPHTSPNQPNISPQQWVQPPLRAQTDHHYPLYYTPYPVYQ
# SFQPPPEQPRSVTPKFKIEYSSIHATFLATIKDADSLKDRKSWVKWNEGVWQAVADGFVLGHICDEPSPGTPWTEWNMPLVRPNLPSQPTRKELEARL
# KWDKNDGWTSSPDCSFIHGMDIEKFNLKWSSTLTTLCNYGYDIPWDTLISKYISKLPSGPRYVYLKQTLEEEFDQPGIIPNRDLFDKFAIRLENTRNR
# ELLDLANLWGWSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g217
###
# start gene g218
Scaffold_20	AUGUSTUS	gene	512753	513451	0.96	-	.	g218
Scaffold_20	AUGUSTUS	transcript	512753	513451	0.96	-	.	g218.t1
Scaffold_20	AUGUSTUS	stop_codon	512753	512755	.	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_20	AUGUSTUS	CDS	512753	512973	0.98	-	2	transcript_id "g218.t1"; gene_id "g218";
Scaffold_20	AUGUSTUS	CDS	513025	513451	0.98	-	0	transcript_id "g218.t1"; gene_id "g218";
Scaffold_20	AUGUSTUS	start_codon	513449	513451	.	-	0	transcript_id "g218.t1"; gene_id "g218";
# protein sequence = [MKLKALGIECWLSSSHTDEHPIGNTETSFSETTGTTTVRTSVSPHEEPDSESESESESGSEVRKTDKGFDKKLIHWKV
# DYYLSWRTSPNEPMSLWCIVFSRKPTGHLETVESKVWMCSSKQNTQQCSSEHFHEDPARRFRPRSIKSSDNMGTLRLEIRRLNGTVNAVCLLGVDDLD
# IDILDEKYPWIVFEFNFKRKNNDGEWNSICNQTYLKILS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g218
###
# start gene g219
Scaffold_20	AUGUSTUS	gene	515217	515591	0.39	-	.	g219
Scaffold_20	AUGUSTUS	transcript	515217	515591	0.39	-	.	g219.t1
Scaffold_20	AUGUSTUS	stop_codon	515217	515219	.	-	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_20	AUGUSTUS	CDS	515217	515591	0.39	-	0	transcript_id "g219.t1"; gene_id "g219";
Scaffold_20	AUGUSTUS	start_codon	515589	515591	.	-	0	transcript_id "g219.t1"; gene_id "g219";
# protein sequence = [MPAVAMALAYVSKVSGGRTDSFPGGEVITMNETLDGLKQQDSTCLFSPSQTSLPQDITTKPGVTTKEWLKDGGVVGVG
# TAPQTYYSAALMKSLHQKTSLSTPATSQVPTTQPKTDESSDGLEEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g219
###
# start gene g220
Scaffold_20	AUGUSTUS	gene	517569	518829	0.31	+	.	g220
Scaffold_20	AUGUSTUS	transcript	517569	518829	0.31	+	.	g220.t1
Scaffold_20	AUGUSTUS	start_codon	517569	517571	.	+	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_20	AUGUSTUS	CDS	517569	517894	0.51	+	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_20	AUGUSTUS	CDS	518020	518317	0.93	+	1	transcript_id "g220.t1"; gene_id "g220";
Scaffold_20	AUGUSTUS	CDS	518395	518829	0.48	+	0	transcript_id "g220.t1"; gene_id "g220";
Scaffold_20	AUGUSTUS	stop_codon	518827	518829	.	+	0	transcript_id "g220.t1"; gene_id "g220";
# protein sequence = [MIKTLLSTPTIRAPNNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGF
# KGSIETLGTVLAALGRPLTALNPRARSRSQSGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIR
# FNTLAASTNWDSAALKWAYGRGLADASRTKWRETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSN
# SGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g220
###
# start gene g221
Scaffold_20	AUGUSTUS	gene	519206	519883	0.86	+	.	g221
Scaffold_20	AUGUSTUS	transcript	519206	519883	0.86	+	.	g221.t1
Scaffold_20	AUGUSTUS	start_codon	519206	519208	.	+	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_20	AUGUSTUS	CDS	519206	519883	0.86	+	0	transcript_id "g221.t1"; gene_id "g221";
Scaffold_20	AUGUSTUS	stop_codon	519881	519883	.	+	0	transcript_id "g221.t1"; gene_id "g221";
# protein sequence = [MLHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAVPLPEPSPSVSPTILETPPG
# DSPRSRSRSRSRTLRAKPLSSKFPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAADRSSTTPTVPPLHPSI
# PEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEALRRLSAVFILCLKRS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g221
###
# start gene g222
Scaffold_20	AUGUSTUS	gene	520600	521991	0.91	+	.	g222
Scaffold_20	AUGUSTUS	transcript	520600	521991	0.91	+	.	g222.t1
Scaffold_20	AUGUSTUS	start_codon	520600	520602	.	+	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_20	AUGUSTUS	CDS	520600	521991	0.91	+	0	transcript_id "g222.t1"; gene_id "g222";
Scaffold_20	AUGUSTUS	stop_codon	521989	521991	.	+	0	transcript_id "g222.t1"; gene_id "g222";
# protein sequence = [MTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIVETDASDYAIAAILSIQYADGEIHPLAFLSRTLH
# AAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNMVIRFRPGKLGEKPDSITRRWDVYPKEGDIG
# YAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAIILALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQV
# LRYFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTICGRNKPRRHRPYGLLKPLPVPVRPWDSISMDFIEQLPMSNGYTAILVVVDRSSK
# QAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFSGLSVKRSPWNFTIPLDIIRKPMGKLSVSIRLSTVHQDLLFLPTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g222
###
# start gene g223
Scaffold_20	AUGUSTUS	gene	523657	524169	0.95	-	.	g223
Scaffold_20	AUGUSTUS	transcript	523657	524169	0.95	-	.	g223.t1
Scaffold_20	AUGUSTUS	stop_codon	523657	523659	.	-	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_20	AUGUSTUS	CDS	523657	524169	0.95	-	0	transcript_id "g223.t1"; gene_id "g223";
Scaffold_20	AUGUSTUS	start_codon	524167	524169	.	-	0	transcript_id "g223.t1"; gene_id "g223";
# protein sequence = [MSASRTITTTTSATAGPSRSRPVPPPPPPASDSAAQEEEGLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA
# RAAAEKKRKAQEAQERAKRARQQEEEVVERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEVCASTFNFASTNLRIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g223
###
# start gene g224
Scaffold_20	AUGUSTUS	gene	537087	537470	0.9	+	.	g224
Scaffold_20	AUGUSTUS	transcript	537087	537470	0.9	+	.	g224.t1
Scaffold_20	AUGUSTUS	start_codon	537087	537089	.	+	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_20	AUGUSTUS	CDS	537087	537470	0.9	+	0	transcript_id "g224.t1"; gene_id "g224";
Scaffold_20	AUGUSTUS	stop_codon	537468	537470	.	+	0	transcript_id "g224.t1"; gene_id "g224";
# protein sequence = [MSATSMEQPSSSKLKLKKQKSALSRGNMTQAQKLNQAASFTAITVVAGQRLMSIPEQSFRDEPSSNVRTPEGRQPAVQ
# EPPPVDPGMGPPQRRYTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g224
###
# start gene g225
Scaffold_20	AUGUSTUS	gene	538958	539932	0.99	+	.	g225
Scaffold_20	AUGUSTUS	transcript	538958	539932	0.99	+	.	g225.t1
Scaffold_20	AUGUSTUS	start_codon	538958	538960	.	+	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_20	AUGUSTUS	CDS	538958	539932	0.99	+	0	transcript_id "g225.t1"; gene_id "g225";
Scaffold_20	AUGUSTUS	stop_codon	539930	539932	.	+	0	transcript_id "g225.t1"; gene_id "g225";
# protein sequence = [MEERSSSKSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKSQAKLIKSALGFFTESAGDWATPHLLHFNAEHPP
# FGGNWEEFLKEFVQRFESVDPGMEARSEIKNLKQVKVRQSRNLLRSSRILGIGLECLTLIYERFFTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAIS
# VDVYMHDPTMTGRNSGHAPTHAAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETPAVTVDAEDIWKQSAKTSSWDSD
# ETEADASNLDASRYPLRDPHHSPCSQMNPSRSLPRPQHLPCNRTCYSEPP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g225
###
# start gene g226
Scaffold_20	AUGUSTUS	gene	544527	545000	0.78	+	.	g226
Scaffold_20	AUGUSTUS	transcript	544527	545000	0.78	+	.	g226.t1
Scaffold_20	AUGUSTUS	start_codon	544527	544529	.	+	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_20	AUGUSTUS	CDS	544527	545000	0.78	+	0	transcript_id "g226.t1"; gene_id "g226";
Scaffold_20	AUGUSTUS	stop_codon	544998	545000	.	+	0	transcript_id "g226.t1"; gene_id "g226";
# protein sequence = [MEECSSSKSSINKPEVFKGKDSSEAHHFMAQFQNWASEQPHLAKSQVNLIKSALGFFTESTGDWATPHLLHFSAENPP
# FGGNWDTFLKEFGQWFESMDPGMEARSEIKNLRQSKGRQLQNSLSSSRISEIGLKCLILIYGNASSLPYFRKSDNISSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g226
###
# start gene g227
Scaffold_20	AUGUSTUS	gene	554816	555278	0.28	-	.	g227
Scaffold_20	AUGUSTUS	transcript	554816	555278	0.28	-	.	g227.t1
Scaffold_20	AUGUSTUS	stop_codon	554816	554818	.	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_20	AUGUSTUS	CDS	554816	554890	0.53	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_20	AUGUSTUS	CDS	554991	555029	0.58	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_20	AUGUSTUS	CDS	555123	555278	0.49	-	0	transcript_id "g227.t1"; gene_id "g227";
Scaffold_20	AUGUSTUS	start_codon	555276	555278	.	-	0	transcript_id "g227.t1"; gene_id "g227";
# protein sequence = [MSAYPWTSQPPDITICDVGGGHGDIILDLMKAHPHFKLVLQDQPQIIDMARKFWEEEYPEAIQTRITYGVLNDPSFVL
# SCESQIGLDIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g227
###
#
# ----- prediction on sequence number 3 (length = 1030649, name = Scaffold_13) -----
#
# Predicted genes for sequence number 3 on both strands
# start gene g228
Scaffold_13	AUGUSTUS	gene	1813	2702	0.78	+	.	g228
Scaffold_13	AUGUSTUS	transcript	1813	2702	0.78	+	.	g228.t1
Scaffold_13	AUGUSTUS	start_codon	1813	1815	.	+	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_13	AUGUSTUS	CDS	1813	1943	0.78	+	0	transcript_id "g228.t1"; gene_id "g228";
Scaffold_13	AUGUSTUS	CDS	2021	2702	0.87	+	1	transcript_id "g228.t1"; gene_id "g228";
Scaffold_13	AUGUSTUS	stop_codon	2700	2702	.	+	0	transcript_id "g228.t1"; gene_id "g228";
# protein sequence = [MVRPIPTWFLHRDISIGNLLKLKSAATFLQKDFSALPVGNLILPSIADIACKIHEHAEVLTSGAGCKAIWTDGDMGAD
# MARYFESAHDGTVSVSGFPRLGFCHCLTIIDSVAKGTPQFMSKGLLNEEPENEIQSPADDIESFLWVGLWSTLRNTKFPSSAKKEIRWSQSITKGRTS
# RETTANDIQESLGTIMKGVPEPYSNMFCTMAPILSEWYDAIRQLRKDWILDWSETNLDDSKDVNLLFHSFAYRGVLDFIEIFQKHKEDLEKTVW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g228
###
# start gene g229
Scaffold_13	AUGUSTUS	gene	6614	7850	0.31	-	.	g229
Scaffold_13	AUGUSTUS	transcript	6614	7850	0.31	-	.	g229.t1
Scaffold_13	AUGUSTUS	stop_codon	6614	6616	.	-	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_13	AUGUSTUS	CDS	6614	7080	0.66	-	2	transcript_id "g229.t1"; gene_id "g229";
Scaffold_13	AUGUSTUS	CDS	7433	7850	0.31	-	0	transcript_id "g229.t1"; gene_id "g229";
Scaffold_13	AUGUSTUS	start_codon	7848	7850	.	-	0	transcript_id "g229.t1"; gene_id "g229";
# protein sequence = [MFIHQMDVKSAYLYGKLDDNEQIYMKAPPGVDIEVKAGQVLKLKLALYGLKQAGRRWYMRFREIMTSVGLTRSNFDHA
# VFYRTDPFCIIFIHVDDMTMLTKTMAVMDTLKKKIRDQIEVVDSGEIHWLLGLRSADLYIHEIEGYTDADGMSQEDRHAISGYVFMLNGGAVSWSSKR
# QDTISLSTTEAEYIALTHAAKEAIWFRNLLSELFGPITKPIILNADNQSAIALAKDDRFHARTKHIDIRYHFIRYVIEEGKIRLVYCPTEDMTADIFT
# KALPSLKAKHFAASMGLTKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g229
###
# start gene g230
Scaffold_13	AUGUSTUS	gene	9204	11233	0.9	-	.	g230
Scaffold_13	AUGUSTUS	transcript	9204	11233	0.9	-	.	g230.t1
Scaffold_13	AUGUSTUS	stop_codon	9204	9206	.	-	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_13	AUGUSTUS	CDS	9204	9931	0.94	-	2	transcript_id "g230.t1"; gene_id "g230";
Scaffold_13	AUGUSTUS	CDS	10081	11233	0.94	-	0	transcript_id "g230.t1"; gene_id "g230";
Scaffold_13	AUGUSTUS	start_codon	11231	11233	.	-	0	transcript_id "g230.t1"; gene_id "g230";
# protein sequence = [MSLRTNPPRKADNRPTKPTAACAHREHIFDKDDVKDRYHDPDGSKYRVCKDQPCPNRYDKITTGYIPSFARLIDRKQE
# DLILGRGAPPEQVASSSSQKPEGTPEAAPAPEPEYPVFPPPPSPVLDRPSSPISSLPRSSPPPPDPEDPDPGAEVSDPESDDDDDNMSKVFKAFDKVS
# TLKSDGSNWDTWKNRVELATRSIGFSITSHLIQKNTEAWEAKKDDDGNLLNAIVGRLSDQIYRRYKNYENVFDLWKNLLSDFDSKSALTEAHLQQQLH
# SMHCHEPSKVNEHLDKLLEIRDSLEARKITIPEEMFNNTIIASIPNIFKPTINALVVVAARTSVPLTTRELVSTIRAEASGHTRGQSGKKESANYAGG
# NSNRGRGGFNRNRQRGPREFSKKEKNQPSGSGSNNWRSKNKEVGSSATIEEVPESSWAAVEVTTTTSQEIFNFSEIASNYETAFVASHSSGAILFDSG
# CSSHMTPLQDKLRNTRSVPTRIIQAANAETFTSNTAGNLQIDLPINEDGISKSLTLQNTLLCPNTPNTLVSLGKLDDAGYVMVIKDGTLKIINRQGET
# IGIVPKTNGLYQIPSAEYAYAGRQPGWFRFMKHTASLATRTMLMSNICSNQTRFTGSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g230
###
# start gene g231
Scaffold_13	AUGUSTUS	gene	15096	15725	0.81	+	.	g231
Scaffold_13	AUGUSTUS	transcript	15096	15725	0.81	+	.	g231.t1
Scaffold_13	AUGUSTUS	start_codon	15096	15098	.	+	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_13	AUGUSTUS	CDS	15096	15725	0.81	+	0	transcript_id "g231.t1"; gene_id "g231";
Scaffold_13	AUGUSTUS	stop_codon	15723	15725	.	+	0	transcript_id "g231.t1"; gene_id "g231";
# protein sequence = [MSSLCLLWAFLFTLNFLRAGVVAIPTPLESPLNSPKTRGPHRKSLVDIYDASLTNFASAGCTRLRIVLDSGLHPAAYT
# EADKLVNERWSLFVGHSYGYQSQSGQTTATRIMITNKKGEIVPKILSPKNRPVIGHISFKSLDAKEHVLQVTLPGIEGLTKLLWINNALEKMKELFRL
# RDEVTHLDLNEKLWHNAFWGMIKANGTGMEAPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g231
###
# start gene g232
Scaffold_13	AUGUSTUS	gene	17077	17385	0.84	+	.	g232
Scaffold_13	AUGUSTUS	transcript	17077	17385	0.84	+	.	g232.t1
Scaffold_13	AUGUSTUS	start_codon	17077	17079	.	+	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_13	AUGUSTUS	CDS	17077	17385	0.84	+	0	transcript_id "g232.t1"; gene_id "g232";
Scaffold_13	AUGUSTUS	stop_codon	17383	17385	.	+	0	transcript_id "g232.t1"; gene_id "g232";
# protein sequence = [MQVPTDPDPAYDSLRARIQANLEALDLNQSGDPDKAVEVIVDAVRGEGRAEGKEWPLYLPLGRDANKDIETKCVKMLT
# AVKDWKEVTDYLDINQSQAKAELI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g232
###
# start gene g233
Scaffold_13	AUGUSTUS	gene	34757	35536	0.91	-	.	g233
Scaffold_13	AUGUSTUS	transcript	34757	35536	0.91	-	.	g233.t1
Scaffold_13	AUGUSTUS	stop_codon	34757	34759	.	-	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_13	AUGUSTUS	CDS	34757	35536	0.91	-	0	transcript_id "g233.t1"; gene_id "g233";
Scaffold_13	AUGUSTUS	start_codon	35534	35536	.	-	0	transcript_id "g233.t1"; gene_id "g233";
# protein sequence = [MKILDRVPVSEDERIKVKVLTPTELEQSKLAMIFDGKIGRGQSHSRVQNEAILPGTATIKGPDSRKVDDASSLVSSKT
# GSTIGKRFSSMRIPFSARKSQDGFSGISPSSQSGLGSSVGGEKAVSVSNASTVQTPQAPATSRQTPVMRIVAQWDGAETDMEHLHSSSPNENANNFDD
# TNFISVTAESSKSTVVVGTGTGMDRAGKAADGVKSAYTGSELGGDGKMNWLLYDIAPQGTVKLVLEWEVSAASSLEVIESESS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g233
###
# start gene g234
Scaffold_13	AUGUSTUS	gene	35892	37166	0.27	-	.	g234
Scaffold_13	AUGUSTUS	transcript	35892	37166	0.27	-	.	g234.t1
Scaffold_13	AUGUSTUS	stop_codon	35892	35894	.	-	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_13	AUGUSTUS	CDS	35892	36550	0.65	-	2	transcript_id "g234.t1"; gene_id "g234";
Scaffold_13	AUGUSTUS	CDS	36662	37166	0.3	-	0	transcript_id "g234.t1"; gene_id "g234";
Scaffold_13	AUGUSTUS	start_codon	37164	37166	.	-	0	transcript_id "g234.t1"; gene_id "g234";
# protein sequence = [MLKLYHRVQGHGDATIHDVSLSTMPAQAQITTSPTLPELLARKDLIRNAIHRARTSSRALEAYMGSMSVHDVPLSQVG
# LFLESYNLHGSKLDEELARLKNEEDEVYKEIQTQKDRIAAEQLCQSGGGTLGMQVSVGLFAENEGQIELQLVYGNLAQRHKRSSSLTYRPCEASKPMN
# IITWSRLIALLQDWTNVPLTLETTTPSYGVLIPTLNPLKLSTYRKPYRVVQPMSIIPAPGVMSARYSHSHSGSGRPRRRGSRDRSYSPENYRGQRRRS
# SSSSRSRRSRTPPPVVISVPTPAPRALNTLGLTVTSKGDGRFNHSVFQIPGLINVPSDGMAHNVTVVELKEELNTKLQWFAVPKIDTRVHLNVRARGS
# KTWVFTDATTSLGQN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g234
###
# start gene g235
Scaffold_13	AUGUSTUS	gene	40690	41638	0.32	-	.	g235
Scaffold_13	AUGUSTUS	transcript	40690	41638	0.32	-	.	g235.t1
Scaffold_13	AUGUSTUS	stop_codon	40690	40692	.	-	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_13	AUGUSTUS	CDS	40690	41423	0.75	-	2	transcript_id "g235.t1"; gene_id "g235";
Scaffold_13	AUGUSTUS	CDS	41497	41638	0.32	-	0	transcript_id "g235.t1"; gene_id "g235";
Scaffold_13	AUGUSTUS	start_codon	41636	41638	.	-	0	transcript_id "g235.t1"; gene_id "g235";
# protein sequence = [MVPDGSTNLALKDVINALTFVNQNIAAFGGDNSRVTIAGQSSGATMILFSISLFLPMLISFFQDYGFQSSSTQRTLQS
# AYNSLINCSASDSACQNALSVDAILNAQGTLFNEASNLDASAGAGEPLRPVNDGTLITSPLDSTAAFPSVNKPILVSTVLDEAALTIGSEFSSALPED
# EFLPICQASLGDSRAAAVANASFYKPVSVDGSEDARQQLQLLGTDYVWRCSSWTFARNWISNGGSAYVGRYSVGATYPGNEEVSFCTEPGAVCHQDDI
# EIVVSWRLISVFIILQT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g235
###
# start gene g236
Scaffold_13	AUGUSTUS	gene	43509	43892	0.78	-	.	g236
Scaffold_13	AUGUSTUS	transcript	43509	43892	0.78	-	.	g236.t1
Scaffold_13	AUGUSTUS	stop_codon	43509	43511	.	-	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_13	AUGUSTUS	CDS	43509	43892	0.78	-	0	transcript_id "g236.t1"; gene_id "g236";
Scaffold_13	AUGUSTUS	start_codon	43890	43892	.	-	0	transcript_id "g236.t1"; gene_id "g236";
# protein sequence = [MQPEHKLNAYILDFYSHGQVSALAEANGIRRGDVWYELQEFDLTLKTIRTSLQELLIQLSLARCREIKDVNELLDLEA
# EEEDEENEEEDGIEGFKRPPKTSPGDWKVYEIFDRITRNFGEKFHEIFA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g236
###
# start gene g237
Scaffold_13	AUGUSTUS	gene	55894	56357	0.67	+	.	g237
Scaffold_13	AUGUSTUS	transcript	55894	56357	0.67	+	.	g237.t1
Scaffold_13	AUGUSTUS	start_codon	55894	55896	.	+	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_13	AUGUSTUS	CDS	55894	55959	0.7	+	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_13	AUGUSTUS	CDS	56028	56357	0.94	+	0	transcript_id "g237.t1"; gene_id "g237";
Scaffold_13	AUGUSTUS	stop_codon	56355	56357	.	+	0	transcript_id "g237.t1"; gene_id "g237";
# protein sequence = [MFDQVLDVMRNMKHEKDSEAHQIFRQSAGHAPKGVRLLPETVNPEEETVPGIQHPGSTGVIYCSERAIANGFSYTAQH
# EWANLGQGAPEVGPIPNAPERPKTIQMPEDSLEYAPTTGVKSMCVTMSTALIV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g237
###
# start gene g238
Scaffold_13	AUGUSTUS	gene	59235	60400	0.73	-	.	g238
Scaffold_13	AUGUSTUS	transcript	59235	60400	0.73	-	.	g238.t1
Scaffold_13	AUGUSTUS	stop_codon	59235	59237	.	-	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_13	AUGUSTUS	CDS	59235	59802	1	-	1	transcript_id "g238.t1"; gene_id "g238";
Scaffold_13	AUGUSTUS	CDS	59908	60292	0.73	-	2	transcript_id "g238.t1"; gene_id "g238";
Scaffold_13	AUGUSTUS	CDS	60349	60400	0.87	-	0	transcript_id "g238.t1"; gene_id "g238";
Scaffold_13	AUGUSTUS	start_codon	60398	60400	.	-	0	transcript_id "g238.t1"; gene_id "g238";
# protein sequence = [MTSELAQFLKSPKTVSVRCPFSGGQPKIGVDEGPIHLVEAGLVNQLQELGWNVKFDGHHQFEDIKYTLSSSSATASSP
# AAGTDNDTSTTSNHWDPPIGILKNPRLVSRVCEEVAKVVSGHAKKGELPLTLGGDHSLAMGTISGTLDAHPSAGVIWVDAHADINTAATTESGNIHGM
# PVSFLMGLDGNHQAFSDYNKSNSPSLETPFAWIKPVLKPSSIVYIGLRDVDSGEKKILKDNGIKAFSMHDVDRYGIGKVVEMALDYLNADNTNPDEVR
# PIHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICERIWETGALVGLDLMVSPFYSPFH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g238
###
# start gene g239
Scaffold_13	AUGUSTUS	gene	60859	62190	0.4	-	.	g239
Scaffold_13	AUGUSTUS	transcript	60859	62190	0.4	-	.	g239.t1
Scaffold_13	AUGUSTUS	stop_codon	60859	60861	.	-	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_13	AUGUSTUS	CDS	60859	61673	0.58	-	2	transcript_id "g239.t1"; gene_id "g239";
Scaffold_13	AUGUSTUS	CDS	61824	62190	0.51	-	0	transcript_id "g239.t1"; gene_id "g239";
Scaffold_13	AUGUSTUS	start_codon	62188	62190	.	-	0	transcript_id "g239.t1"; gene_id "g239";
# protein sequence = [MITSGCIRDWSQVKDGTVLKVSWPQAAKRNLEARMFSACTGDFGSPDHIISFEACHEDGSPVSNSIFLSSANDNLENV
# FWNLHGAKPPPVYPKPDFRSLCFSLTRDEGETLENCTSAFELMESATAFRRDFSALPVRNLILPSSTKDIGSLNSFPELITAVENDKHRSIADIAYKI
# HKHAQEFTSGAGCKAIWTDGDMGADMAGYFERLAHDGTVLVSVFSRICHCVNIIDSVFKGTPQFMSTGKWLINESKKNVQSPAHDIESFLWVGLWSTL
# RNTKFPKSARNEIRWSQSIAEGYAFRETTANNIQDTLADIKDGFPQPYSNLLHAMAPILDEWFDAIRQLRKDWKQGWRNTNRDRAEDVNLLCHSFAYR
# GVLDLIEIFQRHKEDLKKTVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g239
###
# start gene g240
Scaffold_13	AUGUSTUS	gene	62816	64501	0.17	-	.	g240
Scaffold_13	AUGUSTUS	transcript	62816	64501	0.17	-	.	g240.t1
Scaffold_13	AUGUSTUS	stop_codon	62816	62818	.	-	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_13	AUGUSTUS	CDS	62816	63636	0.59	-	2	transcript_id "g240.t1"; gene_id "g240";
Scaffold_13	AUGUSTUS	CDS	63786	64211	0.54	-	2	transcript_id "g240.t1"; gene_id "g240";
Scaffold_13	AUGUSTUS	CDS	64267	64501	0.31	-	0	transcript_id "g240.t1"; gene_id "g240";
Scaffold_13	AUGUSTUS	start_codon	64499	64501	.	-	0	transcript_id "g240.t1"; gene_id "g240";
# protein sequence = [MFDVIQRAKEVHQSHNCHFLIKSPLAAIIYAPGKGVSVEVNQYLTLADSWFIEEATGRNESLPPSGHGPESIQHKESS
# DNNRLYCFHNKDIKFTLPRWKLTSGNIQDWSEVKDGGVLKGSWPQAAKRNLEARMFSACTGDFGSPDHIMSFEACYEDGSPVSNSIFLPSANDNLENV
# FWNLHSAKSPLVYPKPDFRSLCFSLTRDEGETLENCTSAFELMESATAFRRDFSALPVGNLISARDIGSLNSFPELIAAVENDKHKSIADIAFKIHKH
# AQVLTSGSGCKAIWTDGDMGADMVRYFERLTHDGAVSVSYFRCLRFLLFIQFISYPIYPVVKGTTQFMSKRLLKGRFQNEIQSPADDMESFFWVGLWS
# TLKNTNFPKSAEQEIQWSWSIAQSHTSRETTAIDIQEDLDDIKEGFPQPYSNLLHAMAPILDEWFDTIRQLRKDWKQGWRNTNRDRPEDVNLLFHSFA
# YRGVLDFIEIFQKHKEDLEQTIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g240
###
# start gene g241
Scaffold_13	AUGUSTUS	gene	73034	75541	0.4	-	.	g241
Scaffold_13	AUGUSTUS	transcript	73034	75541	0.4	-	.	g241.t1
Scaffold_13	AUGUSTUS	stop_codon	73034	73036	.	-	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_13	AUGUSTUS	CDS	73034	75541	0.4	-	0	transcript_id "g241.t1"; gene_id "g241";
Scaffold_13	AUGUSTUS	start_codon	75539	75541	.	-	0	transcript_id "g241.t1"; gene_id "g241";
# protein sequence = [MNSLHFLGIRLVLSHSLSLSISISFTGPHMSTEVEALREKHQKDLQRLEEVQQRESELIETLAEAEVGHAAAIEDLRK
# AHSDAMKQKQKELDNLLSRMSEEHEVALSTLGRELAAASSTLKQALQSHEEAFGKLQQEHEEELRSKLQEASDTLSRVRQEHEGFLLKATDAHAEALK
# QKDLEVTASIQQTEEDYYNALTQMRSDHAEALLRHTAESTAALEKLKEEHAAEIRMSERAKESLLSESQSSRGLALQELQDEHSSAIFRKEVSHTEDL
# EKLKADHARALLDKDKDAEIELGKLRAAIARKETTLNEELGKVKSDHIAALSSLQAEHTTALSSLQADHVAAISSIRDEHASILSSTHTDHASALTLA
# KAEYVSQLDQLRAEHEEAVFKLKEEQKAEGERLTSALSSLENDSSAAAVEARNVIDAAVQSQREQQAALLAEITRSHADELEQLKAFHEQMSQDLVTT
# SEAKIATLLESHTVEVLKLRTQHQQEITELNNTMVAIQEQHKESLENMRALSERSVAETTQSLKAELNDLNRQHLKDSEKLRKENELLMQELEAHKVA
# ADEFLLRDQSRQIHEEQIAEKDNAIRTVEDRLSVVENERDGLASDLAKLRAEFERTRTEQSLLVQEASKRESLVMELERHRSVLAEMQENLQRVKDEK
# DTLQIEKGRSDSIVRELQAQIARSGSPPNGRPATERFNRIPGAAGIKLPPPTPPPSVPPPPAPRSIQHDPGFSASSAGTSSSSRDSQQIPESPATPAT
# SLGGSIITSISAVTDTKALVKIDEQARQLEEQEAMIKTLNKQLTHCESDLQTHMDLVSTLETSLGDSEKNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g241
###
# start gene g242
Scaffold_13	AUGUSTUS	gene	75575	76015	0.28	-	.	g242
Scaffold_13	AUGUSTUS	transcript	75575	76015	0.28	-	.	g242.t1
Scaffold_13	AUGUSTUS	stop_codon	75575	75577	.	-	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_13	AUGUSTUS	CDS	75575	76015	0.28	-	0	transcript_id "g242.t1"; gene_id "g242";
Scaffold_13	AUGUSTUS	start_codon	76013	76015	.	-	0	transcript_id "g242.t1"; gene_id "g242";
# protein sequence = [MRLQEVLKEREAEISTLELSLLKATQTESSASSTSDQLRDLKLELDNAHDDEPAPESFLSPQTINKFAHIRRSMQFHS
# ENGNSQRDHDSNSASDSMVSDTDESLDRLNELMLYVASNALTLVSTHLIISTDLWHRRSRVTERLSIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g242
###
# start gene g243
Scaffold_13	AUGUSTUS	gene	77211	78532	0.42	-	.	g243
Scaffold_13	AUGUSTUS	transcript	77211	78532	0.42	-	.	g243.t1
Scaffold_13	AUGUSTUS	stop_codon	77211	77213	.	-	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_13	AUGUSTUS	CDS	77211	78042	0.45	-	1	transcript_id "g243.t1"; gene_id "g243";
Scaffold_13	AUGUSTUS	CDS	78159	78532	0.42	-	0	transcript_id "g243.t1"; gene_id "g243";
Scaffold_13	AUGUSTUS	start_codon	78530	78532	.	-	0	transcript_id "g243.t1"; gene_id "g243";
# protein sequence = [MNAQSSRSHAIFSLTFTQKKYSGMGAPPRSSSPLPPGGRSPSRLARPGSVYSGSGSGSTSGNRVGSPTLGRPATPSFA
# AAMGRGGGLRPSSALGHAGDRASAGGDDEGGEWTTIVSKFHFVDLAGGLLALGNVISALGDPSRAKSHTATHVPYRDSKLTRLLQDSLGGNAHTLMIA
# CVSPAEWNAAETINTLKYANRARNIKNRAVVNEKEDGWDDVEWLQGTVTRLRKEVKILKIGGSISSIDVAVPEPVEGAGKKVLAQMTELQNNYQDLRA
# KFVERTEELTRLRRELGEKHRGSSGAVSGTGKYEEIVGPVIEEYEKTIAAMEAELSLNRAALRHTNEMVEEKEEELAAVTERHSATELYVEELRSRLA
# KLSEREASTEVRTLHLNLKYRKLIAAFRP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g243
###
# start gene g244
Scaffold_13	AUGUSTUS	gene	78625	78933	0.95	-	.	g244
Scaffold_13	AUGUSTUS	transcript	78625	78933	0.95	-	.	g244.t1
Scaffold_13	AUGUSTUS	stop_codon	78625	78627	.	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_13	AUGUSTUS	CDS	78625	78933	0.95	-	0	transcript_id "g244.t1"; gene_id "g244";
Scaffold_13	AUGUSTUS	start_codon	78931	78933	.	-	0	transcript_id "g244.t1"; gene_id "g244";
# protein sequence = [MTGIDLDANPSDPNNGMGIIPRAVSTIFAEARRLKEERGSSWNYSIKGSFIEIYNEDLIDLLSMDDGAGGRREVQIRE
# DKDGHIIWGGLREVNVKNPNEVMT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g244
###
# start gene g245
Scaffold_13	AUGUSTUS	gene	83002	83418	0.99	+	.	g245
Scaffold_13	AUGUSTUS	transcript	83002	83418	0.99	+	.	g245.t1
Scaffold_13	AUGUSTUS	start_codon	83002	83004	.	+	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_13	AUGUSTUS	CDS	83002	83418	0.99	+	0	transcript_id "g245.t1"; gene_id "g245";
Scaffold_13	AUGUSTUS	stop_codon	83416	83418	.	+	0	transcript_id "g245.t1"; gene_id "g245";
# protein sequence = [MSIDLEWVKLDSTLSLTLVNILNRQLSTTARPSFIGPVEVTSIEFGTTAPDIELVDLRDIYRDFLEDDEDDENELKAT
# VGTEEDDEAFEWVSRKAARREEGLAFQQQPQFARGPMNMFASTPTLHSPAMETWILLSPA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g245
###
# start gene g246
Scaffold_13	AUGUSTUS	gene	88200	90616	0.19	-	.	g246
Scaffold_13	AUGUSTUS	transcript	88200	90616	0.19	-	.	g246.t1
Scaffold_13	AUGUSTUS	stop_codon	88200	88202	.	-	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_13	AUGUSTUS	CDS	88200	88627	0.71	-	2	transcript_id "g246.t1"; gene_id "g246";
Scaffold_13	AUGUSTUS	CDS	90058	90616	0.21	-	0	transcript_id "g246.t1"; gene_id "g246";
Scaffold_13	AUGUSTUS	start_codon	90614	90616	.	-	0	transcript_id "g246.t1"; gene_id "g246";
# protein sequence = [MRVNFAIRKHELLTRSLRKMERTLDTVLRSIGNPSIASGMISRSPSPSAQNSSTQALLNRSPSPSAAVGSGGSPKLHS
# LPDNALNPLGLLAEASLANRRAHIGTSSSFRARADNPGENPKVGVANDIYFKPGKFYFHSSLVCTDVSTGPMTILPLRRLYIERQVQPEMLTFVSTQE
# VVALFKMFVDHNEQTTITLIRDVADILEANSVNPTHTPALYSTFLKALISARLERPSEEKTRSSDVLNGDIGSAGHQVHFQDTDTIHTLSEFQFEGEM
# GPVADVSTFPPTMAPDPMEDPVSGMTMDSIFSSNFWDSVLVPGTSTFSVRSSFD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g246
###
# start gene g247
Scaffold_13	AUGUSTUS	gene	90821	91318	0.8	-	.	g247
Scaffold_13	AUGUSTUS	transcript	90821	91318	0.8	-	.	g247.t1
Scaffold_13	AUGUSTUS	stop_codon	90821	90823	.	-	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_13	AUGUSTUS	CDS	90821	91318	0.8	-	0	transcript_id "g247.t1"; gene_id "g247";
Scaffold_13	AUGUSTUS	start_codon	91316	91318	.	-	0	transcript_id "g247.t1"; gene_id "g247";
# protein sequence = [MPIPLYSYPSYRHAPSYHYSSAPYAEVLSLSSQDYDMSQDHSLPHLNQPPSPSIPIDPSLALYSPYYHSYQQQPQQHL
# PPHLSIAPNYPSPSSQGSDTIGTPPTEHMYPTGSSSSNANGKRPASAISTASGSEAVKKARKDDELSEIRSPTADKEEKPKPTRGSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g247
###
# start gene g248
Scaffold_13	AUGUSTUS	gene	103355	104983	0.36	+	.	g248
Scaffold_13	AUGUSTUS	transcript	103355	104983	0.36	+	.	g248.t1
Scaffold_13	AUGUSTUS	start_codon	103355	103357	.	+	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_13	AUGUSTUS	CDS	103355	104983	0.36	+	0	transcript_id "g248.t1"; gene_id "g248";
Scaffold_13	AUGUSTUS	stop_codon	104981	104983	.	+	0	transcript_id "g248.t1"; gene_id "g248";
# protein sequence = [MDGTVRLWSITTGECLHVLSGHTSLVGLLGLSPSFLVSAAADSTLRVWDARLPSNDGSYNRTSLGPSPSSNSADLLRG
# VMTGHTGAITCFQHDEWKVVSGSDGTLKVWDLRDLNFANTSSSTLNVAGGTGTGGWGIPGAGWGAAGFGAIPGAAIGFGGAAAPGPAAVGGAGAPGGG
# AVPVVRDLLTGITGVWQVAFEGRWCVSASNRNDVTVLDVWDFSKTEIATGDPLSNTTGSGIIEVNEEQEERERESKEGNVWTWEDEEWVGEPPGAIYD
# YEDSDVEDSDVEGDAGIVGRYQDGDIELISVHEERDDDDDDIVYTGRRPPSSGRQESIPPPYHVSRPPSKVFASSSLINAETQTAPRTRRTTRAMSEV
# SRTSEHSTRSRGSNSRMDVDVEIDVDVELMPEVPEEPLHEQEADIEGDGEYRNLADGLEGDDRDAEMVEDMMEIDRDFTESKRSSQIHSAARHRIASR
# RLEEEDINSLPEASTSRHRHGPARSKRAFTPSAPSRQVSGSSTKAFAGSYVGRRVMARRLLQTVLPNWAKEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g248
###
# start gene g249
Scaffold_13	AUGUSTUS	gene	105865	106575	0.84	-	.	g249
Scaffold_13	AUGUSTUS	transcript	105865	106575	0.84	-	.	g249.t1
Scaffold_13	AUGUSTUS	stop_codon	105865	105867	.	-	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_13	AUGUSTUS	CDS	105865	106575	0.84	-	0	transcript_id "g249.t1"; gene_id "g249";
Scaffold_13	AUGUSTUS	start_codon	106573	106575	.	-	0	transcript_id "g249.t1"; gene_id "g249";
# protein sequence = [MRLKDRTLRPKVLKQTRDLDATRASLLSPDKNLLEIAQIPSAEYHRRFIEAYTASQFSDVSTSDNVVIEQRPHQVGGL
# LYSHPSFLHTQLFATPQPGIILQNAEQKTTFGQETIFVGSFGGLTPVIRQEDRGDKIPLLNHNSPQGIERENIRRSVAKMRMVPGSVVIEEPPLSVAR
# NSSGLKTTRISSSAVVVGSQAMFSNSNPYRIGSMEYVALEPLKKKGDGKSGLPFFALLVR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g249
###
# start gene g250
Scaffold_13	AUGUSTUS	gene	114303	114737	1	+	.	g250
Scaffold_13	AUGUSTUS	transcript	114303	114737	1	+	.	g250.t1
Scaffold_13	AUGUSTUS	start_codon	114303	114305	.	+	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_13	AUGUSTUS	CDS	114303	114737	1	+	0	transcript_id "g250.t1"; gene_id "g250";
Scaffold_13	AUGUSTUS	stop_codon	114735	114737	.	+	0	transcript_id "g250.t1"; gene_id "g250";
# protein sequence = [MAPNRGQPHAEFGVAVNKDAKKSEVLSMAAGVAEDSATTVVEAEPKEATVSEAEDTSVARRDAVNSEVLSIAETIEPA
# DVVETVLEAAAIDVLAAEATVDTAEAEEASVLSDDAVKRDVLSIAETTADVAAVDIAIVLVAVVVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g250
###
# start gene g251
Scaffold_13	AUGUSTUS	gene	114867	115166	0.75	+	.	g251
Scaffold_13	AUGUSTUS	transcript	114867	115166	0.75	+	.	g251.t1
Scaffold_13	AUGUSTUS	start_codon	114867	114869	.	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_13	AUGUSTUS	CDS	114867	115166	0.75	+	0	transcript_id "g251.t1"; gene_id "g251";
Scaffold_13	AUGUSTUS	stop_codon	115164	115166	.	+	0	transcript_id "g251.t1"; gene_id "g251";
# protein sequence = [MVTVEFVVEVDTVVVLVLVLAESEKLNVEEANVALHEVATLVLVKVEKLLVEVEDADTTLDEAEALALVEFVELEAVD
# VEFEEVDVDVELEPLNHHWRH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g251
###
# start gene g252
Scaffold_13	AUGUSTUS	gene	116398	116994	0.91	-	.	g252
Scaffold_13	AUGUSTUS	transcript	116398	116994	0.91	-	.	g252.t1
Scaffold_13	AUGUSTUS	stop_codon	116398	116400	.	-	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_13	AUGUSTUS	CDS	116398	116994	0.91	-	0	transcript_id "g252.t1"; gene_id "g252";
Scaffold_13	AUGUSTUS	start_codon	116992	116994	.	-	0	transcript_id "g252.t1"; gene_id "g252";
# protein sequence = [MVPIIIAGLTTGSNDQREAAAYAIGDLVERTAPEAFKPFVVPFTGPLIRVATQATSYPPAVKTAILSGLMSMLERIPL
# FVKPFFPQLQRTFVKSASDPASVVVRTKAGRALGVLMKNQPRVDPVITELISGIRTSEEGIAGSLVLALANVIDGAGENVGEKARETCVEIVNDAFKE
# SHDGAFLHCSFVEGKTDFCSCL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g252
###
# start gene g253
Scaffold_13	AUGUSTUS	gene	119527	120255	0.63	-	.	g253
Scaffold_13	AUGUSTUS	transcript	119527	120255	0.63	-	.	g253.t1
Scaffold_13	AUGUSTUS	stop_codon	119527	119529	.	-	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_13	AUGUSTUS	CDS	119527	120255	0.63	-	0	transcript_id "g253.t1"; gene_id "g253";
Scaffold_13	AUGUSTUS	start_codon	120253	120255	.	-	0	transcript_id "g253.t1"; gene_id "g253";
# protein sequence = [MFEEHLSTPSSATETGDHIKEAVVILFGRVARHLDASDARIPNIVERLVEALKTPSEQVQIAVSECLSPLVNFMRPKV
# PALVDILLEDLFNAPKYASRRGAAYGLAGVIKGTGIGGMKEFSIVTKLRAASEDKKRYESRQGVLFAIETLSITLARLFEPYIEFILPILLTLFGDAS
# ADVREATQDASRIIMGNMSGYGVKLILPSLLSGLDEKQWRSKKGSIELLGMMAYCSHASFHSRFLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g253
###
# start gene g254
Scaffold_13	AUGUSTUS	gene	122824	123483	0.64	-	.	g254
Scaffold_13	AUGUSTUS	transcript	122824	123483	0.64	-	.	g254.t1
Scaffold_13	AUGUSTUS	stop_codon	122824	122826	.	-	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_13	AUGUSTUS	CDS	122824	123483	0.64	-	0	transcript_id "g254.t1"; gene_id "g254";
Scaffold_13	AUGUSTUS	start_codon	123481	123483	.	-	0	transcript_id "g254.t1"; gene_id "g254";
# protein sequence = [MLASLPPSSAISETLVQTAVPLLAKETHEGAVMILADALPSHVNFLLSNNKPLTPEVTGLISKEMGGIKPSIRHAFCL
# MAGSALWRTGTKTTDTDAMLEFTKAIMPALNTTLKNVAANPLNASGGVLEAYIAIALLLGPLAKSGEFDDFVAKNPVLHGISTVGVKPSFLLWDKVYQ
# KATDVNDEKWLLRACEAAVVYFNAEISKSEALRLAITLSYVIF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g254
###
# start gene g255
Scaffold_13	AUGUSTUS	gene	124577	124854	0.69	-	.	g255
Scaffold_13	AUGUSTUS	transcript	124577	124854	0.69	-	.	g255.t1
Scaffold_13	AUGUSTUS	stop_codon	124577	124579	.	-	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_13	AUGUSTUS	CDS	124577	124783	0.69	-	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_13	AUGUSTUS	CDS	124849	124854	0.7	-	0	transcript_id "g255.t1"; gene_id "g255";
Scaffold_13	AUGUSTUS	start_codon	124852	124854	.	-	0	transcript_id "g255.t1"; gene_id "g255";
# protein sequence = [MEVMDIFRLLTLTYPRYSDSPSREAVEEVGMVLVKRDELRGTEDGPPDELKMGVAEQVVGWISNEVSQFR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g255
###
# start gene g256
Scaffold_13	AUGUSTUS	gene	129088	129840	0.15	+	.	g256
Scaffold_13	AUGUSTUS	transcript	129088	129840	0.15	+	.	g256.t1
Scaffold_13	AUGUSTUS	start_codon	129088	129090	.	+	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_13	AUGUSTUS	CDS	129088	129340	0.46	+	0	transcript_id "g256.t1"; gene_id "g256";
Scaffold_13	AUGUSTUS	CDS	129653	129840	0.15	+	2	transcript_id "g256.t1"; gene_id "g256";
Scaffold_13	AUGUSTUS	stop_codon	129838	129840	.	+	0	transcript_id "g256.t1"; gene_id "g256";
# protein sequence = [MIRNGDIVEVYQVLPIAQSSFDCRLNDFFQKWDADNTTWQRVGEVVDAVGQGRKQLYQGKEYDYVFDVDIQDGVPPLK
# LPYNVTGPSTYVDPYTGASRYSGNSAAPSAVPPASSEYMDPFTGASRYSGAPPSKPPTSASPKRIPMV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g256
###
# start gene g257
Scaffold_13	AUGUSTUS	gene	132410	132712	0.7	-	.	g257
Scaffold_13	AUGUSTUS	transcript	132410	132712	0.7	-	.	g257.t1
Scaffold_13	AUGUSTUS	stop_codon	132410	132412	.	-	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_13	AUGUSTUS	CDS	132410	132712	0.7	-	0	transcript_id "g257.t1"; gene_id "g257";
Scaffold_13	AUGUSTUS	start_codon	132710	132712	.	-	0	transcript_id "g257.t1"; gene_id "g257";
# protein sequence = [MHVSVSSAQVSLFLMLLYRSSGNIGLPQSSGQNYTQNLRQFSSTPDEDAVAAMDVSEKTNHNDMPTVEDVSYQSIPRP
# GRRAHIRTRVIKTAIGYDKKKW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g257
###
# start gene g258
Scaffold_13	AUGUSTUS	gene	135292	135657	0.75	+	.	g258
Scaffold_13	AUGUSTUS	transcript	135292	135657	0.75	+	.	g258.t1
Scaffold_13	AUGUSTUS	start_codon	135292	135294	.	+	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_13	AUGUSTUS	CDS	135292	135657	0.75	+	0	transcript_id "g258.t1"; gene_id "g258";
Scaffold_13	AUGUSTUS	stop_codon	135655	135657	.	+	0	transcript_id "g258.t1"; gene_id "g258";
# protein sequence = [MSSTASSLSIPRFPESSQLAGENTWRIFKDQVLAHIEVRELEGYLDGTIIRPPAGGYVSTSTLYPPASTTTPTYSPTP
# FPHEWRQRDRMAASIIYLNIVDPVGLGVEREKPAYHIWAELKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g258
###
# start gene g259
Scaffold_13	AUGUSTUS	gene	139675	141631	0.25	+	.	g259
Scaffold_13	AUGUSTUS	transcript	139675	141631	0.25	+	.	g259.t1
Scaffold_13	AUGUSTUS	start_codon	139675	139677	.	+	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_13	AUGUSTUS	CDS	139675	139882	0.55	+	0	transcript_id "g259.t1"; gene_id "g259";
Scaffold_13	AUGUSTUS	CDS	139941	140321	0.42	+	2	transcript_id "g259.t1"; gene_id "g259";
Scaffold_13	AUGUSTUS	CDS	141084	141631	0.92	+	2	transcript_id "g259.t1"; gene_id "g259";
Scaffold_13	AUGUSTUS	stop_codon	141629	141631	.	+	0	transcript_id "g259.t1"; gene_id "g259";
# protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS
# KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE
# AEDEDIAPPPKRLKTTSSISDLAISLRRAIDLNDQLKQLESLFDSTRDLFLRSVLDLQNAGEDPIVVLEALKAAEPNRRAISLNEWTLMATLFRWPSP
# FNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGASSQVGGSIPMELDLPAIESLAEPALSPEKGA
# EPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g259
###
# start gene g260
Scaffold_13	AUGUSTUS	gene	143329	144106	0.34	+	.	g260
Scaffold_13	AUGUSTUS	transcript	143329	144106	0.34	+	.	g260.t1
Scaffold_13	AUGUSTUS	start_codon	143329	143331	.	+	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_13	AUGUSTUS	CDS	143329	143355	0.34	+	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_13	AUGUSTUS	CDS	143462	143597	0.77	+	0	transcript_id "g260.t1"; gene_id "g260";
Scaffold_13	AUGUSTUS	CDS	143679	144106	1	+	2	transcript_id "g260.t1"; gene_id "g260";
Scaffold_13	AUGUSTUS	stop_codon	144104	144106	.	+	0	transcript_id "g260.t1"; gene_id "g260";
# protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA
# PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERA
# TTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g260
###
# start gene g261
Scaffold_13	AUGUSTUS	gene	144508	146828	0.5	-	.	g261
Scaffold_13	AUGUSTUS	transcript	144508	146828	0.5	-	.	g261.t1
Scaffold_13	AUGUSTUS	stop_codon	144508	144510	.	-	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_13	AUGUSTUS	CDS	144508	146234	0.99	-	2	transcript_id "g261.t1"; gene_id "g261";
Scaffold_13	AUGUSTUS	CDS	146306	146828	0.51	-	0	transcript_id "g261.t1"; gene_id "g261";
Scaffold_13	AUGUSTUS	start_codon	146826	146828	.	-	0	transcript_id "g261.t1"; gene_id "g261";
# protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGA
# THGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDNFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLE
# SKDATCEVFVRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLV
# VEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRD
# SLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFY
# FLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKD
# WDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHLHEKNQLNCQTIFMNLST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g261
###
# start gene g262
Scaffold_13	AUGUSTUS	gene	146942	148381	0.63	-	.	g262
Scaffold_13	AUGUSTUS	transcript	146942	148381	0.63	-	.	g262.t1
Scaffold_13	AUGUSTUS	stop_codon	146942	146944	.	-	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_13	AUGUSTUS	CDS	146942	147856	0.72	-	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_13	AUGUSTUS	CDS	147903	148302	0.67	-	1	transcript_id "g262.t1"; gene_id "g262";
Scaffold_13	AUGUSTUS	CDS	148359	148381	0.93	-	0	transcript_id "g262.t1"; gene_id "g262";
Scaffold_13	AUGUSTUS	start_codon	148379	148381	.	-	0	transcript_id "g262.t1"; gene_id "g262";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPE
# LSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERELMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIK
# SKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHR
# LVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g262
###
# start gene g263
Scaffold_13	AUGUSTUS	gene	148705	149082	0.25	-	.	g263
Scaffold_13	AUGUSTUS	transcript	148705	149082	0.25	-	.	g263.t1
Scaffold_13	AUGUSTUS	stop_codon	148705	148707	.	-	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_13	AUGUSTUS	CDS	148705	149082	0.25	-	0	transcript_id "g263.t1"; gene_id "g263";
Scaffold_13	AUGUSTUS	start_codon	149080	149082	.	-	0	transcript_id "g263.t1"; gene_id "g263";
# protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV
# GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEHDSKGNFHSSMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g263
###
# start gene g264
Scaffold_13	AUGUSTUS	gene	149402	149817	0.12	-	.	g264
Scaffold_13	AUGUSTUS	transcript	149402	149817	0.12	-	.	g264.t1
Scaffold_13	AUGUSTUS	stop_codon	149402	149404	.	-	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_13	AUGUSTUS	CDS	149402	149746	0.22	-	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_13	AUGUSTUS	CDS	149791	149817	0.22	-	0	transcript_id "g264.t1"; gene_id "g264";
Scaffold_13	AUGUSTUS	start_codon	149815	149817	.	-	0	transcript_id "g264.t1"; gene_id "g264";
# protein sequence = [MIMFNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTK
# TNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRICLKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g264
###
# start gene g265
Scaffold_13	AUGUSTUS	gene	150168	151693	0.16	-	.	g265
Scaffold_13	AUGUSTUS	transcript	150168	151693	0.16	-	.	g265.t1
Scaffold_13	AUGUSTUS	stop_codon	150168	150170	.	-	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_13	AUGUSTUS	CDS	150168	150853	0.59	-	2	transcript_id "g265.t1"; gene_id "g265";
Scaffold_13	AUGUSTUS	CDS	150973	151693	0.16	-	0	transcript_id "g265.t1"; gene_id "g265";
Scaffold_13	AUGUSTUS	start_codon	151691	151693	.	-	0	transcript_id "g265.t1"; gene_id "g265";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFKSLIPRELTEEQQQMVALNKDLMEANMKEIRAVK
# SLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRY
# KLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g265
###
# start gene g266
Scaffold_13	AUGUSTUS	gene	162993	163703	0.29	-	.	g266
Scaffold_13	AUGUSTUS	transcript	162993	163703	0.29	-	.	g266.t1
Scaffold_13	AUGUSTUS	stop_codon	162993	162995	.	-	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_13	AUGUSTUS	CDS	162993	163703	0.29	-	0	transcript_id "g266.t1"; gene_id "g266";
Scaffold_13	AUGUSTUS	start_codon	163701	163703	.	-	0	transcript_id "g266.t1"; gene_id "g266";
# protein sequence = [MPFGLMNAPSAFQFFMNERFHDMVDICRVIYLDDILIYLDNKASHVEHVRKVLERLRVNHLHAKPEKCAFHVDTVEYL
# GVIISPLGVSMDPEKVKAVMDWPKPRMVKELQVFLGFANFYRRFIDNYLGITKVFMKLLQKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLLVI
# LECDASDLAIAGIISQLYPETGEIHPIAFHARSMISANKLASFLCERERKESNGHSNQPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g266
###
# start gene g267
Scaffold_13	AUGUSTUS	gene	166370	167413	0.67	-	.	g267
Scaffold_13	AUGUSTUS	transcript	166370	167413	0.67	-	.	g267.t1
Scaffold_13	AUGUSTUS	stop_codon	166370	166372	.	-	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_13	AUGUSTUS	CDS	166370	167413	0.67	-	0	transcript_id "g267.t1"; gene_id "g267";
Scaffold_13	AUGUSTUS	start_codon	167411	167413	.	-	0	transcript_id "g267.t1"; gene_id "g267";
# protein sequence = [MIHCFPTTTELTAEGVADFYYKEIFRLHGLPRRFISDRGPQFAADIMKALLKRLGIESALTTSYHPETNGQTERANQE
# IERYIRMYVSRRQDDWDRLLPTAEFVINSRVHFAHDKAPFEVLYGYPRILHPHRILEGIPFITDRLDALRHAREDAEAALRMSKQRIADTIAEHPNQP
# SFEVGQPVWLSVNNLKIRRKSEKLGSRRLGPFEVIEKTGAHTYRLALPTWMKIHDNINVKRLAPWKGNEVNGILPAPPEPEVIDGEEFYDVDRILDSR
# IHGRWKKLQYLVRWKGYDEGHDTWENEENVVGSSDEAINEFYAAHPNAPRKISATIFHSLPWQPMVNFTEVNN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g267
###
# start gene g268
Scaffold_13	AUGUSTUS	gene	170637	171320	0.38	-	.	g268
Scaffold_13	AUGUSTUS	transcript	170637	171320	0.38	-	.	g268.t1
Scaffold_13	AUGUSTUS	stop_codon	170637	170639	.	-	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_13	AUGUSTUS	CDS	170637	171320	0.38	-	0	transcript_id "g268.t1"; gene_id "g268";
Scaffold_13	AUGUSTUS	start_codon	171318	171320	.	-	0	transcript_id "g268.t1"; gene_id "g268";
# protein sequence = [MSSAQDVRDAITELTKNQAKLQDVVSELVSGLSTTKSVGKPQNYNGKRGEDARRFLAAFELWANSIPALSTDRKKKIT
# SAITYLEGDAAIWATPISETINRSSITGSGVPFPYDTWEEFVTAFKTRFETTDASADAKQLLKRLYQNRTTVGTYASTFQQYADRTGYSDKDLRDRFY
# DHLADRVKDGLVFTTRPTGSLQELIEAAIDVDNRQITQRGSKERNWSMMES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g268
###
# start gene g269
Scaffold_13	AUGUSTUS	gene	183297	183668	0.97	+	.	g269
Scaffold_13	AUGUSTUS	transcript	183297	183668	0.97	+	.	g269.t1
Scaffold_13	AUGUSTUS	start_codon	183297	183299	.	+	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_13	AUGUSTUS	CDS	183297	183668	0.97	+	0	transcript_id "g269.t1"; gene_id "g269";
Scaffold_13	AUGUSTUS	stop_codon	183666	183668	.	+	0	transcript_id "g269.t1"; gene_id "g269";
# protein sequence = [MGKSRNLEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLIPGA
# PATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPPNHPSHPQSSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g269
###
# start gene g270
Scaffold_13	AUGUSTUS	gene	194106	194705	0.82	-	.	g270
Scaffold_13	AUGUSTUS	transcript	194106	194705	0.82	-	.	g270.t1
Scaffold_13	AUGUSTUS	stop_codon	194106	194108	.	-	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_13	AUGUSTUS	CDS	194106	194705	0.82	-	0	transcript_id "g270.t1"; gene_id "g270";
Scaffold_13	AUGUSTUS	start_codon	194703	194705	.	-	0	transcript_id "g270.t1"; gene_id "g270";
# protein sequence = [MLISTVLDLNQAKDKPTGTGERKQLYFDALAAEKGISGKVSLGDIQDDDDGNNNSDDDEDIMDISSESEHDNDSKVVK
# KKGKKQVETVLTKAYKMEAPLCLPSRKTQSANFLDKLSISLDPQALQQRDENRTAASFQLLMLQNYQTQVATLTSQVNEERRRADDAEAELRMYWMLD
# RTRHRSPSPSLPSSILLFPFPFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g270
###
# start gene g271
Scaffold_13	AUGUSTUS	gene	201243	202280	0.99	+	.	g271
Scaffold_13	AUGUSTUS	transcript	201243	202280	0.99	+	.	g271.t1
Scaffold_13	AUGUSTUS	start_codon	201243	201245	.	+	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_13	AUGUSTUS	CDS	201243	202280	0.99	+	0	transcript_id "g271.t1"; gene_id "g271";
Scaffold_13	AUGUSTUS	stop_codon	202278	202280	.	+	0	transcript_id "g271.t1"; gene_id "g271";
# protein sequence = [MNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLK
# EFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPT
# MTGRNTGHAPAHTAHITPADPHAMDIDATHTSTGNSREAFLARMRGRCFGCGAQGHVKQNCPHKETTCRYCGRRGHLESVCQDKFMGLSRDRGRRQQP
# RRQQISATAAPFTLFPNESVQIAASIPTPVAGPAIPSPANQDFSTQIGQIRELLDRANAMSPPSSGFQQGF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g271
###
# start gene g272
Scaffold_13	AUGUSTUS	gene	202331	206038	0.98	+	.	g272
Scaffold_13	AUGUSTUS	transcript	202331	206038	0.98	+	.	g272.t1
Scaffold_13	AUGUSTUS	start_codon	202331	202333	.	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_13	AUGUSTUS	CDS	202331	206038	0.98	+	0	transcript_id "g272.t1"; gene_id "g272";
Scaffold_13	AUGUSTUS	stop_codon	206036	206038	.	+	0	transcript_id "g272.t1"; gene_id "g272";
# protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN
# EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA
# SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD
# IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE
# VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ
# QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII
# TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV
# LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ
# RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA
# RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE
# ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNP
# INGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKKHPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g272
###
# start gene g273
Scaffold_13	AUGUSTUS	gene	206940	208309	0.09	+	.	g273
Scaffold_13	AUGUSTUS	transcript	206940	208309	0.09	+	.	g273.t1
Scaffold_13	AUGUSTUS	start_codon	206940	206942	.	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_13	AUGUSTUS	CDS	206940	207107	0.94	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_13	AUGUSTUS	CDS	207164	207517	0.35	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_13	AUGUSTUS	CDS	207605	207626	0.91	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_13	AUGUSTUS	CDS	207735	207874	0.19	+	2	transcript_id "g273.t1"; gene_id "g273";
Scaffold_13	AUGUSTUS	CDS	207959	208309	0.35	+	0	transcript_id "g273.t1"; gene_id "g273";
Scaffold_13	AUGUSTUS	stop_codon	208307	208309	.	+	0	transcript_id "g273.t1"; gene_id "g273";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLENVTLRSHVRQVSNLTARQSII
# DTLCLGHNYFLTSSVILTSSNILSSWLLPMMLVYVSILFRTIYINSLQNTFVRNRLLDRARSVHSDHEASTRSDNSRFVKKSKKKQQDLLPLVTSNMN
# SASRTKLSQHSLSHCCSNKGSNKDEKSAVNDVSPRLQQGSLPRRQSCFIQLYQAYQSCSAQVVSTNLDTPPAPLESQSTKFIAATLNFQAAEFEFNAN
# LVKTYATRARIAKVIADEACSILKSHQDSSSDSSASDASFATAQSIPTTGSEDTVVTPTEIAVPVPKTVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g273
###
# start gene g274
Scaffold_13	AUGUSTUS	gene	208635	210902	0.1	-	.	g274
Scaffold_13	AUGUSTUS	transcript	208635	210902	0.1	-	.	g274.t1
Scaffold_13	AUGUSTUS	stop_codon	208635	208637	.	-	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_13	AUGUSTUS	CDS	208635	209184	0.52	-	1	transcript_id "g274.t1"; gene_id "g274";
Scaffold_13	AUGUSTUS	CDS	209607	209749	0.96	-	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_13	AUGUSTUS	CDS	209849	210060	0.39	-	2	transcript_id "g274.t1"; gene_id "g274";
Scaffold_13	AUGUSTUS	CDS	210166	210499	0.88	-	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_13	AUGUSTUS	CDS	210624	210902	0.34	-	0	transcript_id "g274.t1"; gene_id "g274";
Scaffold_13	AUGUSTUS	start_codon	210900	210902	.	-	0	transcript_id "g274.t1"; gene_id "g274";
# protein sequence = [MDELKDGIRESPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA
# LEASYYHVYGCRRLTCNPWSDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEA
# LDEERSYEIRRNHMLEAKTQHVKSSVGILLVDPSDESLEEMSKDERIKFIRLIKKFQVNDQGRCTIGITDQPDQPQLVVEKEKCMHMLNSAHDCLGHK
# GTDEAVESTSYFDAYTFIVSEGNVDTMIMSIPSNGCKYIIHGRDSLSSXILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFEQKYRHTIK
# DWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTSEQLDLMVEDED
# EYWMTPENDYIFDAIPHLRLSDTDSDEKLSEEEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g274
###
# start gene g275
Scaffold_13	AUGUSTUS	gene	211943	212471	0.39	-	.	g275
Scaffold_13	AUGUSTUS	transcript	211943	212471	0.39	-	.	g275.t1
Scaffold_13	AUGUSTUS	stop_codon	211943	211945	.	-	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_13	AUGUSTUS	CDS	211943	212284	0.46	-	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_13	AUGUSTUS	CDS	212367	212471	0.67	-	0	transcript_id "g275.t1"; gene_id "g275";
Scaffold_13	AUGUSTUS	start_codon	212469	212471	.	-	0	transcript_id "g275.t1"; gene_id "g275";
# protein sequence = [MIIGINLKTLRELGREWFDMKYSKEELNCSKDPNRTGLVNEPPTNKLEENIKLNQQDRPPINLIDETNKQVVNEAIGV
# EKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTKRGKRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g275
###
# start gene g276
Scaffold_13	AUGUSTUS	gene	212973	213818	0.33	-	.	g276
Scaffold_13	AUGUSTUS	transcript	212973	213818	0.33	-	.	g276.t1
Scaffold_13	AUGUSTUS	stop_codon	212973	212975	.	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_13	AUGUSTUS	CDS	212973	213818	0.33	-	0	transcript_id "g276.t1"; gene_id "g276";
Scaffold_13	AUGUSTUS	start_codon	213816	213818	.	-	0	transcript_id "g276.t1"; gene_id "g276";
# protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY
# LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR
# LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKIVRAFHKK
# HPTAAKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g276
###
# start gene g277
Scaffold_13	AUGUSTUS	gene	214430	215908	0.8	-	.	g277
Scaffold_13	AUGUSTUS	transcript	214430	215908	0.8	-	.	g277.t1
Scaffold_13	AUGUSTUS	stop_codon	214430	214432	.	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_13	AUGUSTUS	CDS	214430	215908	0.8	-	0	transcript_id "g277.t1"; gene_id "g277";
Scaffold_13	AUGUSTUS	start_codon	215906	215908	.	-	0	transcript_id "g277.t1"; gene_id "g277";
# protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS
# PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL
# MNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGF
# LGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQ
# PAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADAFLVWQYIMYQIAMTI
# SNRPSLNLATSPKSPLQSYGTP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g277
###
# start gene g278
Scaffold_13	AUGUSTUS	gene	217006	217884	0.98	-	.	g278
Scaffold_13	AUGUSTUS	transcript	217006	217884	0.98	-	.	g278.t1
Scaffold_13	AUGUSTUS	stop_codon	217006	217008	.	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_13	AUGUSTUS	CDS	217006	217884	0.98	-	0	transcript_id "g278.t1"; gene_id "g278";
Scaffold_13	AUGUSTUS	start_codon	217882	217884	.	-	0	transcript_id "g278.t1"; gene_id "g278";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLIIVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNTGHAPAHTLTLPLPTLTPWTLMLLIPALGIAGRPSLPVCADDVLVVELKAMLS
# RIAHTRRLPADTVDAGDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g278
###
# start gene g279
Scaffold_13	AUGUSTUS	gene	224249	224845	0.54	+	.	g279
Scaffold_13	AUGUSTUS	transcript	224249	224845	0.54	+	.	g279.t1
Scaffold_13	AUGUSTUS	start_codon	224249	224251	.	+	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_13	AUGUSTUS	CDS	224249	224845	0.54	+	0	transcript_id "g279.t1"; gene_id "g279";
Scaffold_13	AUGUSTUS	stop_codon	224843	224845	.	+	0	transcript_id "g279.t1"; gene_id "g279";
# protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDKMARLPKPATLTDYRLEVLRIDNCYWKREETRKHEA
# GKPFIARNLKKGSSDFKTGSSNQHNNSQPSGSWRRSLKPKSFSGGKPNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKH
# QIADCNKRKAVRLRLKKPRSNH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g279
###
# start gene g280
Scaffold_13	AUGUSTUS	gene	237077	237766	0.7	+	.	g280
Scaffold_13	AUGUSTUS	transcript	237077	237766	0.7	+	.	g280.t1
Scaffold_13	AUGUSTUS	start_codon	237077	237079	.	+	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_13	AUGUSTUS	CDS	237077	237766	0.7	+	0	transcript_id "g280.t1"; gene_id "g280";
Scaffold_13	AUGUSTUS	stop_codon	237764	237766	.	+	0	transcript_id "g280.t1"; gene_id "g280";
# protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSF
# ETTIKHFPLLLRAHQLITLIHLVGDTLIYRLLQMFPRQIGTIFSIETQSRRRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g280
###
# start gene g281
Scaffold_13	AUGUSTUS	gene	237864	238472	0.55	+	.	g281
Scaffold_13	AUGUSTUS	transcript	237864	238472	0.55	+	.	g281.t1
Scaffold_13	AUGUSTUS	start_codon	237864	237866	.	+	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_13	AUGUSTUS	CDS	237864	238472	0.55	+	0	transcript_id "g281.t1"; gene_id "g281";
Scaffold_13	AUGUSTUS	stop_codon	238470	238472	.	+	0	transcript_id "g281.t1"; gene_id "g281";
# protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD
# HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS
# DRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g281
###
# start gene g282
Scaffold_13	AUGUSTUS	gene	238821	239925	0.47	+	.	g282
Scaffold_13	AUGUSTUS	transcript	238821	239925	0.47	+	.	g282.t1
Scaffold_13	AUGUSTUS	start_codon	238821	238823	.	+	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_13	AUGUSTUS	CDS	238821	238847	0.47	+	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_13	AUGUSTUS	CDS	238892	239222	0.62	+	0	transcript_id "g282.t1"; gene_id "g282";
Scaffold_13	AUGUSTUS	CDS	239273	239925	0.83	+	2	transcript_id "g282.t1"; gene_id "g282";
Scaffold_13	AUGUSTUS	stop_codon	239923	239925	.	+	0	transcript_id "g282.t1"; gene_id "g282";
# protein sequence = [MIMFNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTK
# TNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQAILQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEIN
# NKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNG
# DSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEMIQREIFIPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g282
###
# start gene g283
Scaffold_13	AUGUSTUS	gene	241981	242358	1	+	.	g283
Scaffold_13	AUGUSTUS	transcript	241981	242358	1	+	.	g283.t1
Scaffold_13	AUGUSTUS	start_codon	241981	241983	.	+	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_13	AUGUSTUS	CDS	241981	242358	1	+	0	transcript_id "g283.t1"; gene_id "g283";
Scaffold_13	AUGUSTUS	stop_codon	242356	242358	.	+	0	transcript_id "g283.t1"; gene_id "g283";
# protein sequence = [MDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLA
# LEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINHVKIMYTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g283
###
# start gene g284
Scaffold_13	AUGUSTUS	gene	248127	249195	0.38	-	.	g284
Scaffold_13	AUGUSTUS	transcript	248127	249195	0.38	-	.	g284.t1
Scaffold_13	AUGUSTUS	stop_codon	248127	248129	.	-	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_13	AUGUSTUS	CDS	248127	248385	1	-	1	transcript_id "g284.t1"; gene_id "g284";
Scaffold_13	AUGUSTUS	CDS	248900	248934	0.46	-	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_13	AUGUSTUS	CDS	248991	249123	0.84	-	1	transcript_id "g284.t1"; gene_id "g284";
Scaffold_13	AUGUSTUS	CDS	249188	249195	0.76	-	0	transcript_id "g284.t1"; gene_id "g284";
Scaffold_13	AUGUSTUS	start_codon	249193	249195	.	-	0	transcript_id "g284.t1"; gene_id "g284";
# protein sequence = [MLDAPLQCQNPIFNVNPEFLDLGVILTTQKASFTMQDLLQINRTICDPAIPAQACVSAFIHSGTSSAKITPDGHLVDA
# LQPPESVVKDLEDLDTQGSPPITVVEKDSGVEDVASLPEGSPIQTEMDLPLIESLTEPTLSPEKGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g284
###
# start gene g285
Scaffold_13	AUGUSTUS	gene	255685	256740	0.72	+	.	g285
Scaffold_13	AUGUSTUS	transcript	255685	256740	0.72	+	.	g285.t1
Scaffold_13	AUGUSTUS	start_codon	255685	255687	.	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_13	AUGUSTUS	CDS	255685	255981	0.72	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_13	AUGUSTUS	CDS	256162	256740	1	+	0	transcript_id "g285.t1"; gene_id "g285";
Scaffold_13	AUGUSTUS	stop_codon	256738	256740	.	+	0	transcript_id "g285.t1"; gene_id "g285";
# protein sequence = [MSHSRTQTITTPSSTTAGPSRSRPLNPPPADPVNDDDEALEEDDDEAIRQAEETVRRMKARKAAAAARRKAEEEAAKK
# AAEEAQRKKEAAARELEERRRPVGGDPDDGDDGDDDDDDEDDRTPCERCRSKRIPCLQQAGKRSSTTCKPCHDAKVRCSHSNRPPTVKKEVASHPTGE
# RLAVLESQVAQLLADNRVLREGQIKSNTYDRHIIKKLEWLMRDAARRRDSPPEMPEPGPSRLPKKRRRVVDSEEEEEDRIVGAEDGEGEEEVEEEEEI
# EPAPKKARSEKGKEREE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g285
###
# start gene g286
Scaffold_13	AUGUSTUS	gene	257105	257932	1	-	.	g286
Scaffold_13	AUGUSTUS	transcript	257105	257932	1	-	.	g286.t1
Scaffold_13	AUGUSTUS	stop_codon	257105	257107	.	-	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_13	AUGUSTUS	CDS	257105	257932	1	-	0	transcript_id "g286.t1"; gene_id "g286";
Scaffold_13	AUGUSTUS	start_codon	257930	257932	.	-	0	transcript_id "g286.t1"; gene_id "g286";
# protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE
# VDMKSDLARDFVVNLDELHAFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRR
# IHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADELHADELVPAFHARYPHKPG
# P]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g286
###
# start gene g287
Scaffold_13	AUGUSTUS	gene	260982	262469	0.18	-	.	g287
Scaffold_13	AUGUSTUS	transcript	260982	262469	0.18	-	.	g287.t1
Scaffold_13	AUGUSTUS	stop_codon	260982	260984	.	-	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_13	AUGUSTUS	CDS	260982	261310	0.55	-	2	transcript_id "g287.t1"; gene_id "g287";
Scaffold_13	AUGUSTUS	CDS	261973	262322	0.24	-	1	transcript_id "g287.t1"; gene_id "g287";
Scaffold_13	AUGUSTUS	CDS	262393	262469	0.76	-	0	transcript_id "g287.t1"; gene_id "g287";
Scaffold_13	AUGUSTUS	start_codon	262467	262469	.	-	0	transcript_id "g287.t1"; gene_id "g287";
# protein sequence = [MEEDQQFEYSTCTLVTDNLSKSDPSPHSPPYGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNNDD
# LDDDSGGLPRGEPGDPSGPASRRPGGPGGPGGPGGPRSPNLLTSPTSNELCWNSSGFKGSIETLAFGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQ
# SGGQRPAFNHLGADGKVLPSERERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEDSEN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g287
###
# start gene g288
Scaffold_13	AUGUSTUS	gene	268257	268902	0.37	+	.	g288
Scaffold_13	AUGUSTUS	transcript	268257	268902	0.37	+	.	g288.t1
Scaffold_13	AUGUSTUS	start_codon	268257	268259	.	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_13	AUGUSTUS	CDS	268257	268259	0.37	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_13	AUGUSTUS	CDS	268363	268902	0.92	+	0	transcript_id "g288.t1"; gene_id "g288";
Scaffold_13	AUGUSTUS	stop_codon	268900	268902	.	+	0	transcript_id "g288.t1"; gene_id "g288";
# protein sequence = [MRKHEAVLKTPPEVILQGIGEKAVKQGKYGVGQASTAYGAPPHWGYSYPPPPPLGYYTTPAYPGHYSNIPAPNPGSVA
# FSSPPSSPQKPAEFPHVNDWLAKLDSDEYRRRDNHNYIQFATIFAHEELTRLDDLHLIGSADKLRTLLACNLGNANRLWKYIVNDMDSITGGGRSSKK
# RQIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g288
###
# start gene g289
Scaffold_13	AUGUSTUS	gene	293112	295089	0.66	+	.	g289
Scaffold_13	AUGUSTUS	transcript	293112	295089	0.66	+	.	g289.t1
Scaffold_13	AUGUSTUS	start_codon	293112	293114	.	+	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_13	AUGUSTUS	CDS	293112	293459	0.67	+	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_13	AUGUSTUS	CDS	294133	295089	0.98	+	0	transcript_id "g289.t1"; gene_id "g289";
Scaffold_13	AUGUSTUS	stop_codon	295087	295089	.	+	0	transcript_id "g289.t1"; gene_id "g289";
# protein sequence = [MSLTSRSRPRLHVSTLSSTEYSSDEIVQSDEEPDADDFEETTPKAPDPAAPSHLQLRSVSYVTQRQLGSSKLPEVVAM
# SRSGRSGSMATVRLQRRTKLAEKLRDIFELDGIEEVQLIAIPYSAILDVDKSSALDFSETIEVKVYDKEAQEQFSIDSFFFAYFRDLPAALDQIRDAV
# RCRRTKGEASYTVLDTTATRNVAGPSGSTLPTSITSSSSLFRIPSILRPFSESRISSSSTTTSATEPQHEEFTHITKRVHSSSFIPITTTLSPTSLGD
# VEDDSLDTPIASTIIIDSRHTYPPSTSGSPVASTYLSIPQRSGTSNSASSSNGSSWAVNVPHWLKVPRTRNLFGGVADTLPVIPPGGEVREMYTSAVT
# TSPISAGSKLGNGGDLTYSILETPDAPIDDDIAEKFRNYFAYDERETLLGRACVPNYCSERY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g289
###
# start gene g290
Scaffold_13	AUGUSTUS	gene	295268	295798	0.63	+	.	g290
Scaffold_13	AUGUSTUS	transcript	295268	295798	0.63	+	.	g290.t1
Scaffold_13	AUGUSTUS	start_codon	295268	295270	.	+	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_13	AUGUSTUS	CDS	295268	295798	0.63	+	0	transcript_id "g290.t1"; gene_id "g290";
Scaffold_13	AUGUSTUS	stop_codon	295796	295798	.	+	0	transcript_id "g290.t1"; gene_id "g290";
# protein sequence = [MALPLRDILSVEKSKATRFGQHGLIVIVKGHEELFFEFGAEDKRDAFVRLIERQIDDVRRRLEEGEASLPTPGQRDAL
# ILEELDIHSYSPTAEEHRLSAPENLTDSLLAPMFSSSTFLTFKPQKSLHFTFLTIGSRGDVQPYIALAKGLQADGHKVRIATHKEFKEWIEAVSTSHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g290
###
# start gene g291
Scaffold_13	AUGUSTUS	gene	296669	297034	0.63	+	.	g291
Scaffold_13	AUGUSTUS	transcript	296669	297034	0.63	+	.	g291.t1
Scaffold_13	AUGUSTUS	start_codon	296669	296671	.	+	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_13	AUGUSTUS	CDS	296669	297034	0.63	+	0	transcript_id "g291.t1"; gene_id "g291";
Scaffold_13	AUGUSTUS	stop_codon	297032	297034	.	+	0	transcript_id "g291.t1"; gene_id "g291";
# protein sequence = [MDTPETLSKFIDTAHSAGKKVVYIGFGSIVVSDPIAMTKCVVEAVVQSGVCAILSKGWSDRLQVKSGDAGNVEEPLPN
# QIYPISSIPHDWLFQRIDAACHHGGAGTTGASLRGEILSKQKT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g291
###
# start gene g292
Scaffold_13	AUGUSTUS	gene	299389	299982	0.72	-	.	g292
Scaffold_13	AUGUSTUS	transcript	299389	299982	0.72	-	.	g292.t1
Scaffold_13	AUGUSTUS	stop_codon	299389	299391	.	-	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_13	AUGUSTUS	CDS	299389	299982	0.72	-	0	transcript_id "g292.t1"; gene_id "g292";
Scaffold_13	AUGUSTUS	start_codon	299980	299982	.	-	0	transcript_id "g292.t1"; gene_id "g292";
# protein sequence = [MTGGTVTPALHSEPLEQALRLLSVNGTDPQKNATEPVIQPYLCFGFKIQDEIVYLSDVSHIPEEAWSIIHGAKQRREG
# RPLPLCILDCLGLRSHTSHFGLEQSVAVAREISATRTYLLGFSHIVSHQEYVTITEAVGGAKAADENTLTENEQKGLNLIGSGEPFWIRPAHDGLRVV
# IDNGLVRDDTYSFQPYFCNFT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g292
###
# start gene g293
Scaffold_13	AUGUSTUS	gene	304380	304937	0.55	+	.	g293
Scaffold_13	AUGUSTUS	transcript	304380	304937	0.55	+	.	g293.t1
Scaffold_13	AUGUSTUS	start_codon	304380	304382	.	+	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_13	AUGUSTUS	CDS	304380	304937	0.55	+	0	transcript_id "g293.t1"; gene_id "g293";
Scaffold_13	AUGUSTUS	stop_codon	304935	304937	.	+	0	transcript_id "g293.t1"; gene_id "g293";
# protein sequence = [MLKEESIQRMFEKGSLVTVHASVAAARDAQVNLAGLFEEMNLPTFENELLPLISFPTKLAQACLHLRLAYVQKIKEPD
# MLILDQMIDDLKLGIGLACTLKRQYEAFLAPDPGGKWNLPSCINADYDASILDSMSIFFRLIHWKLKGGAKGVYFKETDVLEAQWATLNDVGLSVSGG
# SSLVAEQIW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g293
###
# start gene g294
Scaffold_13	AUGUSTUS	gene	307269	307688	0.72	+	.	g294
Scaffold_13	AUGUSTUS	transcript	307269	307688	0.72	+	.	g294.t1
Scaffold_13	AUGUSTUS	start_codon	307269	307271	.	+	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_13	AUGUSTUS	CDS	307269	307688	0.72	+	0	transcript_id "g294.t1"; gene_id "g294";
Scaffold_13	AUGUSTUS	stop_codon	307686	307688	.	+	0	transcript_id "g294.t1"; gene_id "g294";
# protein sequence = [MVSRAVLSLSLVLILHRAIMFHIGVATQHPPLPEPDQLSELGIAFIKQCLTIDAMRRPSADELLGHPWMIEFQEALAS
# YEEDEIANDPPREMPPVENFANATVARQAVIIQEKEVENITRASPTSELGSTPEETFLESV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g294
###
# start gene g295
Scaffold_13	AUGUSTUS	gene	334108	334398	0.59	-	.	g295
Scaffold_13	AUGUSTUS	transcript	334108	334398	0.59	-	.	g295.t1
Scaffold_13	AUGUSTUS	stop_codon	334108	334110	.	-	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_13	AUGUSTUS	CDS	334108	334398	0.59	-	0	transcript_id "g295.t1"; gene_id "g295";
Scaffold_13	AUGUSTUS	start_codon	334396	334398	.	-	0	transcript_id "g295.t1"; gene_id "g295";
# protein sequence = [MSVTNWNLEVRVRAKASETWSYTDAEYVEGRTTIPDRLNDESTALSTSRQRPASKNACKRSSFRKFPFGAEIAFVYTV
# SKDQRVRAGYNESYQKSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g295
###
# start gene g296
Scaffold_13	AUGUSTUS	gene	339340	340220	0.28	-	.	g296
Scaffold_13	AUGUSTUS	transcript	339340	340220	0.28	-	.	g296.t1
Scaffold_13	AUGUSTUS	stop_codon	339340	339342	.	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_13	AUGUSTUS	CDS	339340	340131	0.92	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_13	AUGUSTUS	CDS	340200	340220	0.28	-	0	transcript_id "g296.t1"; gene_id "g296";
Scaffold_13	AUGUSTUS	start_codon	340218	340220	.	-	0	transcript_id "g296.t1"; gene_id "g296";
# protein sequence = [MAISDLVASATDHVSLGDALSTFAHDARRTGRGLQTLGSKVGGAVDMCADFSFYWLLVDHPHYYRILAVNEYAMAKLS
# SIPPSSPFISHSLVPFNSASSLEKIFLASFAESMSTLSTIIQRLILLAEVELSNLEKLEDHLSIIYEIVCREDSSISSAKAELLGEIWTRLGGNRREL
# KGHDAHLELLRGIGGYRKQALAHVASALQILRALSDDMEDMRERMMMPDLVGSQIPLEVQINSIQHGLQRLRDSKVLAKEKEEGAMRRVAIVEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g296
###
# start gene g297
Scaffold_13	AUGUSTUS	gene	343130	345486	0.69	+	.	g297
Scaffold_13	AUGUSTUS	transcript	343130	345486	0.69	+	.	g297.t1
Scaffold_13	AUGUSTUS	start_codon	343130	343132	.	+	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_13	AUGUSTUS	CDS	343130	344277	0.78	+	0	transcript_id "g297.t1"; gene_id "g297";
Scaffold_13	AUGUSTUS	CDS	344421	345486	0.77	+	1	transcript_id "g297.t1"; gene_id "g297";
Scaffold_13	AUGUSTUS	stop_codon	345484	345486	.	+	0	transcript_id "g297.t1"; gene_id "g297";
# protein sequence = [MLSEGDQEYMSSASTFQNSTQWRPTSSNSFSRRDPVIVDHSTYSRLDHDAPAIFMSSEGHYLVQANEGVMSLKTENPA
# VIYQNPVEPDRAGNEDGKQEDRLLTNNRSSHLDPETMTTETHFPQEVFTESAISELVVGNGHEEQSPNSDSYEDVYLASAHELEAGKIEETRNLSSLA
# LPNRSRLSGLEHGANLVFTDDGSPAIREVQQEPQQEEDDWEQAQAGDCVSQKLKFPVTKFPEYGQGTEQSGPPASWCADIDRDIPTPRLLNSDVEDIS
# AVINLYDPCQEQEEEDREEDQEEGGDEINNHLYPESGFVGFPDSQTQPQYTDIEQDIASPSLSNSDQHDIADGYYEDLDQEQEQDREEWGQSNLPPSR
# DFIGFSEPNPPTASVKMVDIEAPPWWYTEETGETDNLVEDANGYYTNEYQGDDEVDHISVHNAVLHPPRLNISPPLNVPSPSLNVSPPPSSNVPPQAE
# NVQKVLLNTDLHNGCPTVSVYSPDADYEGDEEAGGNEGSYDEKDSMSMEYWDTNDESSGAIWNSSPSTITEVFAPYPELPDHTHVSYSNDVGHEWGDS
# QAEASNDQHITTVYNAGPQPVETSTAQSFSVSQSHSAQNFMSWSAPQDFVHSDPEHPGVFHDNIAVSEYDSIPGTSGRWFVGENDILGGVCEPGDEPS
# FMPSPSLPSPVAENHLIWNSPVPRPRYTGVSYNLDAEERCDDNPVWLDVNIGESDDHVEIVNNQYVVLNVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g297
###
# start gene g298
Scaffold_13	AUGUSTUS	gene	345659	347260	0.52	+	.	g298
Scaffold_13	AUGUSTUS	transcript	345659	347260	0.52	+	.	g298.t1
Scaffold_13	AUGUSTUS	start_codon	345659	345661	.	+	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_13	AUGUSTUS	CDS	345659	346456	0.52	+	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_13	AUGUSTUS	CDS	346511	347260	0.94	+	0	transcript_id "g298.t1"; gene_id "g298";
Scaffold_13	AUGUSTUS	stop_codon	347258	347260	.	+	0	transcript_id "g298.t1"; gene_id "g298";
# protein sequence = [MSVDPGGTSYVAPLNVPLLSTAEIPVAYENLLHHAHDYALHSNDADFSLGWAENNCQSSDDGTRFFDPNAMLSADSRP
# SSNSGSDDPLPRPDVNPTNTRPSVTIEEIQEPEIYPNPLPYMGPDGPILRPTTAMGQHPNVEHAQDGCYQQNPNRYFDSDDHADLFHDTNNGSGDGNN
# HNNYESFNGDDDVQMDQGASGDGIEIDAENDTRPQQFDTANASYIRGLSPLTEIPDTPMPKTYSNEDEVLASLMGELSSLVQNGVKSLSMQSHFKSQM
# NDPNINIDTLEAILNRCYRYVGALSDNAAPSFARPEHDSNDQHLSADSEFSPKLYNPPTHRTEGKNYLAELVRNETGVLLGILGVDETRAEPLTPTGK
# FLATVSPGTIKDFANSRHDGPTVQNFVLQLHHGRRTAWNKAAAEVFCKHFRSQEGFGNYKKKDVYEAFIAHITQLKREFALQGRQKSTREKDDERRAR
# RLARRHKVGLIFCLLSFSNPLQISALASAHQGVPPNLPLPSRPFG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g298
###
# start gene g299
Scaffold_13	AUGUSTUS	gene	348294	349202	0.52	+	.	g299
Scaffold_13	AUGUSTUS	transcript	348294	349202	0.52	+	.	g299.t1
Scaffold_13	AUGUSTUS	start_codon	348294	348296	.	+	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_13	AUGUSTUS	CDS	348294	349202	0.52	+	0	transcript_id "g299.t1"; gene_id "g299";
Scaffold_13	AUGUSTUS	stop_codon	349200	349202	.	+	0	transcript_id "g299.t1"; gene_id "g299";
# protein sequence = [MSCTTMGVICSCALPDLFAPLRAINCNADYYVSLCGRTEAAPTETVSTYNDALFGPATSAQFPYPPRPATTTTTTTQS
# EQETSVLQVPVLLDSPSRNFLPLDFGLANNGAKVLPALTSPTEGSSPLSYVAGLISVLRGYDKTQMHMNPPRVVLEEEVLLSNCWKFAGSQGHIAIAL
# SDSIIWNRFTIHSPDGDPGVKLRQAPRVIVMQALVSQENILVDARRLSAWEDFVVVEQLLDPSIFNSSTAFMEVARIVYMPSEGGQQMFSTFSPVQTS
# IVLVQILDNWGDTSTCLHRISFHGDTLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g299
###
# start gene g300
Scaffold_13	AUGUSTUS	gene	351279	352103	0.82	+	.	g300
Scaffold_13	AUGUSTUS	transcript	351279	352103	0.82	+	.	g300.t1
Scaffold_13	AUGUSTUS	start_codon	351279	351281	.	+	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_13	AUGUSTUS	CDS	351279	352103	0.82	+	0	transcript_id "g300.t1"; gene_id "g300";
Scaffold_13	AUGUSTUS	stop_codon	352101	352103	.	+	0	transcript_id "g300.t1"; gene_id "g300";
# protein sequence = [MVHVNKTIRQEGIKAQKKLLPAPDPGLFFGLEDKTRQSPYFYTWEHIRPAWLAMLQAGKFPSNCGCMAQGACIYLYQA
# FGRRGSHHAKKTQVALDAKNLVEQSIKSYDTRMSYRPRTVEGDFDITRSRQLIRELCMVNFRSELLYVDDLLDQSRPQPSPSLSVAELEAATANHKRS
# RRTLISHTLLFDSLTPHASVDLGLAAVSWSERYAALKHFWTLMDTWPREKPVIWRRGIEMDLTKLASIGVEWERILAQFYVQSAFDILGRPPSLPRRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g300
###
# start gene g301
Scaffold_13	AUGUSTUS	gene	354388	354888	0.37	-	.	g301
Scaffold_13	AUGUSTUS	transcript	354388	354888	0.37	-	.	g301.t1
Scaffold_13	AUGUSTUS	stop_codon	354388	354390	.	-	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_13	AUGUSTUS	CDS	354388	354888	0.37	-	0	transcript_id "g301.t1"; gene_id "g301";
Scaffold_13	AUGUSTUS	start_codon	354886	354888	.	-	0	transcript_id "g301.t1"; gene_id "g301";
# protein sequence = [MYLSRDSQCRYLTQLQRVVRQWQALGLQDMTRPAQDIPSPDHPSIPPTASLSMNQTSVDQELEAGQTPRQRDSSRAPQ
# DDSLPSHRSSSVTASSNNKSSANQEFNAAHQAFLDGQPKTHFKKLSTETIQKLANLYGVHAFTPAGAPSRAKQTLIDALFKWVRSYIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g301
###
# start gene g302
Scaffold_13	AUGUSTUS	gene	357911	358795	0.59	-	.	g302
Scaffold_13	AUGUSTUS	transcript	357911	358795	0.59	-	.	g302.t1
Scaffold_13	AUGUSTUS	stop_codon	357911	357913	.	-	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_13	AUGUSTUS	CDS	357911	358659	1	-	2	transcript_id "g302.t1"; gene_id "g302";
Scaffold_13	AUGUSTUS	CDS	358750	358795	0.59	-	0	transcript_id "g302.t1"; gene_id "g302";
Scaffold_13	AUGUSTUS	start_codon	358793	358795	.	-	0	transcript_id "g302.t1"; gene_id "g302";
# protein sequence = [MPSTLSILGYHSQVNEFQRSGVTAATPAITISPPIINGTQQPPSGSGSTNPTAGNVATSSHPLTVAGPSDGGLTGDGR
# FDKAPSTGFNYSSGQRPTESNKTVNLPVQAPRPEHYGSAMGSNNGDHAAKKMKTEDGNARRQYLPTGTGMSGQMGGSYTGSERNDTPGVINPKKRKAA
# ADSNTGASPLALPPHFNMTASSSSADRAQSSSPRPPPAAYPRQNFSNTSGTNNSHLNTTPQAGPSNYQNTSYSSRNPFAPSPTAGNDM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g302
###
# start gene g303
Scaffold_13	AUGUSTUS	gene	365629	366177	0.18	+	.	g303
Scaffold_13	AUGUSTUS	transcript	365629	366177	0.18	+	.	g303.t1
Scaffold_13	AUGUSTUS	start_codon	365629	365631	.	+	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_13	AUGUSTUS	CDS	365629	366177	0.18	+	0	transcript_id "g303.t1"; gene_id "g303";
Scaffold_13	AUGUSTUS	stop_codon	366175	366177	.	+	0	transcript_id "g303.t1"; gene_id "g303";
# protein sequence = [MKISKIGLILLLGLLIPLGRLGSYGKKRKDGNERRKSSTTTTTTRKTTTTENWDDELQLGDSPARSMRNRHPQHPVHQ
# HSFNEEEDSDDDDEADFNFHGSDKDEDDKTVTARSRRAALSRLVSNSSSSSPPPVPPLPFSLLPIPPQHSASSDHDHEHVFPDSPTTSVFSVPTSHSG
# GTDRRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g303
###
# start gene g304
Scaffold_13	AUGUSTUS	gene	366416	368882	0.97	+	.	g304
Scaffold_13	AUGUSTUS	transcript	366416	368882	0.97	+	.	g304.t1
Scaffold_13	AUGUSTUS	start_codon	366416	366418	.	+	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_13	AUGUSTUS	CDS	366416	367538	0.97	+	0	transcript_id "g304.t1"; gene_id "g304";
Scaffold_13	AUGUSTUS	CDS	367681	368882	1	+	2	transcript_id "g304.t1"; gene_id "g304";
Scaffold_13	AUGUSTUS	stop_codon	368880	368882	.	+	0	transcript_id "g304.t1"; gene_id "g304";
# protein sequence = [MRVAVPLEADRPPASGIDEVGTLGVNIEIPPSKEDAMDIEVNVDDTTARNFKSKLTKVAAFKDETLEPEEGTSFADVS
# KVMLDPDPDPSDKSDAEPEPDVEVDVEPDVDAPFDVSDGEDEKEDDDDEGEGEDEKDDADELEVDEVQEDDDKDDEDKDDEEKEVSDKEDVEKDIDDD
# DRSEINLEDEEEEFDLQPVHRVEALDMLAIVELKFALLREKLYIEKMEELAWEESLVASGMQLLSVSILRSHIPHTLGEHPELIFIQSELLSRKNKRL
# ELSERKCTFEIANITKRRKIDEDATWSSRKVYMPLLHFSLLLIPLQHQRDELQTDMLAENHRKRRKLERERRAVDRPQTGECHCLHLLIFSLNIDNCN
# AAPSRRSNKTTFMESCMESTHTLPPGLTVAYPELSTLSSSESQGDLENLLSMTGARRSRPGSTQTNTMGMGMNLSVGNNGLNMDMNINLPIYEQGVHG
# PPVGLGHVYTPGAGTHNGSNPIRERLGRGSSSLNHGPGLARRMVSGPGTLSGSLSSQSTVGMGHVHEPSFVVGGLPPPPMGSGGGSESLLPSFGPSKS
# MGGVGPRSGSTAGLRSGSAGGGVDREREIRSVPSGSGGSGGRSSFHNGQSQHLFSDPSTTTNGAFPESEHQRDGDVVVPSSASSSVHGIHGRQVPSST
# HFGRPGPGIGGGGPPPALSPWKRSISPIGPSVGIGLNSIKGNGQGMGPGMGMGGFGTGHRWEAEEHERELERTEHTDAGDIRGQDTDRERDRDRDRER
# DQHIVHQHRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g304
###
# start gene g305
Scaffold_13	AUGUSTUS	gene	369298	369702	0.47	+	.	g305
Scaffold_13	AUGUSTUS	transcript	369298	369702	0.47	+	.	g305.t1
Scaffold_13	AUGUSTUS	start_codon	369298	369300	.	+	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_13	AUGUSTUS	CDS	369298	369702	0.47	+	0	transcript_id "g305.t1"; gene_id "g305";
Scaffold_13	AUGUSTUS	stop_codon	369700	369702	.	+	0	transcript_id "g305.t1"; gene_id "g305";
# protein sequence = [MNGGRPSSGSGQRLLDERESERDRDRDRNQASTMPSVSGLNFQAHNGIAISLSASSSRPPSWNEIDCGLVHQSLIPIL
# SASWMGVVDVDSATGAARGSLQNINLGQKPQTEADFDQLLSVHWSLATVLKFVKLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g305
###
# start gene g306
Scaffold_13	AUGUSTUS	gene	376093	377016	0.57	-	.	g306
Scaffold_13	AUGUSTUS	transcript	376093	377016	0.57	-	.	g306.t1
Scaffold_13	AUGUSTUS	stop_codon	376093	376095	.	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_13	AUGUSTUS	CDS	376093	376551	0.77	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_13	AUGUSTUS	CDS	376609	377016	0.57	-	0	transcript_id "g306.t1"; gene_id "g306";
Scaffold_13	AUGUSTUS	start_codon	377014	377016	.	-	0	transcript_id "g306.t1"; gene_id "g306";
# protein sequence = [MSTAHTPLLLPEALGFSPQLLLDDIINAVNNTIVEGVNAMEDFLRQWADRRSEEEKDWDSTEELEQGLVSFETLLEHH
# TDVALDFFEAWALKNIFSIPPDLPVVLPHQKGLDLTTKPEREAELMEEISELRIKVDNQRRLQRIYNRALRTSRQQRSRSERRLERLAAVLDHEKLIS
# LAKIPPQLNAMYEAVSRLPPLDPALVATLPPIEPGKRDWETSKAGYLNWATAQLLSRAKVDEDVHGSSAVDDMFRNMAQIGQADQIRKAVEITESVRT
# GLQDVDVTMESEES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g306
###
# start gene g307
Scaffold_13	AUGUSTUS	gene	378372	378920	1	-	.	g307
Scaffold_13	AUGUSTUS	transcript	378372	378920	1	-	.	g307.t1
Scaffold_13	AUGUSTUS	stop_codon	378372	378374	.	-	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_13	AUGUSTUS	CDS	378372	378920	1	-	0	transcript_id "g307.t1"; gene_id "g307";
Scaffold_13	AUGUSTUS	start_codon	378918	378920	.	-	0	transcript_id "g307.t1"; gene_id "g307";
# protein sequence = [MELVGLSILYLTKLLLISRTGIQVGTSDPVFMQSQGTTLKGDQQSPYGGHEYSKIPYPFDPVACDSAREAGDEFHTSL
# KTLGRNWSRQIHSGLFRTWDEIAFVRKHWEGPLVLKGILHVDDAVKAMEAGCDGVVVSNHGGRQVDGAIPALIALEKVCESIKSLIDVDPVFRFVEIR
# GFEKPN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g307
###
# start gene g308
Scaffold_13	AUGUSTUS	gene	380216	381311	0.28	+	.	g308
Scaffold_13	AUGUSTUS	transcript	380216	381311	0.28	+	.	g308.t1
Scaffold_13	AUGUSTUS	start_codon	380216	380218	.	+	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_13	AUGUSTUS	CDS	380216	380648	0.28	+	0	transcript_id "g308.t1"; gene_id "g308";
Scaffold_13	AUGUSTUS	CDS	380950	381311	0.73	+	2	transcript_id "g308.t1"; gene_id "g308";
Scaffold_13	AUGUSTUS	stop_codon	381309	381311	.	+	0	transcript_id "g308.t1"; gene_id "g308";
# protein sequence = [MDQHGIDISVVSFANPWLDFLSPLDAKSLAQDLNTDLEEYCATSPALSFSSLKRIYGLGLLPLVPGISISSVLEAVSQ
# IAKAPHLKGLIMGTKGLGKGLDDDALDPVWQAIEDNGLVVFLHPHYGVDSSAWGEKENGHVLPLALGKLWFDAVAYGPEELAFVSEIISRAGRYESGT
# SNTKAIADRKEGSKRMLFGTGMPAVTGLFNRRLTLRSEDHPFFPPLSSSEKWKSVVENLEAIESVSGWGEVEKEGVSAGNALGFFSIQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g308
###
# start gene g309
Scaffold_13	AUGUSTUS	gene	386005	389329	0.75	-	.	g309
Scaffold_13	AUGUSTUS	transcript	386005	389329	0.75	-	.	g309.t1
Scaffold_13	AUGUSTUS	stop_codon	386005	386007	.	-	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_13	AUGUSTUS	CDS	386005	388547	0.98	-	2	transcript_id "g309.t1"; gene_id "g309";
Scaffold_13	AUGUSTUS	CDS	388639	389329	0.75	-	0	transcript_id "g309.t1"; gene_id "g309";
Scaffold_13	AUGUSTUS	start_codon	389327	389329	.	-	0	transcript_id "g309.t1"; gene_id "g309";
# protein sequence = [MPVPAAPRRAVPPRRKAKSPAPPPRAEEQELSVDPSIEHTKNELDVQILPSADTEELDTAKKILDHTAPLVDDVPPEP
# LVSEEPAMVVPVEETPIPTAKTEVGESDVVQAIQSASESLVEEPEPTHAEIEEEDEASRRKRVAERLAKSGGVNPFALPPERKPSLPVTHEESSPPTS
# TPVYPVSQKRTSIRKASADSVHNPVPAPPARRSSQISLSSVGSPNKKPSIDSVMNDINFPVPTGISEEPESIRLVEEADITDEELADEEFSPEGSEEH
# VEVHEAVDPLEPPQPPVVVPDSPYTKASFSDIEPVHVPPKAASPVNELKLSSSPKNELDHEEPAPPPPPRRSMPPPPRVLSDPIQHEQEERQFPSQSE
# VPSEPPRRLPPRPVLEDDGEMSDAPLPHPNRLSVPPPPPPQPLVEEGQISDDEPKPIPFSRPVRFVPLPVHSGVEEDIESEEKEEATELERSPEEILP
# TPPRRPPSPPEQISVQEKPLFVPPPPPPKILPTAPRRGSTEVKKAELSPTLERRSAVSNVQLGRAEILDEEEGDPIDPSFYSPPGRQTSIAAVAPDTL
# ELEQAPAEDEEQARRRTIAERMAKLGGLKFGAAPIPMNRPAPNKRRASEESTQKEADAEETDEGKIELNEEEEERARKERIATKLASMGGMRIGMQPY
# GMFSGQAPSTQPKPVTSSPERETLHAHPAPRHAAPPPPPPHEIDSEHESVATSDEGVKIEAEESEMEEVNYEDANEEQDEIPPPLPTREGRHTSARHV
# PPGRPPVPTVLPSRKASIQSTTSQRSDDTAFVPTPGKSSSSHQLPPSTSDYVMVEGEEEEELPPPPPPRAGRPVPPRAAPLPPASDIPPSESISSQWE
# MPSIPSLDFGGNTDLSLSWTDDMALSTSSAQPSPDIPAIHSTQVTTTAAADLVLNSDDLVAVWGRVGVQVCEVATTLFEKSKKVLIGDGTYQGFIDAT
# LREVPNAAPMTGQEYGYLVYMQSGASVQKRASEILPGDIAWMHEAKFKGHKGLQTYSQSVGSEVPLVGVVGEFEAKKFKIRVFQANQHVGQQTVETVS
# YRLEDLKSGQVKIFRVLEA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g309
###
# start gene g310
Scaffold_13	AUGUSTUS	gene	389478	390389	0.76	-	.	g310
Scaffold_13	AUGUSTUS	transcript	389478	390389	0.76	-	.	g310.t1
Scaffold_13	AUGUSTUS	stop_codon	389478	389480	.	-	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_13	AUGUSTUS	CDS	389478	390389	0.76	-	0	transcript_id "g310.t1"; gene_id "g310";
Scaffold_13	AUGUSTUS	start_codon	390387	390389	.	-	0	transcript_id "g310.t1"; gene_id "g310";
# protein sequence = [MSDQPPQPKPKPGSLRDRIAAFEKSTPSNAPPPVAPRPKPGGHVSWKPKQPTPPDSPAAPADESSVNRPQKPGGGMSA
# SDAKESIGKGGSLKERMAALQGKGAFGAPSPPVAPKPAVEKPKWKPPPPVASPPEEEEEIETASDKAKDASPPSVPAKSPVSESNKALGEPDSLEVEG
# QSHIETEGGGEEEVDPEEEERQRRATLAARMARLGGARVGMGPPVFGGPAYKKPQPKPEPKSEVPSKEDVSEPVKSEVVETGSKGTLLLQDCSTCLYS
# SIVSHPNICRAISQITFCSRSRRELRRRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g310
###
# start gene g311
Scaffold_13	AUGUSTUS	gene	391284	392201	0.86	-	.	g311
Scaffold_13	AUGUSTUS	transcript	391284	392201	0.86	-	.	g311.t1
Scaffold_13	AUGUSTUS	stop_codon	391284	391286	.	-	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_13	AUGUSTUS	CDS	391284	392201	0.86	-	0	transcript_id "g311.t1"; gene_id "g311";
Scaffold_13	AUGUSTUS	start_codon	392199	392201	.	-	0	transcript_id "g311.t1"; gene_id "g311";
# protein sequence = [MSTQDLNFILGYSLNNLVQRRRTTAAPESTDEYSINLNNAIEMRQRLGQIGIFTFIDMDFEATWMNAALSERRKHVLV
# GLSEGCSIARNLNDARRFTADVLQLDYLSRDGKTYLDLFKTIMPGSDPDTTPDIYYIPNPGWDSFQERMKEKYATSKVHLVSLGEMQVLRTELICESL
# SMYVFSLRLSDFLSADYVVGYTMMSFIGHKIDRVAGIKPRGASSDHKTAQAKKMYKEGDRIQKMMFGLEEAKRRKDEEKQVAKALIARRVVMCFQCQK
# HQPEGERFSRCSRCWNNLKRDVVYCSRYKSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g311
###
# start gene g312
Scaffold_13	AUGUSTUS	gene	395593	396864	0.34	+	.	g312
Scaffold_13	AUGUSTUS	transcript	395593	396864	0.34	+	.	g312.t1
Scaffold_13	AUGUSTUS	start_codon	395593	395595	.	+	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_13	AUGUSTUS	CDS	395593	395742	0.34	+	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_13	AUGUSTUS	CDS	396538	396864	0.77	+	0	transcript_id "g312.t1"; gene_id "g312";
Scaffold_13	AUGUSTUS	stop_codon	396862	396864	.	+	0	transcript_id "g312.t1"; gene_id "g312";
# protein sequence = [MSVAASELELLSEELSTELNEVTDPHLAQSLDILASISPPTSSRPVIAAWVCADLKARLLIDDSSENALQVSTSSSAA
# TPPTPVLLFGHYEWNKRLSLHSDAVDAMAFDTRLQIEGGREFWKYERFEDHIPEGAPLHRVRDWEEVVQFVKSARAANEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g312
###
# start gene g313
Scaffold_13	AUGUSTUS	gene	401827	403316	0.42	+	.	g313
Scaffold_13	AUGUSTUS	transcript	401827	403316	0.42	+	.	g313.t1
Scaffold_13	AUGUSTUS	start_codon	401827	401829	.	+	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_13	AUGUSTUS	CDS	401827	402060	0.46	+	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_13	AUGUSTUS	CDS	402204	403316	0.67	+	0	transcript_id "g313.t1"; gene_id "g313";
Scaffold_13	AUGUSTUS	stop_codon	403314	403316	.	+	0	transcript_id "g313.t1"; gene_id "g313";
# protein sequence = [MSKLPSESAIVKAIRKHAEDNIEVRMVLSGPTWSNWGLSSAGTDEGMYEIRPKAKVSQGLEGAEGYMRDYWANRTTYI
# RISFPPHYLDADADTSSFHQIPKSRTKCKGFAFVVFSSVDEVDQFSATWKWERARSGPVPVPIKADTSPSLLSRVFSASSHVEARKHGFRALPKAQWD
# ALKDEYVVWRQKLLEQVLAEQDDDVDEKMKYKVGSQWEEEEEYNEFGNGEISHSIQSNVPQTSLSSSANLPSYLTSSSPFPPNCLVFIRNIHAGTNKT
# TLRTLLSKALINGVEKGIENTQPQDISQCIDYVDYTKGMDTCYIRFSSPSQASALQSYLTRHCIVQNTALDDTGIEVGRAQTDKPKYIEVEGVQGKKE
# EVYWEKVPIKVRQEAVRKAISNANATSSSAVVSSSSALQTPKTTLPTERPTSVSSVSLLVPRLLHTHTHLHTLVTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g313
###
# start gene g314
Scaffold_13	AUGUSTUS	gene	405445	406293	0.5	+	.	g314
Scaffold_13	AUGUSTUS	transcript	405445	406293	0.5	+	.	g314.t1
Scaffold_13	AUGUSTUS	start_codon	405445	405447	.	+	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_13	AUGUSTUS	CDS	405445	406293	0.5	+	0	transcript_id "g314.t1"; gene_id "g314";
Scaffold_13	AUGUSTUS	stop_codon	406291	406293	.	+	0	transcript_id "g314.t1"; gene_id "g314";
# protein sequence = [MKDAVDGSYYPKSYSEYERDLAVLLYEIGGGATLYALNHSPLSLPSRFTISRQRQSFSLQESTAGLRITEILQNIKTV
# FEGYAPGVGRRGINLSQDVTASENRLCWCPSTDKVFGLCEHAKRLGDLRLGKDMKSVEKIVRAVRVEKDIHIAQEISVAAFSLYDENFYGARPVLIMP
# TCKKGDWKLAAMQNAVLLAAWKFSPFGAAAHGDIWSLSSDGDPKQRPALYLVTMVRQVQPSDILFNWLGNLPGLNLLCGPNFETPSFDPKHDIKRTLT
# IPSSIQIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g314
###
# start gene g315
Scaffold_13	AUGUSTUS	gene	406983	407867	0.22	+	.	g315
Scaffold_13	AUGUSTUS	transcript	406983	407867	0.22	+	.	g315.t1
Scaffold_13	AUGUSTUS	start_codon	406983	406985	.	+	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_13	AUGUSTUS	CDS	406983	407867	0.22	+	0	transcript_id "g315.t1"; gene_id "g315";
Scaffold_13	AUGUSTUS	stop_codon	407865	407867	.	+	0	transcript_id "g315.t1"; gene_id "g315";
# protein sequence = [MGSSDHHTPRYFTGDLTAGSCDLDKVFAEAETEVLEDLACAGYELVPGKTFSFRELFAQEDCDLQRPVGGRYPGLSTA
# VDRSISEASELVSATSDNAESLGSASGNSEELQSILKILKVDAAAMLEEERKEDELAASSAQESHSNSAQRPSPFFYPDPDKPKLRISKRTALREQMN
# PGFDLNNGKSHDRLLRVRYFAEGKDWDTKAVATDIDNDNSFKVGLIFTTLIYIPDKKLVSLAILHCPSICSKGLVRMHLLTKSLSPNQDTISEVRCWT
# FSHSSMEKSYIGTGRRCRLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g315
###
# start gene g316
Scaffold_13	AUGUSTUS	gene	410687	411925	0.5	+	.	g316
Scaffold_13	AUGUSTUS	transcript	410687	411925	0.5	+	.	g316.t1
Scaffold_13	AUGUSTUS	start_codon	410687	410689	.	+	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_13	AUGUSTUS	CDS	410687	411925	0.5	+	0	transcript_id "g316.t1"; gene_id "g316";
Scaffold_13	AUGUSTUS	stop_codon	411923	411925	.	+	0	transcript_id "g316.t1"; gene_id "g316";
# protein sequence = [MTQHPPLLLRTSSSVRADDCQRRTHILGIIPILKKLSLERRLERNYDIERANEARQEKTMLFIEKKAPAKGSPSASLI
# TITEEEWNDIRTTPAIFERVKQWIPSYILAWMTKANEVENLSKGKRTREVQEGDVLENGPDKNPRLMTPIIETTPDPTITQNVELPECLYCIGRLHNY
# LPLPLFTDNNLIFIHSNSLSLKTSKTLLPGDKERTEVVVLKDLLDRLNIRVPDSEKADEDEGLSLYEFQLASKNYFAFELSCDPDGHGGTRANWTRQH
# FLFFNNQRDAEKYYRFWKPREYRLWEEHRLYNTKFDLTTYNMAWNRVVTDYEQSLEAKPRQAPSSSTVPSSSKPFPKGNKGDSFDLCCLGCGKKGHSA
# TDHSSKHGSLLWARWIKGGKSFILGLPQGEDKRICYQWNI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g316
###
# start gene g317
Scaffold_13	AUGUSTUS	gene	413967	414191	0.42	-	.	g317
Scaffold_13	AUGUSTUS	transcript	413967	414191	0.42	-	.	g317.t1
Scaffold_13	AUGUSTUS	stop_codon	413967	413969	.	-	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_13	AUGUSTUS	CDS	413967	414191	0.42	-	0	transcript_id "g317.t1"; gene_id "g317";
Scaffold_13	AUGUSTUS	start_codon	414189	414191	.	-	0	transcript_id "g317.t1"; gene_id "g317";
# protein sequence = [MKAMKLYKLQLHQQPSQPQNPVAGASSHSDDPDLEVEDEFQELTSSLTAMANDDEISDNLEFPSELFNSPRISI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g317
###
# start gene g318
Scaffold_13	AUGUSTUS	gene	420512	421147	0.44	+	.	g318
Scaffold_13	AUGUSTUS	transcript	420512	421147	0.44	+	.	g318.t1
Scaffold_13	AUGUSTUS	start_codon	420512	420514	.	+	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_13	AUGUSTUS	CDS	420512	421147	0.44	+	0	transcript_id "g318.t1"; gene_id "g318";
Scaffold_13	AUGUSTUS	stop_codon	421145	421147	.	+	0	transcript_id "g318.t1"; gene_id "g318";
# protein sequence = [MEELHLTRLKRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEK
# MRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPP
# INNPNSFSRGHINLPFAADVPKLSSGIETQSRRRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g318
###
# start gene g319
Scaffold_13	AUGUSTUS	gene	421585	421791	0.41	+	.	g319
Scaffold_13	AUGUSTUS	transcript	421585	421791	0.41	+	.	g319.t1
Scaffold_13	AUGUSTUS	start_codon	421585	421587	.	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_13	AUGUSTUS	CDS	421585	421791	0.41	+	0	transcript_id "g319.t1"; gene_id "g319";
Scaffold_13	AUGUSTUS	stop_codon	421789	421791	.	+	0	transcript_id "g319.t1"; gene_id "g319";
# protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIENYQIDLGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g319
###
# start gene g320
Scaffold_13	AUGUSTUS	gene	421862	423616	0.88	+	.	g320
Scaffold_13	AUGUSTUS	transcript	421862	423616	0.88	+	.	g320.t1
Scaffold_13	AUGUSTUS	start_codon	421862	421864	.	+	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_13	AUGUSTUS	CDS	421862	423616	0.88	+	0	transcript_id "g320.t1"; gene_id "g320";
Scaffold_13	AUGUSTUS	stop_codon	423614	423616	.	+	0	transcript_id "g320.t1"; gene_id "g320";
# protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK
# KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD
# LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESF
# LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTL
# GLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKS
# TGENDFKGKFSFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRD
# GVLGEFDDQLNNDNSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g320
###
# start gene g321
Scaffold_13	AUGUSTUS	gene	423644	424008	0.35	+	.	g321
Scaffold_13	AUGUSTUS	transcript	423644	424008	0.35	+	.	g321.t1
Scaffold_13	AUGUSTUS	start_codon	423644	423646	.	+	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_13	AUGUSTUS	CDS	423644	423666	0.63	+	0	transcript_id "g321.t1"; gene_id "g321";
Scaffold_13	AUGUSTUS	CDS	423723	424008	0.35	+	1	transcript_id "g321.t1"; gene_id "g321";
Scaffold_13	AUGUSTUS	stop_codon	424006	424008	.	+	0	transcript_id "g321.t1"; gene_id "g321";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQAEY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g321
###
# start gene g322
Scaffold_13	AUGUSTUS	gene	424393	424914	0.4	+	.	g322
Scaffold_13	AUGUSTUS	transcript	424393	424914	0.4	+	.	g322.t1
Scaffold_13	AUGUSTUS	start_codon	424393	424395	.	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_13	AUGUSTUS	CDS	424393	424914	0.4	+	0	transcript_id "g322.t1"; gene_id "g322";
Scaffold_13	AUGUSTUS	stop_codon	424912	424914	.	+	0	transcript_id "g322.t1"; gene_id "g322";
# protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC
# VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPYFTMM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g322
###
# start gene g323
Scaffold_13	AUGUSTUS	gene	425228	426301	0.8	+	.	g323
Scaffold_13	AUGUSTUS	transcript	425228	426301	0.8	+	.	g323.t1
Scaffold_13	AUGUSTUS	start_codon	425228	425230	.	+	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_13	AUGUSTUS	CDS	425228	426301	0.8	+	0	transcript_id "g323.t1"; gene_id "g323";
Scaffold_13	AUGUSTUS	stop_codon	426299	426301	.	+	0	transcript_id "g323.t1"; gene_id "g323";
# protein sequence = [MAPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA
# VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVR
# NYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEE
# RSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQKMNGLNLLD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g323
###
# start gene g324
Scaffold_13	AUGUSTUS	gene	426546	427658	0.43	+	.	g324
Scaffold_13	AUGUSTUS	transcript	426546	427658	0.43	+	.	g324.t1
Scaffold_13	AUGUSTUS	start_codon	426546	426548	.	+	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_13	AUGUSTUS	CDS	426546	427658	0.43	+	0	transcript_id "g324.t1"; gene_id "g324";
Scaffold_13	AUGUSTUS	stop_codon	427656	427658	.	+	0	transcript_id "g324.t1"; gene_id "g324";
# protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE
# VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI
# VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIR
# RTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g324
###
# start gene g325
Scaffold_13	AUGUSTUS	gene	430398	431055	0.3	-	.	g325
Scaffold_13	AUGUSTUS	transcript	430398	431055	0.3	-	.	g325.t1
Scaffold_13	AUGUSTUS	stop_codon	430398	430400	.	-	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_13	AUGUSTUS	CDS	430398	430945	0.63	-	2	transcript_id "g325.t1"; gene_id "g325";
Scaffold_13	AUGUSTUS	CDS	431007	431055	0.3	-	0	transcript_id "g325.t1"; gene_id "g325";
Scaffold_13	AUGUSTUS	start_codon	431053	431055	.	-	0	transcript_id "g325.t1"; gene_id "g325";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDKHGHLVEASPPPDSATEALEGLKEVERGSADEGASSPVGGSVPMELDLP
# TIESLAERTLSPEKGAESAQIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g325
###
# start gene g326
Scaffold_13	AUGUSTUS	gene	431673	432363	0.49	-	.	g326
Scaffold_13	AUGUSTUS	transcript	431673	432363	0.49	-	.	g326.t1
Scaffold_13	AUGUSTUS	stop_codon	431673	431675	.	-	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_13	AUGUSTUS	CDS	431673	432103	0.92	-	2	transcript_id "g326.t1"; gene_id "g326";
Scaffold_13	AUGUSTUS	CDS	432162	432363	0.52	-	0	transcript_id "g326.t1"; gene_id "g326";
Scaffold_13	AUGUSTUS	start_codon	432361	432363	.	-	0	transcript_id "g326.t1"; gene_id "g326";
# protein sequence = [MVSSTDLDPFVSLRGRNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHSKD
# SDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSRQVVVSEDDSASNEVESEDEEE
# DEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g326
###
# start gene g327
Scaffold_13	AUGUSTUS	gene	439012	439350	0.61	-	.	g327
Scaffold_13	AUGUSTUS	transcript	439012	439350	0.61	-	.	g327.t1
Scaffold_13	AUGUSTUS	stop_codon	439012	439014	.	-	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_13	AUGUSTUS	CDS	439012	439350	0.61	-	0	transcript_id "g327.t1"; gene_id "g327";
Scaffold_13	AUGUSTUS	start_codon	439348	439350	.	-	0	transcript_id "g327.t1"; gene_id "g327";
# protein sequence = [MNDKVCSYATSSDLDSTGNSVKQERLGRWNLHKVQISELLDQIEASLLVIFGPLPELYNRNTVDSASSNNLECTIDHR
# THFRELWKKQINILMKLGLAKTYPDMGASNRSIN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g327
###
# start gene g328
Scaffold_13	AUGUSTUS	gene	439891	440704	0.24	+	.	g328
Scaffold_13	AUGUSTUS	transcript	439891	440704	0.24	+	.	g328.t1
Scaffold_13	AUGUSTUS	start_codon	439891	439893	.	+	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_13	AUGUSTUS	CDS	439891	440037	0.38	+	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_13	AUGUSTUS	CDS	440087	440704	0.36	+	0	transcript_id "g328.t1"; gene_id "g328";
Scaffold_13	AUGUSTUS	stop_codon	440702	440704	.	+	0	transcript_id "g328.t1"; gene_id "g328";
# protein sequence = [MIMASFHLFFTSDASNSSLVQGGFKLNVSVHKQISDMLEEAGTTGMTLTELSTSLCQFDRRTIELILTRAERFQPPPH
# LGDLGVAALLETSGRERRHRYFTIQPIVLSSKEKIDKSTAGYSDVDLSNVGGFLSVDPGGFYRNDEELHQYQDSFKDDDSIKLAKVSKKSAESSVAGR
# KGLKQKLPVNAGAEDNGIDPQSSAKPSRRGKRKAAGTASANQEDSIEPRPQKKRKIENAENVEAEAQIGAIGTATFFK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g328
###
# start gene g329
Scaffold_13	AUGUSTUS	gene	441183	443147	0.21	+	.	g329
Scaffold_13	AUGUSTUS	transcript	441183	443147	0.21	+	.	g329.t1
Scaffold_13	AUGUSTUS	start_codon	441183	441185	.	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_13	AUGUSTUS	CDS	441183	441387	0.21	+	0	transcript_id "g329.t1"; gene_id "g329";
Scaffold_13	AUGUSTUS	CDS	441484	443147	1	+	2	transcript_id "g329.t1"; gene_id "g329";
Scaffold_13	AUGUSTUS	stop_codon	443145	443147	.	+	0	transcript_id "g329.t1"; gene_id "g329";
# protein sequence = [MSTQPAYVDGDVDGDVDMVVQPVNIQTDQRLFDDGNLTQADSSNTRDGLSITQASQEPLGLHENSESVWQLRPKVNVS
# NLRRENELLRVVELLGGIVNIQTRELYETHLTLLDTLAKAGEPASSPPGIRTDKRTVTATFNALESRGKVKQLTTLVPLYLGTSRQTVVVYLPHVSDT
# QLGTFLSELAQGVGPPPVPQPSGRIIDEAVEYGQEKKSTVRKHVPVKELEKIGISGPDRWLKNVERAEQLFSQDESFIRDILLTERSTLCQAYRSIIA
# KCIRARELHLIGIHAFETSHASPQIISHQQKVMHLSFLSLDLPLEQYCKLVSPINHSEDLSRFMSTEAGLNTIVRDLPEDIKNILQVGKSRAISKLLE
# GLELLRSLGLVSPLITSTSNNPFLTCEAKGNHPTTFDAAALDGWNSQTSLSAPVYWKFHDAAPVHHWAQSEINPPFLQDVDVGSVSFAIDYWALLENT
# CLKRSLEAPSQGVSHLASLNTSIATARTLRRPISWTSNYKLSWHQTQYLKRFYNISSGKTPLEAEESDAEIEKISWVISAPSAAVRDYYTNIQSRLAK
# EAEKVRKRRKREELEKQAANSAKAQASLKRKLKRRIYTEKWNGHSYLNVFISSP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g329
###
# start gene g330
Scaffold_13	AUGUSTUS	gene	444514	445185	0.72	+	.	g330
Scaffold_13	AUGUSTUS	transcript	444514	445185	0.72	+	.	g330.t1
Scaffold_13	AUGUSTUS	start_codon	444514	444516	.	+	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_13	AUGUSTUS	CDS	444514	445185	0.72	+	0	transcript_id "g330.t1"; gene_id "g330";
Scaffold_13	AUGUSTUS	stop_codon	445183	445185	.	+	0	transcript_id "g330.t1"; gene_id "g330";
# protein sequence = [MNGLTSNQNALHGIIHRDTFQDAASLEELSAQQEVWREWPLLATDGDLASLLQLVSENKVEFNIDTSHPQACRSALDW
# NSKKAGRSLSIDSNSIKSSCSSPDDDQIETSVYVRFFNLADQASSSGIVQEPINAHMDVDEDLSVVHGVTVDGSPACCRKNILGAVVNCSGCLDELWR
# THSANFSANELNTAQLILWLVGQAGAKGLSKQDLIVSTYTRKLSLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g330
###
# start gene g331
Scaffold_13	AUGUSTUS	gene	446180	446860	0.55	+	.	g331
Scaffold_13	AUGUSTUS	transcript	446180	446860	0.55	+	.	g331.t1
Scaffold_13	AUGUSTUS	start_codon	446180	446182	.	+	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_13	AUGUSTUS	CDS	446180	446860	0.55	+	0	transcript_id "g331.t1"; gene_id "g331";
Scaffold_13	AUGUSTUS	stop_codon	446858	446860	.	+	0	transcript_id "g331.t1"; gene_id "g331";
# protein sequence = [MDMVPLVLADVPPSWAGGVSKSPFGLFTKTYTTGQPLYTVSELSLLMSYSTFTAPAPKLFQQRLLHTSAVVKDAPEVP
# DFSHYRAPNTDNNRALSYFMVGTMGVLSASVAKSSVSEFLQTMAASADVLALAKVEVDLSAIPEGKNVIIKWRGKPVFIRHRTQSEIDEARSADWKTF
# RDPESDEARAKKPEWLVMLGVCTHLGCVPIGEAGDYGGWYVLVNRPCSNL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g331
###
# start gene g332
Scaffold_13	AUGUSTUS	gene	455039	455761	0.3	+	.	g332
Scaffold_13	AUGUSTUS	transcript	455039	455761	0.3	+	.	g332.t1
Scaffold_13	AUGUSTUS	start_codon	455039	455041	.	+	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_13	AUGUSTUS	CDS	455039	455181	0.3	+	0	transcript_id "g332.t1"; gene_id "g332";
Scaffold_13	AUGUSTUS	CDS	455491	455761	0.39	+	1	transcript_id "g332.t1"; gene_id "g332";
Scaffold_13	AUGUSTUS	stop_codon	455759	455761	.	+	0	transcript_id "g332.t1"; gene_id "g332";
# protein sequence = [MAGTKRASPRDEDEKNYPISDVVLTEEDAAKLTQVRKDLQRAEVILGATFSISISWWQHFKENPHFTNTVLKKEYKYV
# PSKAVADEKPDAEGLTPSALEFSWEQDVKPSVSFQLFQASIVYLLTQISAAPCDTVNED]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g332
###
# start gene g333
Scaffold_13	AUGUSTUS	gene	460175	461323	0.4	-	.	g333
Scaffold_13	AUGUSTUS	transcript	460175	461323	0.4	-	.	g333.t1
Scaffold_13	AUGUSTUS	stop_codon	460175	460177	.	-	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_13	AUGUSTUS	CDS	460175	461323	0.4	-	0	transcript_id "g333.t1"; gene_id "g333";
Scaffold_13	AUGUSTUS	start_codon	461321	461323	.	-	0	transcript_id "g333.t1"; gene_id "g333";
# protein sequence = [MPINSSIAGSTVPKMSTSAPKVPSGLSSSNLGVEPLTISKSTPNINPTQIAPIAPISLNSPSGTSSSSSSIASTSAST
# SNGTETCSNFSTPPTSLSHSLGNVLGNSLMLSWTASHPKEDLGAGEKSLRPTESIAIPINGKKGKGKAVTTIDPSDTTSLSWKDKLAMSGASWKDRIS
# AFSSSSSHKSSLSSSNSKVSRPTQGHSRSHSGLPGSWKDPGLAAPAPAVVVSAVITADGEKDGDFFQIAGASSSLSGSSISSSSTVSQSSSATTTLAR
# PSPSGTARPSPEPTPITSQVKPLPDITISTQPRVEYKLQNPNHPSLLSQTAPPRDNATSFDIQETERFRSSPQLHGSQISAHMNQLPPPDYPSAASFN
# PQRLFLSPNP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g333
###
# start gene g334
Scaffold_13	AUGUSTUS	gene	464419	464985	0.96	+	.	g334
Scaffold_13	AUGUSTUS	transcript	464419	464985	0.96	+	.	g334.t1
Scaffold_13	AUGUSTUS	start_codon	464419	464421	.	+	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_13	AUGUSTUS	CDS	464419	464985	0.96	+	0	transcript_id "g334.t1"; gene_id "g334";
Scaffold_13	AUGUSTUS	stop_codon	464983	464985	.	+	0	transcript_id "g334.t1"; gene_id "g334";
# protein sequence = [MVSEIEGDHESRHYSVFSRNSKRGSGTPPSSAHSTQIREPIEELDPGAVVLEDIFEQKSRDEFNKIDTTALSASSAVV
# EKTIIPPGTEKALGGTTVPSTTTAPIQISKPVGPSLSRPHDESDLSTSPSSVVTNSSSSQMSSSGPGGKNSSPSRGGLWNRIKGKTGSRLKNATSLKR
# LTSRNGKPRVKF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g334
###
# start gene g335
Scaffold_13	AUGUSTUS	gene	476088	476438	0.93	-	.	g335
Scaffold_13	AUGUSTUS	transcript	476088	476438	0.93	-	.	g335.t1
Scaffold_13	AUGUSTUS	stop_codon	476088	476090	.	-	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_13	AUGUSTUS	CDS	476088	476438	0.93	-	0	transcript_id "g335.t1"; gene_id "g335";
Scaffold_13	AUGUSTUS	start_codon	476436	476438	.	-	0	transcript_id "g335.t1"; gene_id "g335";
# protein sequence = [MRVQKPPSPPSAVETFDFESTSVHAIETAADSSEPSLRGSIQEVDVEESINSSRNSNGTPTHKSEIEEISDAISIDNI
# EYIDYSNSRLMSALAYLIWAVILITNVYTMVALGLGDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g335
###
# start gene g336
Scaffold_13	AUGUSTUS	gene	479073	479728	0.56	+	.	g336
Scaffold_13	AUGUSTUS	transcript	479073	479728	0.56	+	.	g336.t1
Scaffold_13	AUGUSTUS	start_codon	479073	479075	.	+	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_13	AUGUSTUS	CDS	479073	479129	0.56	+	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_13	AUGUSTUS	CDS	479180	479728	0.68	+	0	transcript_id "g336.t1"; gene_id "g336";
Scaffold_13	AUGUSTUS	stop_codon	479726	479728	.	+	0	transcript_id "g336.t1"; gene_id "g336";
# protein sequence = [MNNRIYQSPDLYTVLSNRLLTSLYSIQSTLDSLRTHRPDYTPRTGFVWPIVDPSLAEDAGKKQEDTSTNEVGGMSEAP
# TKQDATASLGVPKRPQNNTLLMNAMHATAAHSSASLASLALAPTVESVLPDPAASSASRMSATPAPVVSRVATPKPIHQEPPPKAAPGGGKKKRKRIS
# LIRFLSSYTLLIVSTGTMVMASENA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g336
###
# start gene g337
Scaffold_13	AUGUSTUS	gene	480894	482016	0.32	-	.	g337
Scaffold_13	AUGUSTUS	transcript	480894	482016	0.32	-	.	g337.t1
Scaffold_13	AUGUSTUS	stop_codon	480894	480896	.	-	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_13	AUGUSTUS	CDS	480894	481396	0.34	-	2	transcript_id "g337.t1"; gene_id "g337";
Scaffold_13	AUGUSTUS	CDS	481455	482016	0.67	-	0	transcript_id "g337.t1"; gene_id "g337";
Scaffold_13	AUGUSTUS	start_codon	482014	482016	.	-	0	transcript_id "g337.t1"; gene_id "g337";
# protein sequence = [MWKVQCLPSKPISPFPKAHRLNHINNPSEIFSDEDDEDSNNEEVVRDDPEARQSAMDNLVPKLDPSEYGKMPASFHSN
# SQRVGPSSVEKDTVKNDLKESQSSPGTNRLTREPILSRNTYDGVDSDDETDEEDADEDSESEEDKPQIVGDIEVDMGEEEDEFLEFSRQALGISDTQW
# KEILEERKTRGAFVPNIVSPSFKLPTVEKPPAHKSADGAPGSGPNPDLDSFEAVMKAMEDELQRSGSSLSSKSPSKKSSNTQAQGKGTSNDKGKGKAV
# TFAHDSSDEDVDIEAAMEAELKAALERGDDVDEDGLGTTDIDYNLIKNFLESLKSQGGLSGPVGNLAGRLQPDWHLPKDV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g337
###
# start gene g338
Scaffold_13	AUGUSTUS	gene	489875	490234	0.54	+	.	g338
Scaffold_13	AUGUSTUS	transcript	489875	490234	0.54	+	.	g338.t1
Scaffold_13	AUGUSTUS	start_codon	489875	489877	.	+	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_13	AUGUSTUS	CDS	489875	490234	0.54	+	0	transcript_id "g338.t1"; gene_id "g338";
Scaffold_13	AUGUSTUS	stop_codon	490232	490234	.	+	0	transcript_id "g338.t1"; gene_id "g338";
# protein sequence = [MDLNNAAAALGLETDFKSTSYSSILTDEMEDDDMSFADTPAEDVNDQSSLETQMQSLQNYLKSVPYECEPPEYMQDRL
# GEIVGKIVVCAKAQNWHVMTVWDKMLQWHVYHFFFAAESHS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g338
###
# start gene g339
Scaffold_13	AUGUSTUS	gene	500570	501959	1	+	.	g339
Scaffold_13	AUGUSTUS	transcript	500570	501959	1	+	.	g339.t1
Scaffold_13	AUGUSTUS	start_codon	500570	500572	.	+	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_13	AUGUSTUS	CDS	500570	501019	1	+	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_13	AUGUSTUS	CDS	501060	501959	1	+	0	transcript_id "g339.t1"; gene_id "g339";
Scaffold_13	AUGUSTUS	stop_codon	501957	501959	.	+	0	transcript_id "g339.t1"; gene_id "g339";
# protein sequence = [MTSHPDNVINRGNRWYFNPDADALANEIVRLNIGDAAGDATDDAPIRTPPKNKLASAVLADTSPLETNSIPSTDSSPK
# APDHQIVVSHSRGSSTDTTISSQDSATSSTSNAMLAHTPLKSGTISELKERPHSFSGGLSSADLRRYNRLMKWSSGEQLSYPSLTPNNQTVHHRSQTQ
# QAHQGPQNLNRDVTSPIDYNTQARNFNAPLQSGMTPTMSPTSPPYIQGRPNNVPVAYRQPPRGFPPQQGLPLPSPGYAHNGQIPIGNSQQLYDMMLPG
# ASPHDPAHPAVSRVQQQHNVFPRAHHHSASDPTAIRDPAAIAMLNSGMPPFPAGMFPTNLGAAPPQMQMYPPSFYGTQDAYRSDAVAAAQAMANRIQA
# QYTGQYAMVPSQLDGGMSSPSSSAGNQNGPSANNRKLGLYKTELCRSWEEKVAVAMVQNANLPMVKKRFVKFRVILR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g339
###
# start gene g340
Scaffold_13	AUGUSTUS	gene	511968	512648	0.5	-	.	g340
Scaffold_13	AUGUSTUS	transcript	511968	512648	0.5	-	.	g340.t1
Scaffold_13	AUGUSTUS	stop_codon	511968	511970	.	-	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_13	AUGUSTUS	CDS	511968	512648	0.5	-	0	transcript_id "g340.t1"; gene_id "g340";
Scaffold_13	AUGUSTUS	start_codon	512646	512648	.	-	0	transcript_id "g340.t1"; gene_id "g340";
# protein sequence = [MLRKTLTSSATTHWITASANAMKARKNVVEPSHWPKYLRYTQSYIYHSSVSLEVKKTINEGPKSSQRSSSSQNHNYVV
# IRHITEPSHPAYNQFGLFASKKIPAKAHILDYIGKPSQDFRSLKYTNCGCKGEIHADERLTSGMQIRGYDFIKPKCLSDYDLSLLRLQNGESIGIDAS
# TTGNEARFINDYRGIKLKPNAAFIDYRTDLGELKMGIWAANEDIKKGTNC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g340
###
# start gene g341
Scaffold_13	AUGUSTUS	gene	523035	523666	0.54	+	.	g341
Scaffold_13	AUGUSTUS	transcript	523035	523666	0.54	+	.	g341.t1
Scaffold_13	AUGUSTUS	start_codon	523035	523037	.	+	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_13	AUGUSTUS	CDS	523035	523302	0.54	+	0	transcript_id "g341.t1"; gene_id "g341";
Scaffold_13	AUGUSTUS	CDS	523389	523666	0.59	+	2	transcript_id "g341.t1"; gene_id "g341";
Scaffold_13	AUGUSTUS	stop_codon	523664	523666	.	+	0	transcript_id "g341.t1"; gene_id "g341";
# protein sequence = [MHIFISYSFESDLTANLRSVPQFVQGSSNLYPEPVTETRRAITPSSVYSSDEADELDDAFFQQLDELENQIINGSSAT
# APAATSESLSHLPSEISVTPEPSFSNVYDTEIDSPPMKRRRLEDCNENSETPLKQSIKKFEGDWAELLDEYDDELNCPVYASSLTFSNERILITQNIL
# YDIPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g341
###
# start gene g342
Scaffold_13	AUGUSTUS	gene	535803	536174	0.7	-	.	g342
Scaffold_13	AUGUSTUS	transcript	535803	536174	0.7	-	.	g342.t1
Scaffold_13	AUGUSTUS	stop_codon	535803	535805	.	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_13	AUGUSTUS	CDS	535803	536174	0.7	-	0	transcript_id "g342.t1"; gene_id "g342";
Scaffold_13	AUGUSTUS	start_codon	536172	536174	.	-	0	transcript_id "g342.t1"; gene_id "g342";
# protein sequence = [MAPDGLPAPPSNAPTPLFSPSPSGMNTPSIGSSTLGEYLSAPLGKGVQGKGKTYLAGSKALDSLARLIASVESFFHPT
# NSGDWTTDVCFFVDDCLKDKSLNKHSQLSAFIKLIAYNFNKREFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g342
###
# start gene g343
Scaffold_13	AUGUSTUS	gene	536398	536697	0.53	-	.	g343
Scaffold_13	AUGUSTUS	transcript	536398	536697	0.53	-	.	g343.t1
Scaffold_13	AUGUSTUS	stop_codon	536398	536400	.	-	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_13	AUGUSTUS	CDS	536398	536697	0.53	-	0	transcript_id "g343.t1"; gene_id "g343";
Scaffold_13	AUGUSTUS	start_codon	536695	536697	.	-	0	transcript_id "g343.t1"; gene_id "g343";
# protein sequence = [MLLRIWESINSYKYDERMLHFLSKLAEMHVSPEVSDPRKIHSIPDDERSEDEGRLNGSNDTNLKEDAYWPGLYRDVGI
# FSEHEWSLLMCKCLASMGTYL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g343
###
# start gene g344
Scaffold_13	AUGUSTUS	gene	537968	539225	0.63	-	.	g344
Scaffold_13	AUGUSTUS	transcript	537968	539225	0.63	-	.	g344.t1
Scaffold_13	AUGUSTUS	stop_codon	537968	537970	.	-	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_13	AUGUSTUS	CDS	537968	538420	0.71	-	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_13	AUGUSTUS	CDS	538664	538983	0.71	-	2	transcript_id "g344.t1"; gene_id "g344";
Scaffold_13	AUGUSTUS	CDS	539078	539225	0.84	-	0	transcript_id "g344.t1"; gene_id "g344";
Scaffold_13	AUGUSTUS	start_codon	539223	539225	.	-	0	transcript_id "g344.t1"; gene_id "g344";
# protein sequence = [MVGSAHRKLRKVLVRKGLLEDREFSIGFGDGDLDPADVIGQLFSSSIVEVPSQSSSKIDATVLPPTSITLSSHTITST
# FTSTSASVAKTSFTTTSSTSQLIPSVASASTSNTNVIPSSTADSSKSSSTTSSGNIIGIVAAVIIAVLSLSVFGFFILSTTYLSGSSASTKYPQSLLS
# NTAASDEQRLKASGRSITAAFGDSDSFPIPSGVAPPAISPFVDPVVNPSPNIQIPLSAAVKHTPSYTATIHGSQIPTSAYSPVTRRSYGSQSPSFVAS
# APPASDRHPPSEPGEQMRPGTIYHDEDVYDGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g344
###
# start gene g345
Scaffold_13	AUGUSTUS	gene	539492	540019	0.52	-	.	g345
Scaffold_13	AUGUSTUS	transcript	539492	540019	0.52	-	.	g345.t1
Scaffold_13	AUGUSTUS	stop_codon	539492	539494	.	-	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_13	AUGUSTUS	CDS	539492	540019	0.52	-	0	transcript_id "g345.t1"; gene_id "g345";
Scaffold_13	AUGUSTUS	start_codon	540017	540019	.	-	0	transcript_id "g345.t1"; gene_id "g345";
# protein sequence = [MDKSVTHTFRSNLLDELENATNGLIEGEATMKRAMGRLWQVMSEDPEPQSTNPPIVTKTEDEEIEELNEQDARAKRLA
# RAPDLTPPIHKLFLFQNNTSLYGEQSHFTTPESQQGNLERAMAVMRELQDDGREYVERLQEIRESLGDVRAHRNGIWNMVRERAVQELQDAAFEAAG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g345
###
# start gene g346
Scaffold_13	AUGUSTUS	gene	547042	547530	0.83	-	.	g346
Scaffold_13	AUGUSTUS	transcript	547042	547530	0.83	-	.	g346.t1
Scaffold_13	AUGUSTUS	stop_codon	547042	547044	.	-	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_13	AUGUSTUS	CDS	547042	547530	0.83	-	0	transcript_id "g346.t1"; gene_id "g346";
Scaffold_13	AUGUSTUS	start_codon	547528	547530	.	-	0	transcript_id "g346.t1"; gene_id "g346";
# protein sequence = [MESETDEEEQIFAMIAHETKPSAWVATSLDKLTIPATVTRSSSPFSTDSSISASSSHSRSSSRSSNSSSGFSHSFSSS
# SSDTTVSSAAPSPSKQSRRERARQARVFIDTSKTDVTPYDGGKTTVLTGGVMLGGSPPKGRINNSQKATTHHPPPNSGVRSAFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g346
###
# start gene g347
Scaffold_13	AUGUSTUS	gene	549209	550696	0.62	-	.	g347
Scaffold_13	AUGUSTUS	transcript	549209	550696	0.62	-	.	g347.t1
Scaffold_13	AUGUSTUS	stop_codon	549209	549211	.	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_13	AUGUSTUS	CDS	549209	550696	0.62	-	0	transcript_id "g347.t1"; gene_id "g347";
Scaffold_13	AUGUSTUS	start_codon	550694	550696	.	-	0	transcript_id "g347.t1"; gene_id "g347";
# protein sequence = [MRVVLVCHRRKASWLRPQRVQPAHSDIQGISTTSSSMIEEGGRPPNRPSAQTKGMDSTQGMSEVSNHSINPSSMDVFM
# ADTNMQELGTDSTFDGMEGIENLNVDAFSFGYDNFGTDAGSGIVMGMALEDIGMGTNMGMSSFALGSSPASTTSAGTSGSTSFGSTELQSQEGSTSSA
# FNVYQQHYGGGFAVRTSLSPEASGSSPPTQQQEPDEEQEPLTATAQAARMFGMGSLSYPFLTSNSNANNTDIGQSYAASSSNEYSNLNVFTTYTKQQL
# AVGSAQGQPQPAKSSNSIQSSTSYLQQQQSQPTTSSNSPTNYNSTSFDPPTNSQTGHSHPQSQNTSSLTSSFAPSSSVSPLLGDPAQLYARFAEFMSQ
# KAASSLQHTQQTQTMSQRPQEAQQQRQNVQGYTPVSNSYNYYGFAGNANGYFGPSSPQSMNTNPNPNSQATDFEYNADFDAFLRSFRTPDAGIGSTLT
# GGGEYVLPYGQMYGQWQDQTHSGGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g347
###
# start gene g348
Scaffold_13	AUGUSTUS	gene	551218	552654	0.85	-	.	g348
Scaffold_13	AUGUSTUS	transcript	551218	552654	0.85	-	.	g348.t1
Scaffold_13	AUGUSTUS	stop_codon	551218	551220	.	-	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_13	AUGUSTUS	CDS	551218	552654	0.85	-	0	transcript_id "g348.t1"; gene_id "g348";
Scaffold_13	AUGUSTUS	start_codon	552652	552654	.	-	0	transcript_id "g348.t1"; gene_id "g348";
# protein sequence = [MASRIRELEAALGEGHALLEERLLRIGRIDEEPPEEPGSISQLEGLGTLTLGEEGEASYFGSSGGNESLIAREMMLHS
# NSNEDDDSDESSLNPSPELFTAVAGSSVSDEEAILPSEEEGRSLALAYCATGALFFRAWKREELWDEVIPKVYGPGGASAHLQSALFFVFALGAYLSP
# KKINGLHEEQAEIWFQRGRAAFHKKDKKRNSPEDTIRALGLMGTYFSMASRHHSRDSAWAALALAAKLCQGAGLHRDPARWNLPSALVQRRRALFWEV
# YQSDISHSIALGRPPTTPLSFVDCEYPDEDPMSHQDICNLKYRYSRDAFIPIMDLVLSAYPTKRSYREVVELDAKIRKLQVPIPPSDNGLKTFFANQL
# LNAVILTLHRSYMARAILNGKEAAAKGEDPNKPFDPFDSAQTPYAPSVTAAYHAAEEISRSLHGFAVTDSEIAGRVWFLTYHGFSAAVSSALKYLFLE
# SSIYISSF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g348
###
# start gene g349
Scaffold_13	AUGUSTUS	gene	558954	559661	0.59	-	.	g349
Scaffold_13	AUGUSTUS	transcript	558954	559661	0.59	-	.	g349.t1
Scaffold_13	AUGUSTUS	stop_codon	558954	558956	.	-	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_13	AUGUSTUS	CDS	558954	559661	0.59	-	0	transcript_id "g349.t1"; gene_id "g349";
Scaffold_13	AUGUSTUS	start_codon	559659	559661	.	-	0	transcript_id "g349.t1"; gene_id "g349";
# protein sequence = [MGLKALREYHVMAEKQTGKRLRIIRIDGGGELNNGLVDEYCKEHGITIEKVPHDSSAANGVAERAFRTVMDGTRTLLE
# EADMPYSFWGEASNTFIYTNNFVPSSRFPDIVPVEAWTQKRHDIAHLRPFGCDCWATLPRRRTDGKLGRQAIKGKLLGYMGRRGYRLWIPETKRVEES
# HDVTFEEGTPHRTRARKDDGESEGDEETGGIIPTPQAHEPTTLQLTPKVTRAAINDRMN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g349
###
# start gene g350
Scaffold_13	AUGUSTUS	gene	575645	576309	0.28	+	.	g350
Scaffold_13	AUGUSTUS	transcript	575645	576309	0.28	+	.	g350.t1
Scaffold_13	AUGUSTUS	start_codon	575645	575647	.	+	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_13	AUGUSTUS	CDS	575645	575773	0.38	+	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_13	AUGUSTUS	CDS	575829	575960	0.68	+	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_13	AUGUSTUS	CDS	576016	576309	0.48	+	0	transcript_id "g350.t1"; gene_id "g350";
Scaffold_13	AUGUSTUS	stop_codon	576307	576309	.	+	0	transcript_id "g350.t1"; gene_id "g350";
# protein sequence = [MIDESDVKTIASKIHGSTSLGNSSIQISPSIQLQPVGEDSESSAKNDLKQDSNGKLQQLLEAKKYITQLKKIIDGYET
# REDGRDELKNRLSLELNILREDMKNLEVSAEVIQFAHVQSFNESQKSHHKLETDLQSREAELRHLRSTLLARDGEDNNLKVGILCLPSPSPHSCTEPN
# PSASSKTF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g350
###
# start gene g351
Scaffold_13	AUGUSTUS	gene	576679	577999	0.23	+	.	g351
Scaffold_13	AUGUSTUS	transcript	576679	577999	0.23	+	.	g351.t1
Scaffold_13	AUGUSTUS	start_codon	576679	576681	.	+	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_13	AUGUSTUS	CDS	576679	576792	0.33	+	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_13	AUGUSTUS	CDS	576890	577040	0.77	+	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_13	AUGUSTUS	CDS	577086	577206	0.76	+	2	transcript_id "g351.t1"; gene_id "g351";
Scaffold_13	AUGUSTUS	CDS	577328	577349	0.75	+	1	transcript_id "g351.t1"; gene_id "g351";
Scaffold_13	AUGUSTUS	CDS	577691	577999	0.84	+	0	transcript_id "g351.t1"; gene_id "g351";
Scaffold_13	AUGUSTUS	stop_codon	577997	577999	.	+	0	transcript_id "g351.t1"; gene_id "g351";
# protein sequence = [MENQILHLQSELARLQAVGLAPPVQSNMAWTPTPTRRPFSYSLPGVTPNSSPFGMSVGALDANKAYNCPPIWESPRGS
# DSTWQAISTQNGQAGSTSLQDFQSSQSTAIPVSPSHNDSTAIPFGAEESSSRLILPIGAKKFRPTNDPPQQSHDPDGSDGSDDPHDDDDDESDQPSYD
# GGNSDNNDNDNDSDNDDDEQESNKRVIATKWKLKHLAKPFDVKNNLNVSPIVNAWKIDLKAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/5
# CDS introns: 0/4
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g351
###
# start gene g352
Scaffold_13	AUGUSTUS	gene	581758	582234	0.86	+	.	g352
Scaffold_13	AUGUSTUS	transcript	581758	582234	0.86	+	.	g352.t1
Scaffold_13	AUGUSTUS	start_codon	581758	581760	.	+	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_13	AUGUSTUS	CDS	581758	582234	0.86	+	0	transcript_id "g352.t1"; gene_id "g352";
Scaffold_13	AUGUSTUS	stop_codon	582232	582234	.	+	0	transcript_id "g352.t1"; gene_id "g352";
# protein sequence = [MTLTLTNLDAQITLVDLVQYPLDAASNQQASLWFPDAFAYVNVDLGAEYQSLVSTWIDLERTTQWRTNSKVRLPTVNR
# PSLLAKWVDKKRYKCKANEPNIEDCGIEFAENVKTWWTSFQPAWRQGLTGERSSVLHTGSDEWKSIDKFGLNGWFGSLYV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g352
###
# start gene g353
Scaffold_13	AUGUSTUS	gene	583335	583832	0.73	-	.	g353
Scaffold_13	AUGUSTUS	transcript	583335	583832	0.73	-	.	g353.t1
Scaffold_13	AUGUSTUS	stop_codon	583335	583337	.	-	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_13	AUGUSTUS	CDS	583335	583832	0.73	-	0	transcript_id "g353.t1"; gene_id "g353";
Scaffold_13	AUGUSTUS	start_codon	583830	583832	.	-	0	transcript_id "g353.t1"; gene_id "g353";
# protein sequence = [MVQRSIRETVVPSWITRPPSDMGLQQAGTLKADHWRVLFNIHLPFSLICMWGKGSPSAVDNAAEMTPVLETSMHLTCA
# SILMTRNSLSPKTRDQFRSSLRDHILGLKQIFPGFMLPTHHLAFHIYDFMDGFSTVRNWWGFPFERLIGKVQRMPTNHKIGKEITAI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g353
###
# start gene g354
Scaffold_13	AUGUSTUS	gene	584428	585489	0.47	-	.	g354
Scaffold_13	AUGUSTUS	transcript	584428	585489	0.47	-	.	g354.t1
Scaffold_13	AUGUSTUS	stop_codon	584428	584430	.	-	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_13	AUGUSTUS	CDS	584428	585489	0.47	-	0	transcript_id "g354.t1"; gene_id "g354";
Scaffold_13	AUGUSTUS	start_codon	585487	585489	.	-	0	transcript_id "g354.t1"; gene_id "g354";
# protein sequence = [MRNDPAWIFIPGLIQGKSEPDAKNSEHRHYWRLLIDEFSAGYLRGLQPRHTYRSHSSEGLNERVFRVAIAGVLMDFKA
# ARPFAGFLDVTSHHTCFLCKCWHRAHLGRTDYQNWTTAGVEFLKRGAEAWLNAKTPKERNEIEFFYGTRYSELWRLPYWNPIKQLLVDPMHIFFLILM
# QRLAREVLGLDNPESSEEEHRKSKTSKKSQQNNSFISFYHDFTPPPHSSELTSSIGTTSDPPEVLGLDEPEAVDQRLSVLEWGDLSSAEQTARVSRME
# QLREEIQGNPRAFQGISDLHYLLSQGLPVSDVHRDHLRKRLGKFKWVVLAHVCNDLMEFPDEKMEIRLQSHFHSRGKKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g354
###
# start gene g355
Scaffold_13	AUGUSTUS	gene	605314	605832	0.25	+	.	g355
Scaffold_13	AUGUSTUS	transcript	605314	605832	0.25	+	.	g355.t1
Scaffold_13	AUGUSTUS	start_codon	605314	605316	.	+	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_13	AUGUSTUS	CDS	605314	605332	0.25	+	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_13	AUGUSTUS	CDS	605407	605558	0.86	+	2	transcript_id "g355.t1"; gene_id "g355";
Scaffold_13	AUGUSTUS	CDS	605638	605832	0.87	+	0	transcript_id "g355.t1"; gene_id "g355";
Scaffold_13	AUGUSTUS	stop_codon	605830	605832	.	+	0	transcript_id "g355.t1"; gene_id "g355";
# protein sequence = [MFLLTVLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLIWSDSSASDASFATAQSIPTT
# GSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g355
###
# start gene g356
Scaffold_13	AUGUSTUS	gene	606093	607125	0.31	-	.	g356
Scaffold_13	AUGUSTUS	transcript	606093	607125	0.31	-	.	g356.t1
Scaffold_13	AUGUSTUS	stop_codon	606093	606095	.	-	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_13	AUGUSTUS	CDS	606093	606535	0.56	-	2	transcript_id "g356.t1"; gene_id "g356";
Scaffold_13	AUGUSTUS	CDS	606609	607125	0.31	-	0	transcript_id "g356.t1"; gene_id "g356";
Scaffold_13	AUGUSTUS	start_codon	607123	607125	.	-	0	transcript_id "g356.t1"; gene_id "g356";
# protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR
# ISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYQLRR
# FERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAE
# QLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g356
###
# start gene g357
Scaffold_13	AUGUSTUS	gene	607337	608045	0.81	-	.	g357
Scaffold_13	AUGUSTUS	transcript	607337	608045	0.81	-	.	g357.t1
Scaffold_13	AUGUSTUS	stop_codon	607337	607339	.	-	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_13	AUGUSTUS	CDS	607337	607625	0.97	-	1	transcript_id "g357.t1"; gene_id "g357";
Scaffold_13	AUGUSTUS	CDS	607675	608045	0.83	-	0	transcript_id "g357.t1"; gene_id "g357";
Scaffold_13	AUGUSTUS	start_codon	608043	608045	.	-	0	transcript_id "g357.t1"; gene_id "g357";
# protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGET
# EEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEEQLRDSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDALIGKYLSNPSDESLGEMSKDE
# RIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVERKAYAHVE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g357
###
# start gene g358
Scaffold_13	AUGUSTUS	gene	608110	609248	0.46	-	.	g358
Scaffold_13	AUGUSTUS	transcript	608110	609248	0.46	-	.	g358.t1
Scaffold_13	AUGUSTUS	stop_codon	608110	608112	.	-	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_13	AUGUSTUS	CDS	608110	609161	0.53	-	2	transcript_id "g358.t1"; gene_id "g358";
Scaffold_13	AUGUSTUS	CDS	609242	609248	0.46	-	0	transcript_id "g358.t1"; gene_id "g358";
Scaffold_13	AUGUSTUS	start_codon	609246	609248	.	-	0	transcript_id "g358.t1"; gene_id "g358";
# protein sequence = [MNRIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELD
# QLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRM
# KYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDE
# LKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKREIVWLKISIGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g358
###
# start gene g359
Scaffold_13	AUGUSTUS	gene	609541	610799	0.88	-	.	g359
Scaffold_13	AUGUSTUS	transcript	609541	610799	0.88	-	.	g359.t1
Scaffold_13	AUGUSTUS	stop_codon	609541	609543	.	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_13	AUGUSTUS	CDS	609541	610352	0.96	-	2	transcript_id "g359.t1"; gene_id "g359";
Scaffold_13	AUGUSTUS	CDS	610427	610799	0.89	-	0	transcript_id "g359.t1"; gene_id "g359";
Scaffold_13	AUGUSTUS	start_codon	610797	610799	.	-	0	transcript_id "g359.t1"; gene_id "g359";
# protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV
# GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQ
# VFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNS
# QRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEK
# PINLNTEEVFTKYKPVDKRLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g359
###
# start gene g360
Scaffold_13	AUGUSTUS	gene	610961	611854	0.75	-	.	g360
Scaffold_13	AUGUSTUS	transcript	610961	611854	0.75	-	.	g360.t1
Scaffold_13	AUGUSTUS	stop_codon	610961	610963	.	-	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_13	AUGUSTUS	CDS	610961	611854	0.75	-	0	transcript_id "g360.t1"; gene_id "g360";
Scaffold_13	AUGUSTUS	start_codon	611852	611854	.	-	0	transcript_id "g360.t1"; gene_id "g360";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDD
# ERRNIAIVANQAWHMKTIVIIQW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g360
###
# start gene g361
Scaffold_13	AUGUSTUS	gene	611884	612204	0.48	-	.	g361
Scaffold_13	AUGUSTUS	transcript	611884	612204	0.48	-	.	g361.t1
Scaffold_13	AUGUSTUS	stop_codon	611884	611886	.	-	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_13	AUGUSTUS	CDS	611884	612204	0.48	-	0	transcript_id "g361.t1"; gene_id "g361";
Scaffold_13	AUGUSTUS	start_codon	612202	612204	.	-	0	transcript_id "g361.t1"; gene_id "g361";
# protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE
# LSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g361
###
# start gene g362
Scaffold_13	AUGUSTUS	gene	612383	614869	0.32	-	.	g362
Scaffold_13	AUGUSTUS	transcript	612383	614869	0.32	-	.	g362.t1
Scaffold_13	AUGUSTUS	stop_codon	612383	612385	.	-	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_13	AUGUSTUS	CDS	612383	613851	0.52	-	2	transcript_id "g362.t1"; gene_id "g362";
Scaffold_13	AUGUSTUS	CDS	614854	614869	0.39	-	0	transcript_id "g362.t1"; gene_id "g362";
Scaffold_13	AUGUSTUS	start_codon	614867	614869	.	-	0	transcript_id "g362.t1"; gene_id "g362";
# protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI
# SRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS
# AKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL
# VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD
# NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ
# SHFKEGADIMTVNSSNGTDGQRKC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g362
###
# start gene g363
Scaffold_13	AUGUSTUS	gene	616028	618344	0.48	+	.	g363
Scaffold_13	AUGUSTUS	transcript	616028	618344	0.48	+	.	g363.t1
Scaffold_13	AUGUSTUS	start_codon	616028	616030	.	+	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_13	AUGUSTUS	CDS	616028	617459	0.92	+	0	transcript_id "g363.t1"; gene_id "g363";
Scaffold_13	AUGUSTUS	CDS	617534	617774	0.49	+	2	transcript_id "g363.t1"; gene_id "g363";
Scaffold_13	AUGUSTUS	CDS	617867	618344	1	+	1	transcript_id "g363.t1"; gene_id "g363";
Scaffold_13	AUGUSTUS	stop_codon	618342	618344	.	+	0	transcript_id "g363.t1"; gene_id "g363";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID
# DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP
# FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLK
# GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSES
# TETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIK
# LNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKRLTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g363
###
# start gene g364
Scaffold_13	AUGUSTUS	gene	619412	619882	0.89	+	.	g364
Scaffold_13	AUGUSTUS	transcript	619412	619882	0.89	+	.	g364.t1
Scaffold_13	AUGUSTUS	start_codon	619412	619414	.	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_13	AUGUSTUS	CDS	619412	619882	0.89	+	0	transcript_id "g364.t1"; gene_id "g364";
Scaffold_13	AUGUSTUS	stop_codon	619880	619882	.	+	0	transcript_id "g364.t1"; gene_id "g364";
# protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA
# VDTSYKAVGWYIYQIDPTERRSFSITLDQWTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDAVILKAC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g364
###
# start gene g365
Scaffold_13	AUGUSTUS	gene	619978	620427	0.51	+	.	g365
Scaffold_13	AUGUSTUS	transcript	619978	620427	0.51	+	.	g365.t1
Scaffold_13	AUGUSTUS	start_codon	619978	619980	.	+	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_13	AUGUSTUS	CDS	619978	620427	0.51	+	0	transcript_id "g365.t1"; gene_id "g365";
Scaffold_13	AUGUSTUS	stop_codon	620425	620427	.	+	0	transcript_id "g365.t1"; gene_id "g365";
# protein sequence = [MVLMDCHESHLVDGKQTSEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQ
# EALDEERSYEIRRKPHVRIQRPTCEVFSRNLFPTFDEEFVHNPYPEHIASEGNRLDELIPLIGKYLSKPIR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g365
###
# start gene g366
Scaffold_13	AUGUSTUS	gene	620597	621836	0.43	+	.	g366
Scaffold_13	AUGUSTUS	transcript	620597	621836	0.43	+	.	g366.t1
Scaffold_13	AUGUSTUS	start_codon	620597	620599	.	+	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_13	AUGUSTUS	CDS	620597	620602	1	+	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_13	AUGUSTUS	CDS	620723	620865	1	+	0	transcript_id "g366.t1"; gene_id "g366";
Scaffold_13	AUGUSTUS	CDS	621000	621190	0.43	+	1	transcript_id "g366.t1"; gene_id "g366";
Scaffold_13	AUGUSTUS	CDS	621541	621836	0.94	+	2	transcript_id "g366.t1"; gene_id "g366";
Scaffold_13	AUGUSTUS	stop_codon	621834	621836	.	+	0	transcript_id "g366.t1"; gene_id "g366";
# protein sequence = [MITDEAVESTSYFDAYTFIVSEGTCRYNDNVVPSNGCKYIIHGRDSLSSCLVRRKYGIKGIRISAYNSQANGKIERAH
# LDIRQALIKATGGDISKWFYFLKMILMGIRVTPRRDELRVALYLLLEMDGTILKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDE
# YWMTPENDYIFDAIPRLRLSDTDLTKNSVRERINN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g366
###
# start gene g367
Scaffold_13	AUGUSTUS	gene	624617	624961	0.54	-	.	g367
Scaffold_13	AUGUSTUS	transcript	624617	624961	0.54	-	.	g367.t1
Scaffold_13	AUGUSTUS	stop_codon	624617	624619	.	-	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_13	AUGUSTUS	CDS	624617	624961	0.54	-	0	transcript_id "g367.t1"; gene_id "g367";
Scaffold_13	AUGUSTUS	start_codon	624959	624961	.	-	0	transcript_id "g367.t1"; gene_id "g367";
# protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS
# SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g367
###
# start gene g368
Scaffold_13	AUGUSTUS	gene	625873	626575	0.43	-	.	g368
Scaffold_13	AUGUSTUS	transcript	625873	626575	0.43	-	.	g368.t1
Scaffold_13	AUGUSTUS	stop_codon	625873	625875	.	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_13	AUGUSTUS	CDS	625873	626309	0.78	-	2	transcript_id "g368.t1"; gene_id "g368";
Scaffold_13	AUGUSTUS	CDS	626368	626575	0.51	-	0	transcript_id "g368.t1"; gene_id "g368";
Scaffold_13	AUGUSTUS	start_codon	626573	626575	.	-	0	transcript_id "g368.t1"; gene_id "g368";
# protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS
# KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE
# DEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g368
###
# start gene g369
Scaffold_13	AUGUSTUS	gene	634584	634874	0.44	+	.	g369
Scaffold_13	AUGUSTUS	transcript	634584	634874	0.44	+	.	g369.t1
Scaffold_13	AUGUSTUS	start_codon	634584	634586	.	+	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_13	AUGUSTUS	CDS	634584	634874	0.44	+	0	transcript_id "g369.t1"; gene_id "g369";
Scaffold_13	AUGUSTUS	stop_codon	634872	634874	.	+	0	transcript_id "g369.t1"; gene_id "g369";
# protein sequence = [MTGGLLCPGEIDWKDDMYVVSHPIFVNTTHRNDSVRAAVQRMDPSMTLPALPIHSASIRKKFTLDDPDKGFLQVIGYF
# KYVSVSLSLLLFMTKYLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g369
###
# start gene g370
Scaffold_13	AUGUSTUS	gene	636736	638444	0.43	+	.	g370
Scaffold_13	AUGUSTUS	transcript	636736	638444	0.43	+	.	g370.t1
Scaffold_13	AUGUSTUS	start_codon	636736	636738	.	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_13	AUGUSTUS	CDS	636736	636807	1	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_13	AUGUSTUS	CDS	636861	637427	0.43	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_13	AUGUSTUS	CDS	637587	638444	0.67	+	0	transcript_id "g370.t1"; gene_id "g370";
Scaffold_13	AUGUSTUS	stop_codon	638442	638444	.	+	0	transcript_id "g370.t1"; gene_id "g370";
# protein sequence = [MVTQDTTSATEALQLMVSRHFRHLPVCNEDGNVVGLLDITKVFHEALGKVERSSAASEQLFNAMAGVQSELGNVGSNP
# QAAAMLAWADKLRERTALPDLTTVMDSRTQPATVGPKTTVREVAKLMKERRTTAVCVMEGAATSPGMQTSSKVVGIFTSKDVVLRVIAAGLDSGRCSV
# VRVMTPHPDTAPPTLSVHEALKKCIVSDHSVTIAGPLMNAVSAEQGIGNETDGGPMWGRFFDSIGHDDTESMLSGSHIPPDIRALQSNTSLSQLHSPR
# SEVHPNDSASVVDDESAVSYHNQKGTPSISAPPPVDDGTYVFKFRTPSGRTHRFQSRHDNVEHLREIVAGKLTTDPFFTDFKPTDSNVIPPDPIDFLL
# SYTDADGDTVLITSDHDVSDAVKIARSSGSDRVVLFVQGGKAWEDAGARDSEVKAAETAAAAIKEIREVEKQELPIPPVYAPPPPPLPQDQVLGIPKD
# LLLPASIGALAVVILGIFTVSRLSSSHY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g370
###
# start gene g371
Scaffold_13	AUGUSTUS	gene	660230	661402	0.4	+	.	g371
Scaffold_13	AUGUSTUS	transcript	660230	661402	0.4	+	.	g371.t1
Scaffold_13	AUGUSTUS	start_codon	660230	660232	.	+	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_13	AUGUSTUS	CDS	660230	661402	0.4	+	0	transcript_id "g371.t1"; gene_id "g371";
Scaffold_13	AUGUSTUS	stop_codon	661400	661402	.	+	0	transcript_id "g371.t1"; gene_id "g371";
# protein sequence = [MNLLTTPLDESTQINPVLLPYLKHVDLNCGHSVVLPRVFSYISATGLEKIELWLTPSSSNLTLSVTPSSSESRWYSTQ
# QNLHLSSLQDLCLQFIGRDQDLLSSSLRYFTFPILRNLEIVNTDPGVRTLTKADAEAHHTQLPPMPRFESFFRDPRFPYLTSLSLSHFEVEESRVDSL
# LGYIPALTSLSLDTVTNCLVLLESLTLKATRVAAGHSLGWMSEFLDSPNKQKAQQPQRRMKFCSRLEALSLWGCDLDMTVLYNMIKARNDPTQDDDDD
# TGPYTTVLQSSTKRSATVLPARRVIRPLRRAKLSSQSNNQNVESVGISEDDSSTLFGASSSAATVLASPAILQAMQASAAQPTSQVSYLRVAGCKGVN
# DRAAGRLANLVADVVWSD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g371
###
# start gene g372
Scaffold_13	AUGUSTUS	gene	665349	665936	0.9	+	.	g372
Scaffold_13	AUGUSTUS	transcript	665349	665936	0.9	+	.	g372.t1
Scaffold_13	AUGUSTUS	start_codon	665349	665351	.	+	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_13	AUGUSTUS	CDS	665349	665936	0.9	+	0	transcript_id "g372.t1"; gene_id "g372";
Scaffold_13	AUGUSTUS	stop_codon	665934	665936	.	+	0	transcript_id "g372.t1"; gene_id "g372";
# protein sequence = [MSSSKSKTKHEEALQLLDDLDSFTPIESAVSSGSATAPAPESETEVLAFLDEITQKSSEPTRPTTAHLERPASRTGAP
# SLRKSTERVRLGGSSLSTGTSTPSRAGTPPTNSRTIGSSEPASDPAPATGGGGSWGWGSVWTTASAALQQARSVVDEQVKNLPSNEQAKKWSEGVKEY
# AKTHQLDKLGKSDAFIDSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g372
###
# start gene g373
Scaffold_13	AUGUSTUS	gene	668284	669793	0.41	+	.	g373
Scaffold_13	AUGUSTUS	transcript	668284	669793	0.41	+	.	g373.t1
Scaffold_13	AUGUSTUS	start_codon	668284	668286	.	+	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_13	AUGUSTUS	CDS	668284	668444	0.44	+	0	transcript_id "g373.t1"; gene_id "g373";
Scaffold_13	AUGUSTUS	CDS	669355	669793	0.54	+	1	transcript_id "g373.t1"; gene_id "g373";
Scaffold_13	AUGUSTUS	stop_codon	669791	669793	.	+	0	transcript_id "g373.t1"; gene_id "g373";
# protein sequence = [MDISGVDFPEREKRFEVVYHMLSVRFAGRLRVKTYAGEGDHVPSAVEIFRGADCSSLGSLEKRQAGVFLDASMANTDQ
# NPSISSESSDQEVKQLESPLNASQSVSQGSNVPDSNSITTSGSVSDTMDSKGSPAISSNNTSHSRPTLVQLGSNTTSAAQHPKKYSASNINKKFLEQN
# STSTTVPPAFGSNSARLGGTEYI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g373
###
# start gene g374
Scaffold_13	AUGUSTUS	gene	671871	673188	0.57	+	.	g374
Scaffold_13	AUGUSTUS	transcript	671871	673188	0.57	+	.	g374.t1
Scaffold_13	AUGUSTUS	start_codon	671871	671873	.	+	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_13	AUGUSTUS	CDS	671871	672045	0.57	+	0	transcript_id "g374.t1"; gene_id "g374";
Scaffold_13	AUGUSTUS	CDS	672122	673188	0.79	+	2	transcript_id "g374.t1"; gene_id "g374";
Scaffold_13	AUGUSTUS	stop_codon	673186	673188	.	+	0	transcript_id "g374.t1"; gene_id "g374";
# protein sequence = [MPPQDASRPPFARKSSSFALPTPATPSGTAESWKSKPSAVAPPPSSQPPSATTGNPVLYLAEFMGVPEKIEEEQSKDL
# QVTQSETVSPSKSRRPVASDFFDEESPSFIVSSTSTVRFDAGAWETNNEVPAVISLVDENAPNDAVSQSEVAVPEVVVPVLSKQAPVDQNLVPTVPPH
# IPPTGARRNHYNKEAAMSAVDDAMSGIRCALDVMHEKDHRSFELDQPARTLFPSSPMSSNRWLPPALRESRPTETFATTCTEPPKSPKSWKVFTVNFP
# ITSTPRDPIPCKQLQLFLYGGIYCLYSSCRRHVTARIHSERRIIPKAVLVWGYKGKSKYRVQIPKSVLKVNLPSQNVTARPSTASKLTGADGASTWRK
# PTTTTGKIELQHSVGLDTTSRSPPPEPEPSRYLKSKKAKKY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g374
###
# start gene g375
Scaffold_13	AUGUSTUS	gene	673242	673592	0.79	+	.	g375
Scaffold_13	AUGUSTUS	transcript	673242	673592	0.79	+	.	g375.t1
Scaffold_13	AUGUSTUS	start_codon	673242	673244	.	+	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_13	AUGUSTUS	CDS	673242	673592	0.79	+	0	transcript_id "g375.t1"; gene_id "g375";
Scaffold_13	AUGUSTUS	stop_codon	673590	673592	.	+	0	transcript_id "g375.t1"; gene_id "g375";
# protein sequence = [MPAGSGVAFYRNAHLSTESGLKSSVSFFAANELEIPSNTSPEDAQTILIAQDLLPNAVSTANTQPSPSSSSTVNSLPV
# KSSPSTSQYGLPSLIPSGKAESKSSDDSVCLNSWFIGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g375
###
# start gene g376
Scaffold_13	AUGUSTUS	gene	674777	675023	0.5	-	.	g376
Scaffold_13	AUGUSTUS	transcript	674777	675023	0.5	-	.	g376.t1
Scaffold_13	AUGUSTUS	stop_codon	674777	674779	.	-	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_13	AUGUSTUS	CDS	674777	674861	0.54	-	1	transcript_id "g376.t1"; gene_id "g376";
Scaffold_13	AUGUSTUS	CDS	674914	675023	0.5	-	0	transcript_id "g376.t1"; gene_id "g376";
Scaffold_13	AUGUSTUS	start_codon	675021	675023	.	-	0	transcript_id "g376.t1"; gene_id "g376";
# protein sequence = [MRCDYIAEGVIKATKELELKIPLVVRLKGTKENEAKQMIKDSGLKITAFDSLDEAAETAVQFAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g376
###
# start gene g377
Scaffold_13	AUGUSTUS	gene	675228	675937	0.53	-	.	g377
Scaffold_13	AUGUSTUS	transcript	675228	675937	0.53	-	.	g377.t1
Scaffold_13	AUGUSTUS	stop_codon	675228	675230	.	-	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_13	AUGUSTUS	CDS	675228	675818	0.59	-	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_13	AUGUSTUS	CDS	675878	675937	0.53	-	0	transcript_id "g377.t1"; gene_id "g377";
Scaffold_13	AUGUSTUS	start_codon	675935	675937	.	-	0	transcript_id "g377.t1"; gene_id "g377";
# protein sequence = [MLGSKLITKQTGAGGRICNAVMLAERRDPSHEYYVAVLNDRVTQGVVLVASAQGGMNIEEVAAKDPSAIITTPINFNT
# GLTKPEALAVAGKLGFKDSAADEAADIFINLYRIFKEKDATQIEINPMAETTDGKVLCMDAKFGFDDNAEFRQQDVFSLRDVSQEEASEVEAQKANLN
# FIKLDGSIGCLVNGAGLAMATMDVLSLHGGNPANFLDVGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g377
###
# start gene g378
Scaffold_13	AUGUSTUS	gene	677931	678281	0.55	-	.	g378
Scaffold_13	AUGUSTUS	transcript	677931	678281	0.55	-	.	g378.t1
Scaffold_13	AUGUSTUS	stop_codon	677931	677933	.	-	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_13	AUGUSTUS	CDS	677931	678281	0.55	-	0	transcript_id "g378.t1"; gene_id "g378";
Scaffold_13	AUGUSTUS	start_codon	678279	678281	.	-	0	transcript_id "g378.t1"; gene_id "g378";
# protein sequence = [MANGESSAYAMAPLQARGVLFIHPQTDVYPGMVVGECSKAQDIYVNPCLKKQLTNFRSAGADDKIVMASPRVMTLEES
# MAYMADDELIEITPKSIRLRKSILDPDKRKRMGGGKVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g378
###
# start gene g379
Scaffold_13	AUGUSTUS	gene	678412	679600	0.84	-	.	g379
Scaffold_13	AUGUSTUS	transcript	678412	679600	0.84	-	.	g379.t1
Scaffold_13	AUGUSTUS	stop_codon	678412	678414	.	-	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_13	AUGUSTUS	CDS	678412	678927	1	-	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_13	AUGUSTUS	CDS	679055	679600	0.84	-	0	transcript_id "g379.t1"; gene_id "g379";
Scaffold_13	AUGUSTUS	start_codon	679598	679600	.	-	0	transcript_id "g379.t1"; gene_id "g379";
# protein sequence = [MNVLISRPLVVMNKADRSTSRPAQVESDLFDLFATLGATDEQMEYPLLYASAKQGWAQPEVPVIGAVPIEDASTEGDV
# TTQMTPLFDLILSHVPPPTHLTADGPFSMLTVQIENDSYVGMLYLGRIESGFLKVGDNILALDADGNECGGGKVKKIFSRIGMDRVEKDTATAGEIVS
# IAGIKMTTPIDPPTISMFVYPNDAPFAGREGSKLTSQVIRDRIYKEAETNVALKVLPGPTSEALELRGRGVLHLGVLFETLRREGFELTIGPPKAVMI
# PDPDVKGGKLEPIESCTINVREEYAGKVIERLTMRKGEMHLYENGDPEEGWVKIEMDVPARGLIGYMAGEFKNDVHGEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g379
###
# start gene g380
Scaffold_13	AUGUSTUS	gene	679636	680079	0.3	-	.	g380
Scaffold_13	AUGUSTUS	transcript	679636	680079	0.3	-	.	g380.t1
Scaffold_13	AUGUSTUS	stop_codon	679636	679638	.	-	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_13	AUGUSTUS	CDS	679636	680079	0.3	-	0	transcript_id "g380.t1"; gene_id "g380";
Scaffold_13	AUGUSTUS	start_codon	680077	680079	.	-	0	transcript_id "g380.t1"; gene_id "g380";
# protein sequence = [MKKKFDLTAGYSTVDHGKTTLVDQLLRQSGTLKRLSALEQLQLTPTSSSMAGTTADSAVDGGFITRVMDSNDLEKERG
# ITILSKCTSIMYKGTLINIVDTPGHADFGGEVERIMSMVDGVALIVDATEGPMTQTRFVLSKALSRGLK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g380
###
# start gene g381
Scaffold_13	AUGUSTUS	gene	682275	682760	0.6	+	.	g381
Scaffold_13	AUGUSTUS	transcript	682275	682760	0.6	+	.	g381.t1
Scaffold_13	AUGUSTUS	start_codon	682275	682277	.	+	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_13	AUGUSTUS	CDS	682275	682760	0.6	+	0	transcript_id "g381.t1"; gene_id "g381";
Scaffold_13	AUGUSTUS	stop_codon	682758	682760	.	+	0	transcript_id "g381.t1"; gene_id "g381";
# protein sequence = [MDDPNADEDLIPRDTRRSQRLLDSRIQNDGELSDSDDEGEGGRRNHARHRDSDSVESGGGISGRKYGLGAGIMHTSAA
# THGAGPSGHVTNVRVFSTPKASSMEVDTLSLPAEIEDVEVKMENGSEGGGREKSDSMDIDSSSATTPAEIASEAPLGSTLNLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g381
###
# start gene g382
Scaffold_13	AUGUSTUS	gene	683929	685494	1	-	.	g382
Scaffold_13	AUGUSTUS	transcript	683929	685494	1	-	.	g382.t1
Scaffold_13	AUGUSTUS	stop_codon	683929	683931	.	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_13	AUGUSTUS	CDS	683929	685494	1	-	0	transcript_id "g382.t1"; gene_id "g382";
Scaffold_13	AUGUSTUS	start_codon	685492	685494	.	-	0	transcript_id "g382.t1"; gene_id "g382";
# protein sequence = [MDNIYSFDLPYSPRPYSLDASETPATYYGHVYEFDFTLPESQGALFIDEDYKLSNELQSSPSEPGSFDSEFQAFHAPS
# TISSGAFTAIGRNKSARREDILPQISLDMTPSYSIHISPSIAQISSRSRTFHSPSPSKHAPNPGRPRANELPNMISETSPFQYSFARATAHASLPDGI
# LGGYKSLRSLFSTPVKPSASRGSIQKMSSDSMTPSLDYSPSRSSSSLSSSSAMPASPIISGVPNFYRFQLGGIYNTSCDATELVPNQTDVSPVIHRSP
# SRSFRLRPADFTEATVSEGSGNFILGKEKASADTVCKHVDSLFSPFVLQTPKKSPTASAALAAVATLSSPLTPVTDDESIADPSFMKDSLPQNVPSSL
# AIHSARKRPYELENSPSPACPPKRARSNYLLALQEKERLERQHDHGSSDTFSSPEKPLAEARRNQSSAVSGPSRATNQPVASTSSSATETTPTFTERT
# FPREIVLDNTPTTLEISNDVFPLFYRRFPASSYFKVQDRLVAFTEHLSREI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g382
###
# start gene g383
Scaffold_13	AUGUSTUS	gene	692268	692960	0.93	+	.	g383
Scaffold_13	AUGUSTUS	transcript	692268	692960	0.93	+	.	g383.t1
Scaffold_13	AUGUSTUS	start_codon	692268	692270	.	+	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_13	AUGUSTUS	CDS	692268	692960	0.93	+	0	transcript_id "g383.t1"; gene_id "g383";
Scaffold_13	AUGUSTUS	stop_codon	692958	692960	.	+	0	transcript_id "g383.t1"; gene_id "g383";
# protein sequence = [MNTNQPDAPAFFRKPPYDRIELRSSTITKPVSADRRILSSLGAIRTPRSTVRVSPYQHCRPLSPDPTFQPASFAASNT
# SNDIPTTSITQSENLQTSDPTISQPRIVTSRTTTRDALNASQPQESLAHDDSGDEFETDDKIPKPSGEVGQPTRGGYNLRIKLGWADDRFDDVEVHTF
# NYLRDMCSNSSPQKFITEIVGRKLDATQRFDQQSLSDIKELGDMVSPLLLCFLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g383
###
# start gene g384
Scaffold_13	AUGUSTUS	gene	701446	701997	0.57	+	.	g384
Scaffold_13	AUGUSTUS	transcript	701446	701997	0.57	+	.	g384.t1
Scaffold_13	AUGUSTUS	start_codon	701446	701448	.	+	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_13	AUGUSTUS	CDS	701446	701997	0.57	+	0	transcript_id "g384.t1"; gene_id "g384";
Scaffold_13	AUGUSTUS	stop_codon	701995	701997	.	+	0	transcript_id "g384.t1"; gene_id "g384";
# protein sequence = [MRICTTGRKVDKPHANTLISEKLRKVLGANTILKHMQVQLNFPLILPQKSIREEPELTDSRKAFEVLELVEVPFLLIC
# QVTAGYSFDQEPARELEASNVVNTGLVLDANIPQTMRRRVDHRIRYPDFAGKIVYHREKSQEDAKGASCFTDSNAVTTGIVPRTADISKPIRTRRICQ
# TLRRLQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g384
###
# start gene g385
Scaffold_13	AUGUSTUS	gene	702475	702969	0.58	+	.	g385
Scaffold_13	AUGUSTUS	transcript	702475	702969	0.58	+	.	g385.t1
Scaffold_13	AUGUSTUS	start_codon	702475	702477	.	+	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_13	AUGUSTUS	CDS	702475	702969	0.58	+	0	transcript_id "g385.t1"; gene_id "g385";
Scaffold_13	AUGUSTUS	stop_codon	702967	702969	.	+	0	transcript_id "g385.t1"; gene_id "g385";
# protein sequence = [MLVAEENTQLKNEQARTSHLTIQLKGCREQCSSQKYALDTAEQRLESLQKTLNARSQELESLKGNMTTHADILSQKNA
# QLLDAQEQSADLTTRLKALQERTDLQHCRLEETLQELENLRMNNQDLLRELESLKDEHIDAKNIAKGTGQLMNIQVRSSILPCIKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g385
###
# start gene g386
Scaffold_13	AUGUSTUS	gene	706735	708168	0.85	-	.	g386
Scaffold_13	AUGUSTUS	transcript	706735	708168	0.85	-	.	g386.t1
Scaffold_13	AUGUSTUS	stop_codon	706735	706737	.	-	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_13	AUGUSTUS	CDS	706735	708168	0.85	-	0	transcript_id "g386.t1"; gene_id "g386";
Scaffold_13	AUGUSTUS	start_codon	708166	708168	.	-	0	transcript_id "g386.t1"; gene_id "g386";
# protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF
# NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE
# LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS
# ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL
# VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM
# VREVLTG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g386
###
# start gene g387
Scaffold_13	AUGUSTUS	gene	711730	713256	0.68	+	.	g387
Scaffold_13	AUGUSTUS	transcript	711730	713256	0.68	+	.	g387.t1
Scaffold_13	AUGUSTUS	start_codon	711730	711732	.	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_13	AUGUSTUS	CDS	711730	713256	0.68	+	0	transcript_id "g387.t1"; gene_id "g387";
Scaffold_13	AUGUSTUS	stop_codon	713254	713256	.	+	0	transcript_id "g387.t1"; gene_id "g387";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD
# LLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSLNG
# TQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVN
# LAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g387
###
# start gene g388
Scaffold_13	AUGUSTUS	gene	713286	715176	0.35	+	.	g388
Scaffold_13	AUGUSTUS	transcript	713286	715176	0.35	+	.	g388.t1
Scaffold_13	AUGUSTUS	start_codon	713286	713288	.	+	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_13	AUGUSTUS	CDS	713286	714647	0.47	+	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_13	AUGUSTUS	CDS	714772	715176	0.61	+	0	transcript_id "g388.t1"; gene_id "g388";
Scaffold_13	AUGUSTUS	stop_codon	715174	715176	.	+	0	transcript_id "g388.t1"; gene_id "g388";
# protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE
# DVDEPDDEDTIKLIPSSRPTNQINNEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA
# ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID
# DERRNFAIVANQSVAYEDHSDPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPF
# KFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNQNIVLDGYKRCEQETF
# SKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNEQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILK
# ILVWGRIAINLNPQNHTESM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g388
###
# start gene g389
Scaffold_13	AUGUSTUS	gene	715253	715540	0.6	+	.	g389
Scaffold_13	AUGUSTUS	transcript	715253	715540	0.6	+	.	g389.t1
Scaffold_13	AUGUSTUS	start_codon	715253	715255	.	+	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_13	AUGUSTUS	CDS	715253	715540	0.6	+	0	transcript_id "g389.t1"; gene_id "g389";
Scaffold_13	AUGUSTUS	stop_codon	715538	715540	.	+	0	transcript_id "g389.t1"; gene_id "g389";
# protein sequence = [MVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE
# TNKQVDNEAIGVENQST]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g389
###
# start gene g390
Scaffold_13	AUGUSTUS	gene	719405	720850	0.54	-	.	g390
Scaffold_13	AUGUSTUS	transcript	719405	720850	0.54	-	.	g390.t1
Scaffold_13	AUGUSTUS	stop_codon	719405	719407	.	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_13	AUGUSTUS	CDS	719405	719832	1	-	2	transcript_id "g390.t1"; gene_id "g390";
Scaffold_13	AUGUSTUS	CDS	719914	720049	0.92	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_13	AUGUSTUS	CDS	720683	720850	0.72	-	0	transcript_id "g390.t1"; gene_id "g390";
Scaffold_13	AUGUSTUS	start_codon	720848	720850	.	-	0	transcript_id "g390.t1"; gene_id "g390";
# protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS
# AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKS
# RQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g390
###
# start gene g391
Scaffold_13	AUGUSTUS	gene	721939	722848	0.17	-	.	g391
Scaffold_13	AUGUSTUS	transcript	721939	722848	0.17	-	.	g391.t1
Scaffold_13	AUGUSTUS	stop_codon	721939	721941	.	-	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_13	AUGUSTUS	CDS	721939	722466	0.87	-	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_13	AUGUSTUS	CDS	722590	722627	0.78	-	2	transcript_id "g391.t1"; gene_id "g391";
Scaffold_13	AUGUSTUS	CDS	722734	722772	0.26	-	2	transcript_id "g391.t1"; gene_id "g391";
Scaffold_13	AUGUSTUS	CDS	722824	722848	0.24	-	0	transcript_id "g391.t1"; gene_id "g391";
Scaffold_13	AUGUSTUS	start_codon	722846	722848	.	-	0	transcript_id "g391.t1"; gene_id "g391";
# protein sequence = [MQDLLQINLNYVLACNSCAGLHVDLAMDALNALHELRTQLDRLGSLFDQARQSFLQSFRDLQQAGQDPIVVLEALKAA
# DPQRKSLSVEDWTVLATLFQWSSPFNLNGLNFDNRTPAEWIDLLRGLHSGASSATVTADGHLVDDSQPPAAAVEVSEALDPQGSLPNTVVEKASGVED
# LASLSEGSPIQTELDLPQIESLTEPTLSPEKGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g391
###
# start gene g392
Scaffold_13	AUGUSTUS	gene	739369	740543	0.57	-	.	g392
Scaffold_13	AUGUSTUS	transcript	739369	740543	0.57	-	.	g392.t1
Scaffold_13	AUGUSTUS	stop_codon	739369	739371	.	-	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_13	AUGUSTUS	CDS	739369	740393	0.9	-	2	transcript_id "g392.t1"; gene_id "g392";
Scaffold_13	AUGUSTUS	CDS	740465	740543	0.62	-	0	transcript_id "g392.t1"; gene_id "g392";
Scaffold_13	AUGUSTUS	start_codon	740541	740543	.	-	0	transcript_id "g392.t1"; gene_id "g392";
# protein sequence = [MYLFFTAMLVNVLVFAAPPPKVPTPPIKYTIRLGRRVGTTGPFLSNNIDFAPDQQLVLFVGHGAYQYNAGKVLYETVA
# FDPSGKHVAPYSSHSQNQEDSNFIKLGTDRVQDIFIELDGEEILTARIVHPYHSLKHIHGLAGLNRLISTVEDLQGVTEYQINSNLQYVDQVFTVLAD
# LERADGKTKLLKPEDCREWAKIFNVKRAQSLGVGTVSVSAHPPPATVTKYTIRLGRRVGTHEQLLSNKIDFAPNQQFVLFIGDHIALQYHRNAGKASK
# YENLVDFSAFPIPFGSSLPHPDSPFIRLGPNRRQDLSIELDTSRTMTVKMKDDSTMYIRSLTEFWELIESVEDLRKIISFPIISDLDWGECGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g392
###
# start gene g393
Scaffold_13	AUGUSTUS	gene	753522	753969	0.42	+	.	g393
Scaffold_13	AUGUSTUS	transcript	753522	753969	0.42	+	.	g393.t1
Scaffold_13	AUGUSTUS	start_codon	753522	753524	.	+	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_13	AUGUSTUS	CDS	753522	753671	0.45	+	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_13	AUGUSTUS	CDS	753745	753969	0.75	+	0	transcript_id "g393.t1"; gene_id "g393";
Scaffold_13	AUGUSTUS	stop_codon	753967	753969	.	+	0	transcript_id "g393.t1"; gene_id "g393";
# protein sequence = [MYVMVDIVVNHFANWGDSNINWSGLTPLNSESYFHSKCWVDWNNQTSAEQCWMGDGYVPLMDVNTEDDQVVTILNNFA
# RNLTTTYGFDGARLDAAKSIRKDFWPAFVSASGVYSQGEAWYGDAP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g393
###
# start gene g394
Scaffold_13	AUGUSTUS	gene	760630	761613	0.36	-	.	g394
Scaffold_13	AUGUSTUS	transcript	760630	761613	0.36	-	.	g394.t1
Scaffold_13	AUGUSTUS	stop_codon	760630	760632	.	-	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_13	AUGUSTUS	CDS	760630	760923	0.79	-	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_13	AUGUSTUS	CDS	760963	761613	0.41	-	0	transcript_id "g394.t1"; gene_id "g394";
Scaffold_13	AUGUSTUS	start_codon	761611	761613	.	-	0	transcript_id "g394.t1"; gene_id "g394";
# protein sequence = [MLKKRKGGGLDPSRQQSKSTAGSWTISTSESTGNAIRRAQMMPPPSTVPRAPQQSIASSSKSATRRTDSAPADTQRTN
# RARPRLSHAIPLPTVEMDIDIEDPYASTDRFELEAFDPIVIQSHEYDIVLVLDNREIKSGRDRSGIADGLRRQGVVVAQRSLNIGDLCWIAKRKPQYC
# NNSEYDEIVLDCILERKRLDDLVQSIKDNRFHDQKVSRFLVFRLHNTAITKVYYLVEEYKLSRVTVFSKLFNSDGRCFLAAERGWEEQDKSTYELAID
# TVLSQTAIADKFQVKETRSINDTIDFYVSLNRQVVSMYKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g394
###
# start gene g395
Scaffold_13	AUGUSTUS	gene	765894	766262	0.98	+	.	g395
Scaffold_13	AUGUSTUS	transcript	765894	766262	0.98	+	.	g395.t1
Scaffold_13	AUGUSTUS	start_codon	765894	765896	.	+	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_13	AUGUSTUS	CDS	765894	766262	0.98	+	0	transcript_id "g395.t1"; gene_id "g395";
Scaffold_13	AUGUSTUS	stop_codon	766260	766262	.	+	0	transcript_id "g395.t1"; gene_id "g395";
# protein sequence = [MVFAVNPGSDAKFAAFKAAAMGQNSTSTASASIVTVTATVTASGGETITTTYGSYPGSSAPTAATSTDHKVIVGDNGT
# LTYNPANITAQIGDTVTFEFHQKNHTVTQSSFADVCPRSFTQKT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g395
###
# start gene g396
Scaffold_13	AUGUSTUS	gene	766515	766736	0.35	+	.	g396
Scaffold_13	AUGUSTUS	transcript	766515	766736	0.35	+	.	g396.t1
Scaffold_13	AUGUSTUS	start_codon	766515	766517	.	+	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_13	AUGUSTUS	CDS	766515	766736	0.35	+	0	transcript_id "g396.t1"; gene_id "g396";
Scaffold_13	AUGUSTUS	stop_codon	766734	766736	.	+	0	transcript_id "g396.t1"; gene_id "g396";
# protein sequence = [MVFSVNAVENSNSSFEAFQAKALALNTTASASGSASLSSPSATSTSNSALSIHGIYGAGTVIAVVGAAVGVLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g396
###
# start gene g397
Scaffold_13	AUGUSTUS	gene	771874	772779	0.89	+	.	g397
Scaffold_13	AUGUSTUS	transcript	771874	772779	0.89	+	.	g397.t1
Scaffold_13	AUGUSTUS	start_codon	771874	771876	.	+	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_13	AUGUSTUS	CDS	771874	772779	0.89	+	0	transcript_id "g397.t1"; gene_id "g397";
Scaffold_13	AUGUSTUS	stop_codon	772777	772779	.	+	0	transcript_id "g397.t1"; gene_id "g397";
# protein sequence = [METLESFWQAAEPILQSVFDSPEAPPKDLDYKTFSSVYTKCYDYTTSRKSQATAEDSPSISSQLASEPSSPAALVLPP
# PSYRRIDEFFAERAKIIYDNSPGPTTSSSDLARYVLVQFTQFSGATSITSRLLRYLERYVINQLIYEGHGWSTVGNQSNNTLKKMTEEQLLERDRKLE
# RWGYEKDADNNLGTWKEVESWAEAGSSLDRIVPIKSLAFRRLRVAFLEPLLADQGRLALAIGELLDTHKCQEVEGSDKEELLLGLKDVFRSCGIAPDN
# LQRVKLELYLHPSNDYRHVGTAPALIK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g397
###
# start gene g398
Scaffold_13	AUGUSTUS	gene	819296	820099	0.91	+	.	g398
Scaffold_13	AUGUSTUS	transcript	819296	820099	0.91	+	.	g398.t1
Scaffold_13	AUGUSTUS	start_codon	819296	819298	.	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_13	AUGUSTUS	CDS	819296	820099	0.91	+	0	transcript_id "g398.t1"; gene_id "g398";
Scaffold_13	AUGUSTUS	stop_codon	820097	820099	.	+	0	transcript_id "g398.t1"; gene_id "g398";
# protein sequence = [MLAAKALQKPITKIDDGPHWIRVLAAELSLRLNDARKERPNLWPKTLALHAGHGKVNCFRTLVVLKVRIGYGTARSKQ
# APFPFTKEVTVNVIAAAGGKLWKELVGNVTGTIRITYISLGFTGIEATDASQQSIASFLDSHAVTGVKRPNEEKNGNPSKSRHRNTQRVRSRPSSPSA
# DQNTTSFTCLECHKTLSLSPKLLSTSDVLGRAYALAALKDEHSDFHFAESVAREMEPEVKEVRGPHKKVKTPMIQEKEIGPRGIEKFFNRT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g398
###
# start gene g399
Scaffold_13	AUGUSTUS	gene	824695	825600	0.76	-	.	g399
Scaffold_13	AUGUSTUS	transcript	824695	825600	0.76	-	.	g399.t1
Scaffold_13	AUGUSTUS	stop_codon	824695	824697	.	-	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_13	AUGUSTUS	CDS	824695	825600	0.76	-	0	transcript_id "g399.t1"; gene_id "g399";
Scaffold_13	AUGUSTUS	start_codon	825598	825600	.	-	0	transcript_id "g399.t1"; gene_id "g399";
# protein sequence = [MACYDYAQCDILRNQEGVTDIMRAGIPAVGRHSAHSRQAKLFTSQSLYLDSDITAAVNNAFSNGSDFYKIVAEKNGPT
# LEQQKELVERVHALGRQTVTHASHFEYYLQAIESGTDSIQHVFADGEIDASMIAKIKARENMFVTPTMEMFRIAYAYPRLAFILRGWKGFGKTSFADI
# QKNVHKMFMAGIPLLAGTDSIGNALRFLTGASLPFGPTLHCELENFVDMTPAEAIRSATVVPAAWHRVRDRGVILPGMRADLVLLNSNPLLNISNARD
# IARVWIAGVEYLDVADGAKFSCSSLID]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g399
###
# start gene g400
Scaffold_13	AUGUSTUS	gene	832960	833451	0.87	+	.	g400
Scaffold_13	AUGUSTUS	transcript	832960	833451	0.87	+	.	g400.t1
Scaffold_13	AUGUSTUS	start_codon	832960	832962	.	+	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_13	AUGUSTUS	CDS	832960	833451	0.87	+	0	transcript_id "g400.t1"; gene_id "g400";
Scaffold_13	AUGUSTUS	stop_codon	833449	833451	.	+	0	transcript_id "g400.t1"; gene_id "g400";
# protein sequence = [MEGYINDAGTINLPRLQFILDEMAQWEVDVFEKENSDTNWYKGKQAKYKNGATPKTNELVITKPQHDIFRAVRDWLMA
# KPTKALTMPNDFPAKDRLFILTIARDLNLSLAWDEYDEEGRNILSFSPAYPEDAFDNEEQEAQVAVLRVVEKIREGADRWRRRRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g400
###
# start gene g401
Scaffold_13	AUGUSTUS	gene	835429	835791	0.83	+	.	g401
Scaffold_13	AUGUSTUS	transcript	835429	835791	0.83	+	.	g401.t1
Scaffold_13	AUGUSTUS	start_codon	835429	835431	.	+	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_13	AUGUSTUS	CDS	835429	835791	0.83	+	0	transcript_id "g401.t1"; gene_id "g401";
Scaffold_13	AUGUSTUS	stop_codon	835789	835791	.	+	0	transcript_id "g401.t1"; gene_id "g401";
# protein sequence = [MLRAVDVLPGANPDARVKDIRSWLKSKGVQDFEAVTLFCDQLGKETITQIEKLADDFNGKQVDYWDKKKAIVKGIPRQ
# AVLKPAHAIYRLQGQRFALSDRVIMVQDSGGVPLGAKGVVVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g401
###
# start gene g402
Scaffold_13	AUGUSTUS	gene	847037	847369	0.46	+	.	g402
Scaffold_13	AUGUSTUS	transcript	847037	847369	0.46	+	.	g402.t1
Scaffold_13	AUGUSTUS	start_codon	847037	847039	.	+	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_13	AUGUSTUS	CDS	847037	847369	0.46	+	0	transcript_id "g402.t1"; gene_id "g402";
Scaffold_13	AUGUSTUS	stop_codon	847367	847369	.	+	0	transcript_id "g402.t1"; gene_id "g402";
# protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP
# VQVLTPRRGQPPWSLRLGAGLLLELILQSSKP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g402
###
# start gene g403
Scaffold_13	AUGUSTUS	gene	853792	855554	0.08	+	.	g403
Scaffold_13	AUGUSTUS	transcript	853792	855554	0.08	+	.	g403.t1
Scaffold_13	AUGUSTUS	start_codon	853792	853794	.	+	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_13	AUGUSTUS	CDS	853792	853801	0.23	+	0	transcript_id "g403.t1"; gene_id "g403";
Scaffold_13	AUGUSTUS	CDS	853864	854244	0.32	+	2	transcript_id "g403.t1"; gene_id "g403";
Scaffold_13	AUGUSTUS	CDS	855007	855554	0.81	+	2	transcript_id "g403.t1"; gene_id "g403";
Scaffold_13	AUGUSTUS	stop_codon	855552	855554	.	+	0	transcript_id "g403.t1"; gene_id "g403";
# protein sequence = [MPPLASPVPPIQKTRITELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRS
# RKNTSIASKGKARQIVVTDEGSTSNEVESEDEAEDEDIAPPPKRLKTTSSISDLAISLRRAIDLNDQLKQLESLFDSTRDLFLRSVLDLQNAGEDPIV
# VLEALKAAEPNRRAISLNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEG
# ASSQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g403
###
# start gene g404
Scaffold_13	AUGUSTUS	gene	857250	858027	0.35	+	.	g404
Scaffold_13	AUGUSTUS	transcript	857250	858027	0.35	+	.	g404.t1
Scaffold_13	AUGUSTUS	start_codon	857250	857252	.	+	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_13	AUGUSTUS	CDS	857250	857276	0.36	+	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_13	AUGUSTUS	CDS	857383	857518	0.55	+	0	transcript_id "g404.t1"; gene_id "g404";
Scaffold_13	AUGUSTUS	CDS	857600	858027	1	+	2	transcript_id "g404.t1"; gene_id "g404";
Scaffold_13	AUGUSTUS	stop_codon	858025	858027	.	+	0	transcript_id "g404.t1"; gene_id "g404";
# protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA
# PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERA
# TTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g404
###
# start gene g405
Scaffold_13	AUGUSTUS	gene	858469	860654	0.8	-	.	g405
Scaffold_13	AUGUSTUS	transcript	858469	860654	0.8	-	.	g405.t1
Scaffold_13	AUGUSTUS	stop_codon	858469	858471	.	-	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_13	AUGUSTUS	CDS	858469	859828	0.84	-	1	transcript_id "g405.t1"; gene_id "g405";
Scaffold_13	AUGUSTUS	CDS	859867	860654	0.8	-	0	transcript_id "g405.t1"; gene_id "g405";
Scaffold_13	AUGUSTUS	start_codon	860652	860654	.	-	0	transcript_id "g405.t1"; gene_id "g405";
# protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKK
# KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSR
# ITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDNFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMNLFPTFDEEFV
# QNNPYPEAHRSSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGV
# FATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEW
# FFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPY
# FLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDR
# KMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTKRTN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g405
###
# start gene g406
Scaffold_13	AUGUSTUS	gene	860701	862307	0.84	-	.	g406
Scaffold_13	AUGUSTUS	transcript	860701	862307	0.84	-	.	g406.t1
Scaffold_13	AUGUSTUS	stop_codon	860701	860703	.	-	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_13	AUGUSTUS	CDS	860701	862228	0.88	-	1	transcript_id "g406.t1"; gene_id "g406";
Scaffold_13	AUGUSTUS	CDS	862285	862307	0.84	-	0	transcript_id "g406.t1"; gene_id "g406";
Scaffold_13	AUGUSTUS	start_codon	862305	862307	.	-	0	transcript_id "g406.t1"; gene_id "g406";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKATLPDEFR
# IERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNI
# PIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQL
# SRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKY
# AGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEETYCSSSPRMAFMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g406
###
# start gene g407
Scaffold_13	AUGUSTUS	gene	862631	863008	0.39	-	.	g407
Scaffold_13	AUGUSTUS	transcript	862631	863008	0.39	-	.	g407.t1
Scaffold_13	AUGUSTUS	stop_codon	862631	862633	.	-	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_13	AUGUSTUS	CDS	862631	863008	0.39	-	0	transcript_id "g407.t1"; gene_id "g407";
Scaffold_13	AUGUSTUS	start_codon	863006	863008	.	-	0	transcript_id "g407.t1"; gene_id "g407";
# protein sequence = [MQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTV
# GTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGEHDSKGNFHSSMS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g407
###
# start gene g408
Scaffold_13	AUGUSTUS	gene	863328	863743	0.15	-	.	g408
Scaffold_13	AUGUSTUS	transcript	863328	863743	0.15	-	.	g408.t1
Scaffold_13	AUGUSTUS	stop_codon	863328	863330	.	-	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_13	AUGUSTUS	CDS	863328	863672	0.25	-	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_13	AUGUSTUS	CDS	863717	863743	0.28	-	0	transcript_id "g408.t1"; gene_id "g408";
Scaffold_13	AUGUSTUS	start_codon	863741	863743	.	-	0	transcript_id "g408.t1"; gene_id "g408";
# protein sequence = [MIMFNLGRITNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTK
# TNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRICLKS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g408
###
# start gene g409
Scaffold_13	AUGUSTUS	gene	864094	865619	0.25	-	.	g409
Scaffold_13	AUGUSTUS	transcript	864094	865619	0.25	-	.	g409.t1
Scaffold_13	AUGUSTUS	stop_codon	864094	864096	.	-	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_13	AUGUSTUS	CDS	864094	864779	0.69	-	2	transcript_id "g409.t1"; gene_id "g409";
Scaffold_13	AUGUSTUS	CDS	864899	865619	0.25	-	0	transcript_id "g409.t1"; gene_id "g409";
Scaffold_13	AUGUSTUS	start_codon	865617	865619	.	-	0	transcript_id "g409.t1"; gene_id "g409";
# protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT
# RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR
# GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFKSLIPRELTEEQQQMVALNKDLMEANMKEIRAVK
# SLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMPEGGDSKRY
# KLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g409
###
# start gene g410
Scaffold_13	AUGUSTUS	gene	870535	870870	0.64	-	.	g410
Scaffold_13	AUGUSTUS	transcript	870535	870870	0.64	-	.	g410.t1
Scaffold_13	AUGUSTUS	stop_codon	870535	870537	.	-	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_13	AUGUSTUS	CDS	870535	870870	0.64	-	0	transcript_id "g410.t1"; gene_id "g410";
Scaffold_13	AUGUSTUS	start_codon	870868	870870	.	-	0	transcript_id "g410.t1"; gene_id "g410";
# protein sequence = [MGDKFTKNFFFDPSKNHEFITILHKLSKDQSRASLPDSSADEAHRKTLQSIDQHDEKHQQIDRSLPRRPRPFIPSNLA
# LNVKLNMLATGFSKVSNETLGVYPGTGVCGMDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g410
###
# start gene g411
Scaffold_13	AUGUSTUS	gene	880787	882964	0.35	+	.	g411
Scaffold_13	AUGUSTUS	transcript	880787	882964	0.35	+	.	g411.t1
Scaffold_13	AUGUSTUS	start_codon	880787	880789	.	+	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_13	AUGUSTUS	CDS	880787	880791	0.42	+	0	transcript_id "g411.t1"; gene_id "g411";
Scaffold_13	AUGUSTUS	CDS	880880	881379	0.87	+	1	transcript_id "g411.t1"; gene_id "g411";
Scaffold_13	AUGUSTUS	CDS	881544	882964	0.88	+	2	transcript_id "g411.t1"; gene_id "g411";
Scaffold_13	AUGUSTUS	stop_codon	882962	882964	.	+	0	transcript_id "g411.t1"; gene_id "g411";
# protein sequence = [MIITLDNESHGSSPSIKQQDTQVSSPFQSADDTDATEVHADRYPQPGSPYKQPVRNDHPSTFYSQYPPTVIPPGFVMH
# AAPYFDPNVYTRTIPMIPSYAPISYLPPTTTLPPNLSGSSNLLTQSVPPVVSAPYPTMPTQEYPGVNGISLMVIAHWEDHVDSDTASPTKTVNKPGPI
# PSIIVDQEDHTHQEDPENNDFGWGSGSDSAVKWGETEETAEPANTSEWDNKAPSAESWGEDVESWGEDVESWGNAISSEPELSTKKGSEKRTSKAHDN
# NRRKDLLGPKGAYSKSSSRSRETQSGSSSLSREPRGTGSQRRGMETPPHLWVKDRKSRWDNGGSLDSDKMRPKSSARSTVDAISADLSRRLDENEITS
# KPSSRAHNNNENYPVSPNGSNLLSTIPKEGSDVDLGVHQELDAPEDTNDNIDSPLPDAPDDADGGFTESAEISGEFNTDTGGNRPINSGVTEGTSVTE
# NIRDTPVDRERTTDEEGVEVVDAQPGSNDSDDSSLTHDANGQEGTSNRLHEHVQEVAEEDSRGMASGNTHSSMNWDAADDAWNGPNWGPTDPETYSHK
# PHSKLPCKAFGQGYCPFGENCEFSHISVDNDERQSSEVTVGIDDTIDVSFKLDFPVGRHQRLSGTSSKWLRSQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g411
###
# start gene g412
Scaffold_13	AUGUSTUS	gene	883488	884306	0.74	+	.	g412
Scaffold_13	AUGUSTUS	transcript	883488	884306	0.74	+	.	g412.t1
Scaffold_13	AUGUSTUS	start_codon	883488	883490	.	+	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_13	AUGUSTUS	CDS	883488	884306	0.74	+	0	transcript_id "g412.t1"; gene_id "g412";
Scaffold_13	AUGUSTUS	stop_codon	884304	884306	.	+	0	transcript_id "g412.t1"; gene_id "g412";
# protein sequence = [MDSFKKAESLNGEVFNGRKIKISRNSRLKKQTHFPLRVEGLAVTTEKQKLMDFFKNSVLVEMIAPTYTDNPTHQLENL
# LQTCGELEEFSVEVSPTNTARAMVFARFSDAAVASRAIATLNDTEHAFLGGGRLKVQETFYSCYCLPQEKASSVRADINSLQTIHGPGIKVQEHLNSA
# DDFELRIYGSDSILFARARLEFDQLMEGEIILDDDNKPLWDDYFDLPSSTKQIDLMNTRNAGSFFIERDFRNRTGTYWPLGVRNVAPVQRIFCTNF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g412
###
# start gene g413
Scaffold_13	AUGUSTUS	gene	892942	893876	0.85	-	.	g413
Scaffold_13	AUGUSTUS	transcript	892942	893876	0.85	-	.	g413.t1
Scaffold_13	AUGUSTUS	stop_codon	892942	892944	.	-	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_13	AUGUSTUS	CDS	892942	893523	0.91	-	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_13	AUGUSTUS	CDS	893574	893876	0.91	-	0	transcript_id "g413.t1"; gene_id "g413";
Scaffold_13	AUGUSTUS	start_codon	893874	893876	.	-	0	transcript_id "g413.t1"; gene_id "g413";
# protein sequence = [MELEAPIEIIDGPLCLAPSATVAGLDSEEEDGFQNMFSSSKSSTKLTPVQFWGDSPRIKELSSLGGKLNFTVPALSQY
# DDDSEDEGILFNAVRNKNKSMLAEPFDRLPPSPTNRRPATKGRKSKVAASKARGLRPMRLSTPPPRDNLTTPPPNQTLEISPVRTPLSHKGLHMSPTA
# SLAHYKSHLDPPPTLQFDQSSSGGAPSTPKRSLAFPLLDDSPFRTSLIGMSPFRTPGSSGLFDPHDPRALLDEEFRRMGPGGFGETSPASGLFGKERQ
# LLYDSPSGLDSSPGKYKRWW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g413
###
# start gene g414
Scaffold_13	AUGUSTUS	gene	893907	895058	0.6	-	.	g414
Scaffold_13	AUGUSTUS	transcript	893907	895058	0.6	-	.	g414.t1
Scaffold_13	AUGUSTUS	stop_codon	893907	893909	.	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_13	AUGUSTUS	CDS	893907	895001	0.6	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_13	AUGUSTUS	CDS	895056	895058	0.61	-	0	transcript_id "g414.t1"; gene_id "g414";
Scaffold_13	AUGUSTUS	start_codon	895056	895058	.	-	0	transcript_id "g414.t1"; gene_id "g414";
# protein sequence = [MVVPKVESPVQTPVLSQQLAPQQPKPFYPLPDTVSLTALQTFQASVSGPPVTPHIRRVQTLNEIAERSPLPPSSPFLN
# SPQSSPVRPIVNLVSSPGPMGPPPEEESYGKLPYTLPSGPYSPNKPDLSYAALLGQAILSSSDHRLTLQEIYDWITIVYPFFKRGETTWMNSIRHVLS
# TTACFRKVTRDRALGRTQWAIWDEDLECFKGGGFRKQFCKDMNGGKTGSEAKTKRGRKQVEDSDGSAEPKPKKVKKDNNLKDSDKGHQRAIAPATAIF
# PPTRPAPPLQPYRGASVAKNLTSEVVFPPLPAESGFRLLPVHPSSSSNSRANSHFDTDDGMRPSIAHTLCPRITMHRPFLHLVRSGPYTQS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g414
###
# start gene g415
Scaffold_13	AUGUSTUS	gene	896724	897155	0.95	-	.	g415
Scaffold_13	AUGUSTUS	transcript	896724	897155	0.95	-	.	g415.t1
Scaffold_13	AUGUSTUS	stop_codon	896724	896726	.	-	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_13	AUGUSTUS	CDS	896724	897155	0.95	-	0	transcript_id "g415.t1"; gene_id "g415";
Scaffold_13	AUGUSTUS	start_codon	897153	897155	.	-	0	transcript_id "g415.t1"; gene_id "g415";
# protein sequence = [MSSSRYFIDASKSGVETDGYKADEPVQDDQDEDMPEGDESSSTVVRAETEAISQTAATEIKEEYEQDEKHADWFHLDT
# TDTQNLEIGKESDSETEDDSDNADVAGEDIADDNIDDWDKLYADDLPSAPLLMDEDIDVASLFIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g415
###
# start gene g416
Scaffold_13	AUGUSTUS	gene	901794	903592	0.54	+	.	g416
Scaffold_13	AUGUSTUS	transcript	901794	903592	0.54	+	.	g416.t1
Scaffold_13	AUGUSTUS	start_codon	901794	901796	.	+	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_13	AUGUSTUS	CDS	901794	902266	0.62	+	0	transcript_id "g416.t1"; gene_id "g416";
Scaffold_13	AUGUSTUS	CDS	902332	903592	0.83	+	1	transcript_id "g416.t1"; gene_id "g416";
Scaffold_13	AUGUSTUS	stop_codon	903590	903592	.	+	0	transcript_id "g416.t1"; gene_id "g416";
# protein sequence = [MLTKNVQERITMSKIQRHPFFLSEKPKITYGGIPSLETISVPLKSIDDIDLELLRSLRTLWREAPDEELKNSLVNPDR
# NWQKGAYYLLFEYRRKRLEEYDEQVAEIERKRMHKEARARAEANRAAKFKKEKAGIQTFPSPVPSCDGPPTPRRATRRGRAARGGRPRGATSAASSDA
# SFIPRERPSHLVPSTFSEDDIKSSLDENALRPQSITRNASPLLPLTVPETEDPKVQAFYTQVLEHLSVLHARTGGPINTNTSASPQGVISPNLALMQE
# IFEDRTMSGESESSPVPTPFAPMNLGLTQLNHINKETCAASPPITIRFPTRPLSLKRKETVQRPKRPTIKTGNDTANKENGQLLTATYGGVELMKKSS
# LRKGGLHGTGKRVQIVDPGIPPDKPSKLKKKRSLRGPPSSPAPSSTSSVLSSSSPFLSPMSTGSAWFTNVFKFSRPEVFTLHSTHSVHVTRNECRRLL
# MAMDVRVVLEDAEGLGILKCKLDEVRDSNGIMSVLKAVKFKIDVRQTEEELFLILIHEKGSTDSFREVCKRLRRQWVLDAVESRIPEQLIPSPLGMAT
# RRMELLSPV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g416
###
# start gene g417
Scaffold_13	AUGUSTUS	gene	905191	905892	0.51	+	.	g417
Scaffold_13	AUGUSTUS	transcript	905191	905892	0.51	+	.	g417.t1
Scaffold_13	AUGUSTUS	start_codon	905191	905193	.	+	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_13	AUGUSTUS	CDS	905191	905467	0.63	+	0	transcript_id "g417.t1"; gene_id "g417";
Scaffold_13	AUGUSTUS	CDS	905549	905892	0.75	+	2	transcript_id "g417.t1"; gene_id "g417";
Scaffold_13	AUGUSTUS	stop_codon	905890	905892	.	+	0	transcript_id "g417.t1"; gene_id "g417";
# protein sequence = [MDASSLSDDLSDYDVVSDPGRHSLESSIADLTPNPAPTNEPSPVQEAYDKFATIRLTANDIQVNTRTSLGLAPASSSK
# ADRTGNDNRTKACLSTPSSFVKPNYHFPSVHLIAGVYSDELCECYGTPTTVPHLERCEILRHCRWVDEVLPDAPWQIDEQFLRERHIDYIVVEEGMTV
# DPSCDKVRLKGYDAMKRMGEKSIPPAVKEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g417
###
# start gene g418
Scaffold_13	AUGUSTUS	gene	916866	917613	0.37	-	.	g418
Scaffold_13	AUGUSTUS	transcript	916866	917613	0.37	-	.	g418.t1
Scaffold_13	AUGUSTUS	stop_codon	916866	916868	.	-	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_13	AUGUSTUS	CDS	916866	917511	0.53	-	1	transcript_id "g418.t1"; gene_id "g418";
Scaffold_13	AUGUSTUS	CDS	917594	917613	0.37	-	0	transcript_id "g418.t1"; gene_id "g418";
Scaffold_13	AUGUSTUS	start_codon	917611	917613	.	-	0	transcript_id "g418.t1"; gene_id "g418";
# protein sequence = [MKSFMISELPNLCLDVGPFGVLRVSGSCWPEKVMKDSIPQELFPAGLLNIEGLDEADKKVSHDMLMRRLSQIIAQKIK
# NDPQVVSPGMVDENDSHQKGKRQRGRSSTVVDDTGVAPSGIVSGTRKTKSIKLDKGDDIAGPSTSGNRRTKGPKSTNVDSVTLGSSARTGKQRKGNGR
# PVRIRRGRSRIRDIATGRASAGLPRPDDSNSSSLPSTFPYNLRKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g418
###
# start gene g419
Scaffold_13	AUGUSTUS	gene	918060	919819	0.09	-	.	g419
Scaffold_13	AUGUSTUS	transcript	918060	919819	0.09	-	.	g419.t1
Scaffold_13	AUGUSTUS	stop_codon	918060	918062	.	-	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_13	AUGUSTUS	CDS	918060	918304	0.55	-	2	transcript_id "g419.t1"; gene_id "g419";
Scaffold_13	AUGUSTUS	CDS	918368	918558	0.62	-	1	transcript_id "g419.t1"; gene_id "g419";
Scaffold_13	AUGUSTUS	CDS	918654	919819	0.15	-	0	transcript_id "g419.t1"; gene_id "g419";
Scaffold_13	AUGUSTUS	start_codon	919817	919819	.	-	0	transcript_id "g419.t1"; gene_id "g419";
# protein sequence = [MNQLLMGISSNGKINLVANGEWRRPFWTPPKSLSDDSHAESETTAYIESLHIPLGNPNKEIPLIILHELGSFQYNVKL
# RNRLDRIFSPSSHTYEGFSQATKSLTLIIRRFLVNTSGTGKTKLLFEGLCMHWGFYMTCAIDSFNLGAADFPLAVSNLNRNSTWTAYLPSTSSANHVS
# LLQTNIRLVYRAVSEVLLTRLLIFRMYLEACAKEGFCLQQRQRWLELQISPKNTISSSDAFGMLKYKITRAGLSDDDLDKAIRHSWDEIQSFWDSPEM
# STVGDFLYIALDEANVASRKYDEAFEDHHGRYPILKELIRGLRRQLGHLPIRFVVVGTIIPENHFQSLVGEWDDFRWCSDTGSFNDPEDHRRYVSQFM
# PVSFASSVTGQALIDRMHRYTASFLAVLLHSNFTSPHTLLGNYIRNFTEYAPHDNEEYSRGEEPRYNNWYSPLGSKGLLERSLSTAEMHRAVIAFLTT
# ARGIIDCSTKDRILITEDYGYFMDPECSQIALDEPLTVTYGAGWLKKNSYFSIRKFISFFLQP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g419
###
# start gene g420
Scaffold_13	AUGUSTUS	gene	921407	922211	0.68	+	.	g420
Scaffold_13	AUGUSTUS	transcript	921407	922211	0.68	+	.	g420.t1
Scaffold_13	AUGUSTUS	start_codon	921407	921409	.	+	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_13	AUGUSTUS	CDS	921407	921857	0.72	+	0	transcript_id "g420.t1"; gene_id "g420";
Scaffold_13	AUGUSTUS	CDS	921964	922211	0.72	+	2	transcript_id "g420.t1"; gene_id "g420";
Scaffold_13	AUGUSTUS	stop_codon	922209	922211	.	+	0	transcript_id "g420.t1"; gene_id "g420";
# protein sequence = [MLKSKISEGFLSDEDLDEAITHSWDEIQSFWNSPEMSTAGDSFYIAIDEANVASRKHDEAFEDQHGRYPILKEIIRGL
# RRQIGSSKLPIRFVVAGTMIPEDHFQSTVGSGMIFACSDTGSFNDPEDHRRYVSQFMPDSFSSSVTGQALIAPSFLAVLLRHNYQSPHTLLGNYIGNF
# TEYVPDDNEEYSRGGNLAIIIGIHHLVPQGFFNVCHLSSTVFAQCIILLFFFSRVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g420
###
# start gene g421
Scaffold_13	AUGUSTUS	gene	924320	926225	0.19	-	.	g421
Scaffold_13	AUGUSTUS	transcript	924320	926225	0.19	-	.	g421.t1
Scaffold_13	AUGUSTUS	stop_codon	924320	924322	.	-	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_13	AUGUSTUS	CDS	924320	925259	0.52	-	1	transcript_id "g421.t1"; gene_id "g421";
Scaffold_13	AUGUSTUS	CDS	925318	926225	0.34	-	0	transcript_id "g421.t1"; gene_id "g421";
Scaffold_13	AUGUSTUS	start_codon	926223	926225	.	-	0	transcript_id "g421.t1"; gene_id "g421";
# protein sequence = [MSNIRKVLRTSSLPRAPNLLVTSADIAAYCHGKDPETKDVTEQDILKERYSQFRKDIPQSEKFRLALEKNQHLAGSEL
# LLPLLARLLVLKQYIAAVKNINGDLSQMQQKRRWLHLQLHPHLLSDNGREDLFKKLAGDLNKWFERQSLNLPQKIDIIESLSQSTVNGIMEALGLYNG
# ENPLYVVIDECQFAVTDMEDHFRSADWTAKRGILREIARWWDSILNQGSATLVGALIFTGTGLSRELISDVLSSVVMKPDYCTSVYDTGAFDDPKAQT
# AYLKRFFPPDIWQSSERLRNRMYYWMRGRYRFTAEYMSLVLQCGYQDMHQLLDQYIRSVACFRPADFEEPEKDFFGIVTLPTPAFGFDKLDQRMREKV
# KTIAHEYLFTSKLETCLGQDERAYIELGLARISGYNGQLSLKIDEPLVLLSCSVWFNEQRSHTVYKTLANRIQIHNPTTGRDGFEEFIAYYLLKVFEK
# SRKLNDVFDFEGADDNGLQNREAQLVTLHLDENQRLVEGKVSLARGTSSLFGPIGLAIGPEDHSTLYEWLNWKKQATFCFPMNCMGPDIMCFLKLKGQ
# GPGKNWGKFTYVCLAIQCKFYRAESLRPCTLRGAISTTTPGLFFAVS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g421
###
# start gene g422
Scaffold_13	AUGUSTUS	gene	926405	926768	0.68	-	.	g422
Scaffold_13	AUGUSTUS	transcript	926405	926768	0.68	-	.	g422.t1
Scaffold_13	AUGUSTUS	stop_codon	926405	926407	.	-	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_13	AUGUSTUS	CDS	926405	926700	0.84	-	2	transcript_id "g422.t1"; gene_id "g422";
Scaffold_13	AUGUSTUS	CDS	926750	926768	0.78	-	0	transcript_id "g422.t1"; gene_id "g422";
Scaffold_13	AUGUSTUS	start_codon	926766	926768	.	-	0	transcript_id "g422.t1"; gene_id "g422";
# protein sequence = [MALKKMESLCLDEATRLTSELKPQMEKFIRDEISLPIWEPSFDSPHLKIPENHKKFIHDLKIPRARGPHKHLPDMLRY
# ELGRFQQEDKLKERIVGLFTKEPTHK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g422
###
# start gene g423
Scaffold_13	AUGUSTUS	gene	931945	933111	0.75	+	.	g423
Scaffold_13	AUGUSTUS	transcript	931945	933111	0.75	+	.	g423.t1
Scaffold_13	AUGUSTUS	start_codon	931945	931947	.	+	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_13	AUGUSTUS	CDS	931945	933111	0.75	+	0	transcript_id "g423.t1"; gene_id "g423";
Scaffold_13	AUGUSTUS	stop_codon	933109	933111	.	+	0	transcript_id "g423.t1"; gene_id "g423";
# protein sequence = [MRVEKAHDRIEERLRQQKEHEEKAKILRAKAKLQQQSQPPQPQPDQRQPYPQQPRPHLPPQQAANPPPMPSPLVFHVT
# PPQPSPTPPRQPPSESIRREWARQEEILQEHRARRAHQARIAAGEIPPNTPLPQPLRPQWSLWEKARIGLDKVYQEVAEERKMREKKEREQREARRKQ
# EEEAARAAWAQQAQARAEEERRRKYTAEQQEQARMKAEWEDKIRRETALAEELKKAEEEKARRRAQAARETGTAGVQRSASIPFIPPQTDDPELFHWE
# MYDRRWAAIRREGVEFVPFPLRFDQLPWPVFHFKPTSVITIDDLLEDDIRFFVLNTKRPGYEGKEAKERLRAELLRYHPDKFGARVLPYVLEVTRRGR
# RLWRVRRGLQRFCTSY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g423
###
# start gene g424
Scaffold_13	AUGUSTUS	gene	937065	937502	0.49	-	.	g424
Scaffold_13	AUGUSTUS	transcript	937065	937502	0.49	-	.	g424.t1
Scaffold_13	AUGUSTUS	stop_codon	937065	937067	.	-	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_13	AUGUSTUS	CDS	937065	937502	0.49	-	0	transcript_id "g424.t1"; gene_id "g424";
Scaffold_13	AUGUSTUS	start_codon	937500	937502	.	-	0	transcript_id "g424.t1"; gene_id "g424";
# protein sequence = [MLTFVKFLSDAENMRIQAQQKLYFERQKQDGFEVCVITKLPLPRVDNKQMIMKGPGDRSTADVNMETADAEVEDSGKA
# ELRQCVQTLLANAKQKDLPGLADALIDAGWDRETLMDAHWDDIKGSYPEWQPATFVKLRTICVKWVA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g424
###
# start gene g425
Scaffold_13	AUGUSTUS	gene	943216	943778	0.45	+	.	g425
Scaffold_13	AUGUSTUS	transcript	943216	943778	0.45	+	.	g425.t1
Scaffold_13	AUGUSTUS	start_codon	943216	943218	.	+	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_13	AUGUSTUS	CDS	943216	943384	0.45	+	0	transcript_id "g425.t1"; gene_id "g425";
Scaffold_13	AUGUSTUS	CDS	943441	943778	0.94	+	2	transcript_id "g425.t1"; gene_id "g425";
Scaffold_13	AUGUSTUS	stop_codon	943776	943778	.	+	0	transcript_id "g425.t1"; gene_id "g425";
# protein sequence = [MPYLRALSTFRDGVRRLAIDKGDSALKDILALCDKLRDEELIPLGVALDDQEGTAIHGKALLKLAPPSELLKARDEKR
# AIALAKQAKKEAAKEAERLKRLERLAKGRVDPKEMFRPPNVKEGLYGSYDDSGVPMTDGEGKELSKSARKKLGKERETQVKLHEEYLTSL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g425
###
# start gene g426
Scaffold_13	AUGUSTUS	gene	944411	945328	0.57	-	.	g426
Scaffold_13	AUGUSTUS	transcript	944411	945328	0.57	-	.	g426.t1
Scaffold_13	AUGUSTUS	stop_codon	944411	944413	.	-	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_13	AUGUSTUS	CDS	944411	945328	0.57	-	0	transcript_id "g426.t1"; gene_id "g426";
Scaffold_13	AUGUSTUS	start_codon	945326	945328	.	-	0	transcript_id "g426.t1"; gene_id "g426";
# protein sequence = [MTALANIKPNLRITDITIPGTHDTCAISAVPWVATQNMTVIAQLNAGIRYFDLRCRLVGFLMMYHGDYALDMYLEHVL
# DDIYSWLRSHPAEGLIIQLSNEILHETDFAAFSLAATTLIVHGPNKDLWNTGVTVPFLSDIKGKIQLIRRYQVDQAKQQIGINATLWTENYNSPRFTI
# PTQDGTLVIQDQSSFSGAPDTIISQKFGVVATLMDQASADESHLNLYINYTSMTSTFPFRRGPVAPWQLAIGYEDIWCEFTPGVNRHLRQKLVVGGSA
# HYGVVVMDFPELPQYDMIDYLITSNFEAAAV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g426
###
# start gene g427
Scaffold_13	AUGUSTUS	gene	945420	946199	0.99	-	.	g427
Scaffold_13	AUGUSTUS	transcript	945420	946199	0.99	-	.	g427.t1
Scaffold_13	AUGUSTUS	stop_codon	945420	945422	.	-	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_13	AUGUSTUS	CDS	945420	946199	0.99	-	0	transcript_id "g427.t1"; gene_id "g427";
Scaffold_13	AUGUSTUS	start_codon	946197	946199	.	-	0	transcript_id "g427.t1"; gene_id "g427";
# protein sequence = [MFPGGKGPARGSPALAVHNGELWCLWLDKNDGLLYHATSDNQSWGPKTAFVGNYWTGLVPDNPTAGPALADCNGVLHA
# AYSVDGSLVHYQYDDIAKKWGKRSLFARSSATPSLQTFDGRLFCAFQGDGNSLNWTTWDPEDGWMRPMSANEKTWGSPALYLLLDRLCLLFAENNDDR
# HTTNTTFNTSTKSWSRTFGSPSQKTAYGVSATGFNKDIALMAFQSHDDNDKGLVLVDTLITALGNITSPLVLFFRHPSNSHPQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g427
###
# start gene g428
Scaffold_13	AUGUSTUS	gene	947491	948495	0.55	+	.	g428
Scaffold_13	AUGUSTUS	transcript	947491	948495	0.55	+	.	g428.t1
Scaffold_13	AUGUSTUS	start_codon	947491	947493	.	+	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_13	AUGUSTUS	CDS	947491	948495	0.55	+	0	transcript_id "g428.t1"; gene_id "g428";
Scaffold_13	AUGUSTUS	stop_codon	948493	948495	.	+	0	transcript_id "g428.t1"; gene_id "g428";
# protein sequence = [MSLVTHENASQRAGWKVMPSGRVVRTMKMRPGKPLPPLPAQTKDSKDGKKKKKVKTPDTRARSKTIDVTKWDGSYVTG
# VFLGGDEVLPIAQLREGLHGVVEERVQDKEKEEKERKQKKKEKKEKKQQDKDMKEKKKNVNILEIVDVQALPDPLVPEAQSKPLSAPTVTTTTAPSHE
# DPSHSVDLLTEKAQTLSLLNSFLFSSKSKHDNIPVDWDSDVDLDEANVIEVRNPAKDVDEGYEIVPRADENEMDVDVNQGPDNDEREDEEESDDSDSS
# DDTQEETPMQVEEKTQPPRPKINPLKDLFAPREDEGANFYPYDVLLYPLFSNSTHLIYLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g428
###
# start gene g429
Scaffold_13	AUGUSTUS	gene	952176	953012	0.53	+	.	g429
Scaffold_13	AUGUSTUS	transcript	952176	953012	0.53	+	.	g429.t1
Scaffold_13	AUGUSTUS	start_codon	952176	952178	.	+	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_13	AUGUSTUS	CDS	952176	952368	0.75	+	0	transcript_id "g429.t1"; gene_id "g429";
Scaffold_13	AUGUSTUS	CDS	952447	952479	0.55	+	2	transcript_id "g429.t1"; gene_id "g429";
Scaffold_13	AUGUSTUS	CDS	952627	953012	0.74	+	2	transcript_id "g429.t1"; gene_id "g429";
Scaffold_13	AUGUSTUS	stop_codon	953010	953012	.	+	0	transcript_id "g429.t1"; gene_id "g429";
# protein sequence = [MWLANDGNYRELRYFTPWTKHRQVEDHFLPRIIQVVTGQVHNSSVDSFKEYLILFLDQSTLRRRDFKFYIPPEGFSFS
# PTYFGLQLGGVYLYSNQQGCDGDRLYYDGCALIAVNGRIVAQGSQFSLNDVEVVTATIDIEDVRSHRAKSSRSMQAAQAEKYPRIEVPFALSLGKFEE
# VREEDMIGFLSTKTMEVRYHRPEEEIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g429
###
# start gene g430
Scaffold_13	AUGUSTUS	gene	974482	974889	0.71	-	.	g430
Scaffold_13	AUGUSTUS	transcript	974482	974889	0.71	-	.	g430.t1
Scaffold_13	AUGUSTUS	stop_codon	974482	974484	.	-	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_13	AUGUSTUS	CDS	974482	974889	0.71	-	0	transcript_id "g430.t1"; gene_id "g430";
Scaffold_13	AUGUSTUS	start_codon	974887	974889	.	-	0	transcript_id "g430.t1"; gene_id "g430";
# protein sequence = [MEAKGCAKPAIWKDARRKFYWAVRARVARSAALAELTEASPGSTTEYRSHLLDSLASIDAAMNDREMSETLEKLDLSQ
# TVSQLKADYLMRRMVELTKEDRKAAMNGFARLADNLSDEERNSLISVLQNATRSPGS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g430
###
# start gene g431
Scaffold_13	AUGUSTUS	gene	974951	977562	0.52	-	.	g431
Scaffold_13	AUGUSTUS	transcript	974951	977562	0.52	-	.	g431.t1
Scaffold_13	AUGUSTUS	stop_codon	974951	974953	.	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_13	AUGUSTUS	CDS	974951	975499	0.86	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_13	AUGUSTUS	CDS	975592	977562	0.55	-	0	transcript_id "g431.t1"; gene_id "g431";
Scaffold_13	AUGUSTUS	start_codon	977560	977562	.	-	0	transcript_id "g431.t1"; gene_id "g431";
# protein sequence = [MPEDAWFEKLTAFVNEQSSTLRERGVGRVSIMLCRPSQYPVYLTLREVDRVWTEEQSIRNIEPALAFQLELSRLSNYK
# LKPVFVESKQIHIYHAVARENQLDNRFFVRALVRPGRLRGSMSTAEYLISETDRLVTTVLDALELVTAEQRNTDCNHIFLNFIYNLAVTYEDVLAAIS
# GFIERHGKRLWRLHVTGSEIRIALEDDEGNVTPIRCVIENVSGFIVNYHGYQEITTDKGTTILKSIGEKGPLHLQPVHQAYSTKESLQPKRYQAHLIG
# TTYVYDFPDLFSKALQNLWDSARATSPTLVKPRVLLESKELVLDEHDQLAEVDRAPGNNTFGMIGWVFTMRTPEFPQGRRVVVVANDITYKIGSFGPI
# EDQFFYLVTQYARELGLPRIYLSANSGARIGLAEELIPLFSAAWNEEGHPEKGVHYLYLTHENYLKLEEQGHDSIKTVDVEVAGELRHKITDIIGLQD
# GLGVESLKGSGLIAGETSRAYDDIFTITLVTARSVGIGAYLVRLGERAVQVEGQPIILTGAGALNKVLGREVYTSNLQLGGTQIMFKNGVSHLTASSD
# LEGATHILKWLSYVPEVKDGALPVLESSDSWDRDIGYTPPKGAYDPRWFIEGKTDEATSEWMSGFFDKGSFQETLSGWRRQLSLGGLGLRIMEAGQVW
# YPNSAYKTAQAIFDFNREGLPLIIFANWRGFSGGQQDMYDEVLKQGSKIVDGLSSYKQPIFVYIVPNGELRGGAWVVLDPSINSEQMEMYADVDARAG
# VLEPEGIVEIKFRQNKITALMERLDTEYASLKRESKDATKTAESRSAATAALERREVILQPTYKQIALLYADLHE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g431
###
# start gene g432
Scaffold_13	AUGUSTUS	gene	978577	980287	0.65	-	.	g432
Scaffold_13	AUGUSTUS	transcript	978577	980287	0.65	-	.	g432.t1
Scaffold_13	AUGUSTUS	stop_codon	978577	978579	.	-	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_13	AUGUSTUS	CDS	978577	979212	1	-	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_13	AUGUSTUS	CDS	979268	980287	0.65	-	0	transcript_id "g432.t1"; gene_id "g432";
Scaffold_13	AUGUSTUS	start_codon	980285	980287	.	-	0	transcript_id "g432.t1"; gene_id "g432";
# protein sequence = [MVSGVNLPAAQLQVAMGIPLHRIRHIRQLYGVAPNAASEIDFDMIKPDANQLQRKPRPKGHVVAVRITAENPDAGFKP
# SSGSLQELNFRSSTNVWGYFSVSSAGGLHEFADSQFGHIFAYGEDRGESRKNMIIALKELSIRGDFRTTVEYLIKLLELDDFKDNTITTGWLDSLISD
# KLTAERPDATLAVICGAVTKAYLASEACWTEYKRILDKGQVPARDVLKTVFVIDFIYENVRYSFTAARSSSTAWTLYLNGGSTMVGARPLADGGLLVL
# LDGRSHSIYWREEVGALRLMVDAKTCLIEQENDPTQLRSPSPGKLIRFFVDSGEHINAGEQYAEIEVMKMYMPLVASEDGIVQLIKQPGVSLEPGDIL
# GILTLDDPGRVKHAKPFEGLLPTMGTPAVTGSKPHQRFIRCLGVLNDILDGFDNQAIMASTVKDLIDILHDPELPYSELTAILSSLSGRIPAKLDDSI
# HAALETAKAKGEFPAARIKKVLENFVESSVLPQDRPMFRTQLGAIYDVLDRFTGGLKGHEIKVWSNLLRNTRLQKECWRKY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g432
###
# start gene g433
Scaffold_13	AUGUSTUS	gene	980665	981276	0.98	-	.	g433
Scaffold_13	AUGUSTUS	transcript	980665	981276	0.98	-	.	g433.t1
Scaffold_13	AUGUSTUS	stop_codon	980665	980667	.	-	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_13	AUGUSTUS	CDS	980665	981276	0.98	-	0	transcript_id "g433.t1"; gene_id "g433";
Scaffold_13	AUGUSTUS	start_codon	981274	981276	.	-	0	transcript_id "g433.t1"; gene_id "g433";
# protein sequence = [MATPEDLKVNAEYIRMADRYIEVPGGSNNNNYANVDLIVDVAERAGVHAVWAGWGHASENPRLPESLAASKNKIVFIG
# PPGSAMRSLGDKISSTIVAQSANVPTMPWSGTGITDTALSEAGYVIVPDKAYQDACVTSVEEGLVKAEEIGWPVMIKASEGGGGKGIRKVEQPEAFKN
# AYHAVAGEIPGRQICNLSYSHVHPFWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g433
###
# start gene g434
Scaffold_13	AUGUSTUS	gene	986224	986643	0.6	-	.	g434
Scaffold_13	AUGUSTUS	transcript	986224	986643	0.6	-	.	g434.t1
Scaffold_13	AUGUSTUS	stop_codon	986224	986226	.	-	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_13	AUGUSTUS	CDS	986224	986643	0.6	-	0	transcript_id "g434.t1"; gene_id "g434";
Scaffold_13	AUGUSTUS	start_codon	986641	986643	.	-	0	transcript_id "g434.t1"; gene_id "g434";
# protein sequence = [MTDKLDAPTSSSTDAGSGKGAPDGASVPKAIIKNVDMSEEMQQESVDIASAALEKYNIEKDIAAQIKKEFDRRHGPTW
# HVVVGKNFGSYVTHGELQIMTLPWPLSIDDLCIHQYSSPFYGSRSSNHPAFSVSILFSLFD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g434
###
# start gene g435
Scaffold_13	AUGUSTUS	gene	991092	992019	0.27	+	.	g435
Scaffold_13	AUGUSTUS	transcript	991092	992019	0.27	+	.	g435.t1
Scaffold_13	AUGUSTUS	start_codon	991092	991094	.	+	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_13	AUGUSTUS	CDS	991092	991247	0.87	+	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_13	AUGUSTUS	CDS	991705	992019	0.5	+	0	transcript_id "g435.t1"; gene_id "g435";
Scaffold_13	AUGUSTUS	stop_codon	992017	992019	.	+	0	transcript_id "g435.t1"; gene_id "g435";
# protein sequence = [MSSSTSSHHNPNLNNWGNSNTGSGLGSSTLGTSSFGDSLSQSRSHYQSGYLMSSMSQPSMFSSTRTRTPPAPRSSSSA
# PLYVIVFGYPADKYSVTVEYFKSLGDTTDADPNTEIVNCFRIGYHDPGEAMRAVRKNGEILGGSWMVGAKWAVRAFVL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g435
###
# start gene g436
Scaffold_13	AUGUSTUS	gene	992674	993102	0.96	-	.	g436
Scaffold_13	AUGUSTUS	transcript	992674	993102	0.96	-	.	g436.t1
Scaffold_13	AUGUSTUS	stop_codon	992674	992676	.	-	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_13	AUGUSTUS	CDS	992674	993102	0.96	-	0	transcript_id "g436.t1"; gene_id "g436";
Scaffold_13	AUGUSTUS	start_codon	993100	993102	.	-	0	transcript_id "g436.t1"; gene_id "g436";
# protein sequence = [MSDPTGPHSRSPSSGPTPARQQQRSQSRRRGRSQTARSLSASGDDSDASSASSLARRRRRGGGRKGGGLPGVEEVEDT
# GNQVANTAKNAVGQVGQVAGGGKKQDDDEGSGGDKPLKLRLDLNLDVAVELKARVHGDLTLSLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g436
###
# start gene g437
Scaffold_13	AUGUSTUS	gene	993654	994156	0.33	+	.	g437
Scaffold_13	AUGUSTUS	transcript	993654	994156	0.33	+	.	g437.t1
Scaffold_13	AUGUSTUS	start_codon	993654	993656	.	+	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_13	AUGUSTUS	CDS	993654	993848	0.36	+	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_13	AUGUSTUS	CDS	993938	994156	0.55	+	0	transcript_id "g437.t1"; gene_id "g437";
Scaffold_13	AUGUSTUS	stop_codon	994154	994156	.	+	0	transcript_id "g437.t1"; gene_id "g437";
# protein sequence = [MSQSDIHEFQNPADIDIPKTGAGMGSVAGGGSSTTGDSRTEEQKEADNKLAERLSALIEDANSRVHIENMDARKDDDK
# DEDELIRQVKPLLQQAEKILGETEGMVKGADPDNRLSNRPNVMPNLILQRQKNSDLQLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g437
###
# start gene g438
Scaffold_13	AUGUSTUS	gene	995102	995995	0.6	-	.	g438
Scaffold_13	AUGUSTUS	transcript	995102	995995	0.6	-	.	g438.t1
Scaffold_13	AUGUSTUS	stop_codon	995102	995104	.	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_13	AUGUSTUS	CDS	995102	995995	0.6	-	0	transcript_id "g438.t1"; gene_id "g438";
Scaffold_13	AUGUSTUS	start_codon	995993	995995	.	-	0	transcript_id "g438.t1"; gene_id "g438";
# protein sequence = [MMKTELEEFVSRQDPLEVDADGQYATQGGAGILFQMVNQQIDLATESGQGAILARVVAESNRVMRGMQEQWVKTVEQE
# YKKQVEKPEEIAPGLVEYVIALANDMLKSADYAEALLARLEPLVSEKYRVQMNEKLNDAIDGYLDVAKKCTQTLIDMIFNDLKPVTKNLFQPPWYDGI
# LAQIVETIRDYMDDYKEFLNPSLFELLVEDLIDAFLLVYLNALANSPKLKIPAATERIKDDVDDAFRLFLNYKSQKDMEEYFEVLDLILGILEASKEI
# VFLSVLVLCQEARAQSCFCGGID]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g438
###
# start gene g439
Scaffold_13	AUGUSTUS	gene	996538	997298	0.99	-	.	g439
Scaffold_13	AUGUSTUS	transcript	996538	997298	0.99	-	.	g439.t1
Scaffold_13	AUGUSTUS	stop_codon	996538	996540	.	-	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_13	AUGUSTUS	CDS	996538	996923	0.99	-	2	transcript_id "g439.t1"; gene_id "g439";
Scaffold_13	AUGUSTUS	CDS	997013	997298	0.99	-	0	transcript_id "g439.t1"; gene_id "g439";
Scaffold_13	AUGUSTUS	start_codon	997296	997298	.	-	0	transcript_id "g439.t1"; gene_id "g439";
# protein sequence = [MAAAPVSAAQAIGEYLQSPDDLVKVSAYRKKLEKEKASIDARLKSGVKEQLQATREGLRKLLSTRANVQAIKDEMVII
# DRECSDPQTQVATFDQIKEMVNNLLDMESKLSEIGYMLDDDSANITGPAPNLLVIHYYLKQLEAFRNQTMHQAKKASSDARIYLVRRFERLHTVIEQF
# DQYIIDLAGNVLDIVREGNGHVIVRLIKIAEMEGREDEKVDLEYLYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g439
###
# start gene g440
Scaffold_13	AUGUSTUS	gene	998238	998999	0.62	+	.	g440
Scaffold_13	AUGUSTUS	transcript	998238	998999	0.62	+	.	g440.t1
Scaffold_13	AUGUSTUS	start_codon	998238	998240	.	+	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_13	AUGUSTUS	CDS	998238	998999	0.62	+	0	transcript_id "g440.t1"; gene_id "g440";
Scaffold_13	AUGUSTUS	stop_codon	998997	998999	.	+	0	transcript_id "g440.t1"; gene_id "g440";
# protein sequence = [MVSQIGADGPNSPVRSFAKIPSYGWSYDTQAIVCTMEHPPKGPFLGPNTTAYQRFLPTGPIAFLPISATVSSLVWSTK
# PALSTALKACDPSVLARMINAAFRLPDVSIRYLHGRILEAHEAGNPMTDEEINAEIVWREKSHSIDATSAYSSITPDVSSNTRVPPSDSEMVPPIVTS
# IQAGTIASFPLRYAHTETYTGEGLGSRTVLVGDAAHTIHPLAGQGLNLGLGDVECLARCITEAVLRGGDIGSSLFNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g440
###
# start gene g441
Scaffold_13	AUGUSTUS	gene	999095	999478	0.87	+	.	g441
Scaffold_13	AUGUSTUS	transcript	999095	999478	0.87	+	.	g441.t1
Scaffold_13	AUGUSTUS	start_codon	999095	999097	.	+	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_13	AUGUSTUS	CDS	999095	999478	0.87	+	0	transcript_id "g441.t1"; gene_id "g441";
Scaffold_13	AUGUSTUS	stop_codon	999476	999478	.	+	0	transcript_id "g441.t1"; gene_id "g441";
# protein sequence = [MSACDKLHKIYGTSSGPLVQLRSVGLEVLNELDSIKAAIMMSAGSVSQTNDKYLSYNGDFRTMVFNVAAKGVENINTV
# AQVAQIIRGGRGACGECDTEFGQSYVLLSAASEGCVIAQTMCHSTLQDC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g441
###
# start gene g442
Scaffold_13	AUGUSTUS	gene	1002703	1003032	0.54	-	.	g442
Scaffold_13	AUGUSTUS	transcript	1002703	1003032	0.54	-	.	g442.t1
Scaffold_13	AUGUSTUS	stop_codon	1002703	1002705	.	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_13	AUGUSTUS	CDS	1002703	1003032	0.54	-	0	transcript_id "g442.t1"; gene_id "g442";
Scaffold_13	AUGUSTUS	start_codon	1003030	1003032	.	-	0	transcript_id "g442.t1"; gene_id "g442";
# protein sequence = [MRVPPPKLVTSSSGTDGSTSGSILSARVTSQKAKIWTGEDAIPTTGTGDELSMGIRYVTALGGDSYLMSDADVRPGSS
# YTVSTHLQSTYSLDAPDHDRSGVNRAYYTGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g442
###
# start gene g443
Scaffold_13	AUGUSTUS	gene	1003413	1005233	1	-	.	g443
Scaffold_13	AUGUSTUS	transcript	1003413	1005233	1	-	.	g443.t1
Scaffold_13	AUGUSTUS	stop_codon	1003413	1003415	.	-	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_13	AUGUSTUS	CDS	1003413	1005233	1	-	0	transcript_id "g443.t1"; gene_id "g443";
Scaffold_13	AUGUSTUS	start_codon	1005231	1005233	.	-	0	transcript_id "g443.t1"; gene_id "g443";
# protein sequence = [MLSHFLSFFLASALIPLSASLSVQIPLDNQFPPVAHVGQPYSWTFPNNTFDYASDSTPPTHTVSPLPDWLSFNPVTRT
# FSGTPSQADQGEPEITVTAHIGDASNSTKCNILITTSPALTLNQPISAQLYEGNPSLSSVFTVSNNSAIYTGNPTIRVPHKWSFSVGFSSETFMNSQD
# NAHYTVLQSDKSPIPYKMEFTQGPDTLGGTAPLLEEVGSTATFHLELIGIVSGGYSDGSLPFDMVIADHELSMDSNSLPIVNITRDANFTLNFGSTGD
# LAGVLVDGEAINPSDILELSIDTSSCGWLQWDGVSRLLTGSTVGQDFNSSTGPHLPVTLTTTFNQTIRTILPLAIEPSFFTTGTFPAYAIPETGLASF
# DIHPYLSNVTGEKPADVNMSIAVEPSSAASCLTFNSTSLVVEGTVTGDCQVSNISVTIAAYSHVTHSTSHATLPMTDSFKKSSGTPHHPGSLSFSAHK
# KLILGISIAFGIVGLSALGTFLASVRRCLRVQDPVWLPSNVNEICLKVTKVVRSSCGEVPRWMESRIHSPYGEAASRDGLLRSPRNYGNIGLGLDPSN
# EVTQGIYVTFERCWKQVSKSRCMKKGDFMNRIRETVRT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g443
###
# start gene g444
Scaffold_13	AUGUSTUS	gene	1005570	1008324	0.22	-	.	g444
Scaffold_13	AUGUSTUS	transcript	1005570	1008324	0.22	-	.	g444.t1
Scaffold_13	AUGUSTUS	stop_codon	1005570	1005572	.	-	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_13	AUGUSTUS	CDS	1005570	1006211	1	-	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_13	AUGUSTUS	CDS	1006266	1006617	0.92	-	1	transcript_id "g444.t1"; gene_id "g444";
Scaffold_13	AUGUSTUS	CDS	1007063	1007285	0.58	-	2	transcript_id "g444.t1"; gene_id "g444";
Scaffold_13	AUGUSTUS	CDS	1007367	1008324	0.44	-	0	transcript_id "g444.t1"; gene_id "g444";
Scaffold_13	AUGUSTUS	start_codon	1008322	1008324	.	-	0	transcript_id "g444.t1"; gene_id "g444";
# protein sequence = [MKMLPLEYVVIDAYIYGILLTILNQSALRIIDGLATNLPPMQVFPALRTLIVQYFSSQDPAQRRGAMLALGIAVEGCS
# EFMTPLMGEVWPIIEAGLQDIDASVRKATCIAVSCFCEWLEEECVAKHTVLIPVRLPNFVTRISLIFVQAIMNLINDSATQRSACTALDALLEILADV
# IDQYLQLIMERLSGLLETAPIPVKSVVTGAIGSAAHASKEKFIPYFEPTMQRLQHFLVLTGEGEEIELRGITMDAVGTFAEAVGKDHFRPYFPTMMTQ
# AFEGIEMGSARLRECSFLFFGVMARVFGDEFAGYLPQVVPPLIASFTTSDPNSAFNSGLSASNAIPVSDEADVNGLPTEELEDVDLDKLLDVNSAIAV
# EKEIAADTIGMLFNATQAHFLPSVVSALCVHLAETINKIGLLLLKDVSQVISRFFAYLVTVLSELEPICGIAIQILEQKAFCQQDPDQDEEEEAPEAQ
# AEYDSVLVSSAGDLVAALANALGGDFAPAFGRFFPLIAKYYKKNRSLSDRSSAIGCLAEIIAGMKNAVSPSTEPLLELFYQALSDTDAEVLSNAAFAV
# GLLTEYSEVDLSPQYLHLLGALRPLFVVTSDSPASKLNAKDNAAGAVARLIVRNTAAVPLDQVLPVFVEALPLKNDYLENRPVFRAIFHLVQTNGAVL
# GPYMDQLLRVFAVVLDPNGPDQVGDDIRAELIQLIGVVNAQDPAKIQAAGLSAFVPGA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g444
###
# start gene g445
Scaffold_13	AUGUSTUS	gene	1016878	1017282	0.49	-	.	g445
Scaffold_13	AUGUSTUS	transcript	1016878	1017282	0.49	-	.	g445.t1
Scaffold_13	AUGUSTUS	stop_codon	1016878	1016880	.	-	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_13	AUGUSTUS	CDS	1016878	1017282	0.49	-	0	transcript_id "g445.t1"; gene_id "g445";
Scaffold_13	AUGUSTUS	start_codon	1017280	1017282	.	-	0	transcript_id "g445.t1"; gene_id "g445";
# protein sequence = [MNGGRPSSGSGQRLLDERESERDRDRDRNQASTMPSVSGLNFQAHNGIAISLSASSSRPPSWNEIDCGLVHQSLIPIL
# SASWMGVVDVDSATGAARGSLQNINLGQKPQTEADFDQLLSVHWSLATVLKFVKLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g445
###
# start gene g446
Scaffold_13	AUGUSTUS	gene	1019516	1020049	0.21	-	.	g446
Scaffold_13	AUGUSTUS	transcript	1019516	1020049	0.21	-	.	g446.t1
Scaffold_13	AUGUSTUS	stop_codon	1019516	1019518	.	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_13	AUGUSTUS	CDS	1019516	1020049	0.21	-	0	transcript_id "g446.t1"; gene_id "g446";
Scaffold_13	AUGUSTUS	start_codon	1020047	1020049	.	-	0	transcript_id "g446.t1"; gene_id "g446";
# protein sequence = [MDIEVNVDDTTARNFKSKLTKVAAFKDETLEPEEGTSFADVSKVMLDPDPDPSDKSDAEPEPDVEVDVEPDVDAPFDV
# SDGEDEKEDDDDEGEGEDEKDDADELEVDEVQEDDDKDDEDKDDEEKEVSDKEDVEKDIDDDDRSEINLRMKRRNSIFNLSIELKLLTCLPSLSSSLL
# C]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g446
###
# start gene g447
Scaffold_13	AUGUSTUS	gene	1020397	1021407	0.15	-	.	g447
Scaffold_13	AUGUSTUS	transcript	1020397	1021407	0.15	-	.	g447.t1
Scaffold_13	AUGUSTUS	stop_codon	1020397	1020399	.	-	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_13	AUGUSTUS	CDS	1020397	1021407	0.15	-	0	transcript_id "g447.t1"; gene_id "g447";
Scaffold_13	AUGUSTUS	start_codon	1021405	1021407	.	-	0	transcript_id "g447.t1"; gene_id "g447";
# protein sequence = [MDSELCVEPAENWDDDLEFQGQGQQNTQNTDGSRNKKNRNKNKSPPHSPHTPYPRRTRNPSSPSSPSKPRISMSTTSS
# QVTMEAEDWDLETPAPTPVHSRNSAHSYSNQQHQQQTRTWIEWTEAGPSIPTRRLVSSGSGSLRETEKTTTTENWDEDFEDRVDSPPRSPYSLGSPGS
# PTGKKRKDGNERRKSSTTTTTTRKTTTTENWDDELQLGDSPARSMRNRHPQHPVHQHSFNEEEDSDDDDEADFNFHGSDKDEDDKTVTARSRRAALSR
# LVSNSSSSSPPPVPPLPFSLLPIPPQHSASSDHDHEHVFPDSPTTSVFSVPTSHSGGTDRRR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g447
###
# start gene g448
Scaffold_13	AUGUSTUS	gene	1027901	1028668	1	+	.	g448
Scaffold_13	AUGUSTUS	transcript	1027901	1028668	1	+	.	g448.t1
Scaffold_13	AUGUSTUS	start_codon	1027901	1027903	.	+	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_13	AUGUSTUS	CDS	1027901	1028668	1	+	0	transcript_id "g448.t1"; gene_id "g448";
Scaffold_13	AUGUSTUS	stop_codon	1028666	1028668	.	+	0	transcript_id "g448.t1"; gene_id "g448";
# protein sequence = [MESANQNSNDLGVTAATPAITISPPIINGTQQPPSGSGSTNPTAGNVATSSHPLTVAGPSDGGLTGDGRFDKAPSTGF
# NYSSGQRPTESNKTVNLPVQAPRPEHYGSAMGSNNGDHAAKKMKTEDGNARRQYLPTGTGMSGQMGGSYTGSERNDTPGVINPKKRKAAADSNTGASP
# LALPPHFNMTASSSSADRAQSSSPRPPPAAYPRQNFSNTSGTNNSHLNTTPQAGPSNYQNTSYSSRNPFAPSPTAGNDM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g448
###
#
# ----- prediction on sequence number 4 (length = 805900, name = Scaffold_16) -----
#
# Predicted genes for sequence number 4 on both strands
# start gene g449
Scaffold_16	AUGUSTUS	gene	747	2369	0.8	-	.	g449
Scaffold_16	AUGUSTUS	transcript	747	2369	0.8	-	.	g449.t1
Scaffold_16	AUGUSTUS	stop_codon	747	749	.	-	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_16	AUGUSTUS	CDS	747	2369	0.8	-	0	transcript_id "g449.t1"; gene_id "g449";
Scaffold_16	AUGUSTUS	start_codon	2367	2369	.	-	0	transcript_id "g449.t1"; gene_id "g449";
# protein sequence = [MEARGMDLTESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIRKYLSNPSDESLGEMSKDERIK
# FIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMH
# TPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNS
# QANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNS
# FIEKVRRRVDANKVAELRRFERKYRHTIKNWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTR
# NEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMAPENDYIFDAIPHLRLSDTDSDEELSEGEDVKIMYTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g449
###
# start gene g450
Scaffold_16	AUGUSTUS	gene	2910	3827	0.74	-	.	g450
Scaffold_16	AUGUSTUS	transcript	2910	3827	0.74	-	.	g450.t1
Scaffold_16	AUGUSTUS	stop_codon	2910	2912	.	-	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_16	AUGUSTUS	CDS	2910	3827	0.74	-	0	transcript_id "g450.t1"; gene_id "g450";
Scaffold_16	AUGUSTUS	start_codon	3825	3827	.	-	0	transcript_id "g450.t1"; gene_id "g450";
# protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNIPFEWNEKCDKAMDELKDGIRDCPAL
# RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRHLTVETDASYIKGMLDNPSCGPN
# ATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPELNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDI
# ELDVQEALDEERSYEIRRNHMLESVKIMYTV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g450
###
# start gene g451
Scaffold_16	AUGUSTUS	gene	4677	6387	0.51	-	.	g451
Scaffold_16	AUGUSTUS	transcript	4677	6387	0.51	-	.	g451.t1
Scaffold_16	AUGUSTUS	stop_codon	4677	4679	.	-	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_16	AUGUSTUS	CDS	4677	5298	1	-	1	transcript_id "g451.t1"; gene_id "g451";
Scaffold_16	AUGUSTUS	CDS	5391	5631	0.54	-	2	transcript_id "g451.t1"; gene_id "g451";
Scaffold_16	AUGUSTUS	CDS	5706	6387	0.92	-	0	transcript_id "g451.t1"; gene_id "g451";
Scaffold_16	AUGUSTUS	start_codon	6385	6387	.	-	0	transcript_id "g451.t1"; gene_id "g451";
# protein sequence = [MTIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQG
# SQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSH
# KRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDSKGNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKT
# IGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPS
# FEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKAT
# LPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTERGKKDYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g451
###
# start gene g452
Scaffold_16	AUGUSTUS	gene	7168	7791	0.53	-	.	g452
Scaffold_16	AUGUSTUS	transcript	7168	7791	0.53	-	.	g452.t1
Scaffold_16	AUGUSTUS	stop_codon	7168	7170	.	-	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_16	AUGUSTUS	CDS	7168	7791	0.53	-	0	transcript_id "g452.t1"; gene_id "g452";
Scaffold_16	AUGUSTUS	start_codon	7789	7791	.	-	0	transcript_id "g452.t1"; gene_id "g452";
# protein sequence = [MEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLC
# KSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRI
# EELSDRLGNLEAHRERRCVRVFNQDSSNGKK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g452
###
# start gene g453
Scaffold_16	AUGUSTUS	gene	7832	8680	0.96	-	.	g453
Scaffold_16	AUGUSTUS	transcript	7832	8680	0.96	-	.	g453.t1
Scaffold_16	AUGUSTUS	stop_codon	7832	7834	.	-	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_16	AUGUSTUS	CDS	7832	8680	0.96	-	0	transcript_id "g453.t1"; gene_id "g453";
Scaffold_16	AUGUSTUS	start_codon	8678	8680	.	-	0	transcript_id "g453.t1"; gene_id "g453";
# protein sequence = [MECLRCQLKLRLRLIKPVRNFQESIRQHHLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALR
# VFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLET
# VVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIK
# LESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g453
###
# start gene g454
Scaffold_16	AUGUSTUS	gene	25838	27764	0.29	+	.	g454
Scaffold_16	AUGUSTUS	transcript	25838	27764	0.29	+	.	g454.t1
Scaffold_16	AUGUSTUS	start_codon	25838	25840	.	+	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_16	AUGUSTUS	CDS	25838	26461	0.29	+	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_16	AUGUSTUS	CDS	27420	27764	0.89	+	0	transcript_id "g454.t1"; gene_id "g454";
Scaffold_16	AUGUSTUS	stop_codon	27762	27764	.	+	0	transcript_id "g454.t1"; gene_id "g454";
# protein sequence = [MELAASEEKKKRAAVAAGVIDTRKRPTTEADRTDVKRVKLEAEPLAPDPSLSLLASFDFSTLPATLITDLIVANLEAF
# TEPALVSLVQVYRQRLGIGTVSTSVPPAPAATASGSVPVAAPTVPAVSDIKSVGKDIARPPTIEPSTTTPAPPIKEEPVDPLQMDIDQDELEYEPDRL
# NEEVFFFVSMLELQTDSCKAFRSSAFVKNRATPMDSMIREFALQILRKLQREPVQEALAESNGDSTEFNVNGDSAPTVAEEGSSTEKKRATKVTDELE
# EGEDENMEDGQLPAEDLLQTPYLPERIETTKQRRVMFYSTLNFYLHCR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g454
###
# start gene g455
Scaffold_16	AUGUSTUS	gene	31258	32202	0.33	+	.	g455
Scaffold_16	AUGUSTUS	transcript	31258	32202	0.33	+	.	g455.t1
Scaffold_16	AUGUSTUS	start_codon	31258	31260	.	+	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_16	AUGUSTUS	CDS	31258	32202	0.33	+	0	transcript_id "g455.t1"; gene_id "g455";
Scaffold_16	AUGUSTUS	stop_codon	32200	32202	.	+	0	transcript_id "g455.t1"; gene_id "g455";
# protein sequence = [MLSFDPDERITVFEALEHPWLASYHDVTDEPECKQPFDAWRYIETLETMDDFRNALWKEIQEYRQEVRGVNDLSGMPI
# RTVSGSRGTDVEKRVSGVHEHPEHPEAEIIVEEAASEGQPTTLTEEPDELEPEAVKLATEDSYLPPPPSSQNNRWSAPVTPTDPVVTYARRSSIMQAP
# RQGSTFNTPFPSSQHIPSYSESSTASSSVAFPSRGEGYVLPARSRTGSIAGGEVTRRLLRTLSTVSIYESGEGLAGGLADLAPIGRYIVDRQTTEADA
# PASEMPREFGINEADEDAWDEKSGSEREKRANSSSVTVKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g455
###
# start gene g456
Scaffold_16	AUGUSTUS	gene	32881	33480	0.99	-	.	g456
Scaffold_16	AUGUSTUS	transcript	32881	33480	0.99	-	.	g456.t1
Scaffold_16	AUGUSTUS	stop_codon	32881	32883	.	-	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_16	AUGUSTUS	CDS	32881	33480	0.99	-	0	transcript_id "g456.t1"; gene_id "g456";
Scaffold_16	AUGUSTUS	start_codon	33478	33480	.	-	0	transcript_id "g456.t1"; gene_id "g456";
# protein sequence = [MDVDICGPSIPTILGIASEQVHSSSTGWSPVYVQDNLGVMSVGFMLPSSRDAVMWRGPKKNGLISQFLKDVDWGDLDY
# LVVDTPPGTSDEHLSIVQFLKESGIDGAVLITTPQEVALQDVHREIDFCKKVGIRILGIVENMSGFVCPSCKTESQIFKPSTGGAKRLAEETGIELLG
# AVPLDPRIGKSADYGVSFLDEYP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g456
###
# start gene g457
Scaffold_16	AUGUSTUS	gene	39479	40930	0.91	-	.	g457
Scaffold_16	AUGUSTUS	transcript	39479	40930	0.91	-	.	g457.t1
Scaffold_16	AUGUSTUS	stop_codon	39479	39481	.	-	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_16	AUGUSTUS	CDS	39479	40930	0.91	-	0	transcript_id "g457.t1"; gene_id "g457";
Scaffold_16	AUGUSTUS	start_codon	40928	40930	.	-	0	transcript_id "g457.t1"; gene_id "g457";
# protein sequence = [MSEIFVHCLEPVSCPDGGESCRPHTQSSGIPFVLSQVCRQWRTVALSTPALWTFLNVVIPFANDLGTVYPNFINCCLE
# RSRILPLHIVLCAFDQGDEETDGKDTFQIISRTINRLIPECSRWESFELMINANPWVDISIPSFCPISPTGTPTLRSIKFCNQWGRFPSLAAWISDLM
# RSSPNLRNIRLDSGKGIQFADISWFHLQTSKVEEIKLKDLFILFENCPELRTCTACLFSPVHLVIVSSPEIVLNHLHTLILTYAEESDLKAAFCWLTL
# PALKKLILNGLCNTEWPDESFSNFLSRSGFSLEVLSLTDLAFTDAHLVSYLHHSSIHDSLEKLVIEPQEEIISSFLLDFLTFKLPSSDTNTIHAPVPL
# LPKLNSILFNVNAITQAVALRHFVASRWYDTATYEVPLPVASLKHIHVRLAVPDPPNVNVSIDEIEHVFSRITKSRGTEVRLETIAMAPSDFDQYAGI
# ERLNIDSVFEGII]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g457
###
# start gene g458
Scaffold_16	AUGUSTUS	gene	45275	46075	0.35	-	.	g458
Scaffold_16	AUGUSTUS	transcript	45275	46075	0.35	-	.	g458.t1
Scaffold_16	AUGUSTUS	stop_codon	45275	45277	.	-	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_16	AUGUSTUS	CDS	45275	46075	0.35	-	0	transcript_id "g458.t1"; gene_id "g458";
Scaffold_16	AUGUSTUS	start_codon	46073	46075	.	-	0	transcript_id "g458.t1"; gene_id "g458";
# protein sequence = [MLRLVAPPGSHSTDDESKTRATINKIGRGVGTIFLKVPLPIIGPIAARVIHSLADKPPPIAPTGYPGDPVNSPVLMRR
# LALLEHTFPGATLPVLTQGLPPPAKPDGVMEMINSWGLKFDEMRENKAERKNEERRRAWAQIQAAGVANGGYPYGGGHQAIPRNRSPSPSPVAMPTPM
# IGGAAMGMSYGGSDVGYMDYRDARRAGRRAAKAERKAYRRMQKGQRKGLLSGMSRAERRATAADLLEHWATNRVLWVVVMPAEKGKHDRF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g458
###
# start gene g459
Scaffold_16	AUGUSTUS	gene	54269	54763	0.99	-	.	g459
Scaffold_16	AUGUSTUS	transcript	54269	54763	0.99	-	.	g459.t1
Scaffold_16	AUGUSTUS	stop_codon	54269	54271	.	-	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_16	AUGUSTUS	CDS	54269	54763	0.99	-	0	transcript_id "g459.t1"; gene_id "g459";
Scaffold_16	AUGUSTUS	start_codon	54761	54763	.	-	0	transcript_id "g459.t1"; gene_id "g459";
# protein sequence = [MTALLVQKLWTIRQRDYPSAPQGFVSCSASGHGLPDYAVGYELRGPRTIFEQYKERTYHLAYDITAWDNGELRRQEPQ
# KAALVTNDEIVWVHCDLRSTNIMIHDGRVSGVIDWENSGWQPRHWQLLVVRPWCGTNGPRIANAWKQIPFDDDVEQAYEAGLSLLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g459
###
# start gene g460
Scaffold_16	AUGUSTUS	gene	57834	60612	0.93	+	.	g460
Scaffold_16	AUGUSTUS	transcript	57834	60612	0.93	+	.	g460.t1
Scaffold_16	AUGUSTUS	start_codon	57834	57836	.	+	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_16	AUGUSTUS	CDS	57834	57838	0.98	+	0	transcript_id "g460.t1"; gene_id "g460";
Scaffold_16	AUGUSTUS	CDS	57960	57964	0.99	+	1	transcript_id "g460.t1"; gene_id "g460";
Scaffold_16	AUGUSTUS	CDS	58100	60612	0.96	+	2	transcript_id "g460.t1"; gene_id "g460";
Scaffold_16	AUGUSTUS	stop_codon	60610	60612	.	+	0	transcript_id "g460.t1"; gene_id "g460";
# protein sequence = [MAVKREPLASPIGKLYSSGELFSNPPIGLPGSQLVSSLSRSSSRAAHDKAAQTGPSRASRKLRFAELGPDQVHVYPSA
# PSSPKKVLLALPPPDEDSNAVSLGTFKGRMKPIDLEDATASQTQVEQVKEEAAETHVEEGTAEIQVEQAEEGTTEIQGEQIEKGTAETQIEQVEEGTA
# EYIRQKYFPSAPTDNPDLAWMSSSLDPPPQEQTPDLRFDLNGTPIPSSKILSLPTHLGLHHHAEGTRAGYTLDDIFLLTRSTVRAQRAAMLEVLVGVT
# RWLRTSGTKEDVDIEAARKSLLNLPNPEGSGIPPLLKRILFAGLEALPERGAVGVRAMDVVWECVVGQTNVTEDLGDLEFEFGGMEEGKTDEGVLITA
# LPLADVLPQFLGLLLSPPDSDLGDERPSTLTLNQPEFRSLRTTPAQQQILSILTRLAMYSNAYAETIVQEKGLMEGLLRVFIIPPATSTYASTPDLAT
# IRLLTILASASRTNAEALCQKIGAGDVLLRFVVLSTNDNVLVEIMIFYTILARYGMYSRVAADAKEVWWKIGDHVVALSSSYSQSNMRLVRAYVGLIE
# AWLICATDPHRTTPSHELLWSQVKSWEWGAGLATLLTKVSSLAVERTGTVDNRIRIAVSSASLWRSLGAYLEGAKVNGIRGGEGERTEVGLVLKRVFD
# SGAVQTFRNLIEDLKTKLDTVGTEMKTTVASIEIASLASILSSAIRLWLGCCPPSPSDGSPPFELPFADISDLCAILVRHDLWHQNFNPLLIRPLSTL
# LVLFLRLSPHLPGSHLDLWLAQAFGVIKTLRRGDEEHALQIISQILDMLTSEWAAPRAESALPTSSGKKRADLKPS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g460
###
# start gene g461
Scaffold_16	AUGUSTUS	gene	60752	61755	0.87	+	.	g461
Scaffold_16	AUGUSTUS	transcript	60752	61755	0.87	+	.	g461.t1
Scaffold_16	AUGUSTUS	start_codon	60752	60754	.	+	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_16	AUGUSTUS	CDS	60752	61275	0.99	+	0	transcript_id "g461.t1"; gene_id "g461";
Scaffold_16	AUGUSTUS	CDS	61404	61755	0.87	+	1	transcript_id "g461.t1"; gene_id "g461";
Scaffold_16	AUGUSTUS	stop_codon	61753	61755	.	+	0	transcript_id "g461.t1"; gene_id "g461";
# protein sequence = [MAAPGASTSFRLDPVPFQPSSALRERLFSLKQSGALPDSWDASEIDVVRAALALAMVEREVLQRFAPSMISLVGPKEE
# DIIFACMKVFMLEHDVGNGDSKTHSDGEGLQEVFRDEVVARQLHEILEPYTVKALSSSSTSYVPSSRSSSAPLELASLPLLGTAVPFYQFYTDFLSLV
# EVDDVIAGAGGIEQWLYPVETAPDVLGAYLRALIKYGEGVQGFLRLLAVHHVAANIWPDFYVGTHIEELVFDERRSKLLRVVVEQGGMEVVKDVLRYR
# QSPQLRRILCSPACFQE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g461
###
# start gene g462
Scaffold_16	AUGUSTUS	gene	67944	68684	0.45	-	.	g462
Scaffold_16	AUGUSTUS	transcript	67944	68684	0.45	-	.	g462.t1
Scaffold_16	AUGUSTUS	stop_codon	67944	67946	.	-	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_16	AUGUSTUS	CDS	67944	68684	0.45	-	0	transcript_id "g462.t1"; gene_id "g462";
Scaffold_16	AUGUSTUS	start_codon	68682	68684	.	-	0	transcript_id "g462.t1"; gene_id "g462";
# protein sequence = [MHPQSRFFYRFSQSWNHPGMDYGFSRRQWHRRPSRLLWFTIGAASATWYIMRHDAEQSDKANYWKNCYRPPVQQPRPQ
# NNGDFSRVLGDPLPTVPGNDSGAPPSPSPYPYSHPHHHSHWGWGFAKERSFQYPPSPPPPPPPPPPSAAHPPNGPANLRNYGQAPSDSALPTVPTESL
# SGPASTPGADLAPTPTPTPVAAAIHTQTVPWGFESSYEHQKKEWEQEREKLLAKAQDTVILLCLNCLSFF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g462
###
# start gene g463
Scaffold_16	AUGUSTUS	gene	70141	70425	0.69	-	.	g463
Scaffold_16	AUGUSTUS	transcript	70141	70425	0.69	-	.	g463.t1
Scaffold_16	AUGUSTUS	stop_codon	70141	70143	.	-	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_16	AUGUSTUS	CDS	70141	70425	0.69	-	0	transcript_id "g463.t1"; gene_id "g463";
Scaffold_16	AUGUSTUS	start_codon	70423	70425	.	-	0	transcript_id "g463.t1"; gene_id "g463";
# protein sequence = [MSYYLQVISNRAIEILGGELGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVTELNISLIPALSGLRDALDAKSKAFEH
# IVKIGRTHLQVRIRAQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g463
###
# start gene g464
Scaffold_16	AUGUSTUS	gene	70533	70826	0.82	-	.	g464
Scaffold_16	AUGUSTUS	transcript	70533	70826	0.82	-	.	g464.t1
Scaffold_16	AUGUSTUS	stop_codon	70533	70535	.	-	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_16	AUGUSTUS	CDS	70533	70826	0.82	-	0	transcript_id "g464.t1"; gene_id "g464";
Scaffold_16	AUGUSTUS	start_codon	70824	70826	.	-	0	transcript_id "g464.t1"; gene_id "g464";
# protein sequence = [MFPYQSFESKFVDMSGYNGRSLQNFDIGGPTERLPPPLIKAFGILKKAASIVNVGYGLDAKIGEAIQQAADDVRCFSF
# IRWKADFYGFNQGHFGTTK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g464
###
# start gene g465
Scaffold_16	AUGUSTUS	gene	73656	74219	0.72	-	.	g465
Scaffold_16	AUGUSTUS	transcript	73656	74219	0.72	-	.	g465.t1
Scaffold_16	AUGUSTUS	stop_codon	73656	73658	.	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_16	AUGUSTUS	CDS	73656	74219	0.72	-	0	transcript_id "g465.t1"; gene_id "g465";
Scaffold_16	AUGUSTUS	start_codon	74217	74219	.	-	0	transcript_id "g465.t1"; gene_id "g465";
# protein sequence = [MELGDRYLVVQRASVGAKPDTPGMIPNLPYDQFPEIPRPIMPAGESTGSDARILLMLNMVTPEDLIDDEEYGDLFDDI
# KEECSNFGAVEDLRIPRPVKKDKTKWTPGEGLDPQAIARIDEAAGVGRVYVKYVDSHSASAALKSLAGRSFAGRSIIATLLSEESQTTPPLNLIFAPQ
# PDAPPPLPADS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g465
###
# start gene g466
Scaffold_16	AUGUSTUS	gene	74703	75625	0.43	-	.	g466
Scaffold_16	AUGUSTUS	transcript	74703	75625	0.43	-	.	g466.t1
Scaffold_16	AUGUSTUS	stop_codon	74703	74705	.	-	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_16	AUGUSTUS	CDS	74703	75517	1	-	2	transcript_id "g466.t1"; gene_id "g466";
Scaffold_16	AUGUSTUS	CDS	75619	75625	0.43	-	0	transcript_id "g466.t1"; gene_id "g466";
Scaffold_16	AUGUSTUS	start_codon	75623	75625	.	-	0	transcript_id "g466.t1"; gene_id "g466";
# protein sequence = [MLYRASHREDRHRSSKHEERDGHREREHRDRGDRSDRYGGRRGDDRRDGRGDRDRERYSRGPREFDERRPRDDDRRRG
# REDDGYGPPRDRGDRGERRGRGGGGGGEGRGGGGGGGGGGRREATPPERRSPTPEGAVPLTQRRRKASGWDVHAPGYEQYSAMQAKQTGLLNHAVSHL
# LFPNDFAGLFNLPGANRTQIPPILGIAGLPPPMPVQTFGMGIGANPNLSRQSRRLYIGSITPEVNEQNLAEFFNQKMAEMNIGTSTPVPCSCGTVQL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g466
###
# start gene g467
Scaffold_16	AUGUSTUS	gene	82258	83313	0.7	+	.	g467
Scaffold_16	AUGUSTUS	transcript	82258	83313	0.7	+	.	g467.t1
Scaffold_16	AUGUSTUS	start_codon	82258	82260	.	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_16	AUGUSTUS	CDS	82258	83313	0.7	+	0	transcript_id "g467.t1"; gene_id "g467";
Scaffold_16	AUGUSTUS	stop_codon	83311	83313	.	+	0	transcript_id "g467.t1"; gene_id "g467";
# protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK
# LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA
# LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK
# QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRCQQISATGPADTPKFWLDVYAVNCDIFTYRFVSRGL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g467
###
# start gene g468
Scaffold_16	AUGUSTUS	gene	90149	90679	0.35	-	.	g468
Scaffold_16	AUGUSTUS	transcript	90149	90679	0.35	-	.	g468.t1
Scaffold_16	AUGUSTUS	stop_codon	90149	90151	.	-	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_16	AUGUSTUS	CDS	90149	90679	0.35	-	0	transcript_id "g468.t1"; gene_id "g468";
Scaffold_16	AUGUSTUS	start_codon	90677	90679	.	-	0	transcript_id "g468.t1"; gene_id "g468";
# protein sequence = [MEFSQGGFILIALLLHNDFGNGINGIGLSTARGLAQSGFGETLLRLYESLSPMPQRLSEALQELNQDMAYEIQHNKRG
# KMGLCSPARVEILRHSNFPTFDDLEALSTFLTPVTSSSEGLPPLLASLRLPTLPNISGIVAFSTEHFAWSPKLTLQHFHNYLWPGVIIRMLSSVRRAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g468
###
# start gene g469
Scaffold_16	AUGUSTUS	gene	91906	92163	0.85	+	.	g469
Scaffold_16	AUGUSTUS	transcript	91906	92163	0.85	+	.	g469.t1
Scaffold_16	AUGUSTUS	start_codon	91906	91908	.	+	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_16	AUGUSTUS	CDS	91906	92163	0.85	+	0	transcript_id "g469.t1"; gene_id "g469";
Scaffold_16	AUGUSTUS	stop_codon	92161	92163	.	+	0	transcript_id "g469.t1"; gene_id "g469";
# protein sequence = [MAEDGGSLAESLDIRRHLFIRRGDGGDGGGEVVEEFEVDEVELSEVMGGPKEGEKAKDDVDESYSPDKQISNAKLSGT
# QARTRKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g469
###
# start gene g470
Scaffold_16	AUGUSTUS	gene	107167	108057	0.96	-	.	g470
Scaffold_16	AUGUSTUS	transcript	107167	108057	0.96	-	.	g470.t1
Scaffold_16	AUGUSTUS	stop_codon	107167	107169	.	-	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_16	AUGUSTUS	CDS	107167	108057	0.96	-	0	transcript_id "g470.t1"; gene_id "g470";
Scaffold_16	AUGUSTUS	start_codon	108055	108057	.	-	0	transcript_id "g470.t1"; gene_id "g470";
# protein sequence = [MSSTTAFKINARLGKAPVRQEQENASELKDVVVHKGVLEDWVLNTAQMRDAQYLQRFRIPVVPLSLTYVLEQSAAREW
# AAQNPRKPTQLQAPHMPPPPPQLRPVLGRQLALSRQGNTSPNQAAARSGSIMPGPTLLHAYRPYPSFSEPPSHQQQAPPRTLHPPPPIPPRGQISSLP
# PSSSQDPYSLPLPMSYSHIDDLTFSVDMQTQHNSSLNSYPTPLPAASQYLTQPPGGSQVRRPSQLRYPSSAQNSEPRRSADQETMHNYPGNSMEMHPR
# PSTSSSDNQRNLYQWRGPSGYR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g470
###
# start gene g471
Scaffold_16	AUGUSTUS	gene	111527	112494	0.28	-	.	g471
Scaffold_16	AUGUSTUS	transcript	111527	112494	0.28	-	.	g471.t1
Scaffold_16	AUGUSTUS	stop_codon	111527	111529	.	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_16	AUGUSTUS	CDS	111527	112110	0.52	-	2	transcript_id "g471.t1"; gene_id "g471";
Scaffold_16	AUGUSTUS	CDS	112479	112494	0.29	-	0	transcript_id "g471.t1"; gene_id "g471";
Scaffold_16	AUGUSTUS	start_codon	112492	112494	.	-	0	transcript_id "g471.t1"; gene_id "g471";
# protein sequence = [MNEEAVWHTVYENNQWRIYCKLCRSIGQSPYHAKEHQKTAKHVENLQRLDVQEIPGHRSDNTSPAVPIKSIFDLAASR
# LFQELGDPAAPKEPLPPISDFLNESHRSSMDFEPLARFDWDEFEGLDAELHESHDVEGIQVLSNYMLNMFEHGPDAVYSDDDLSDGERSESSDAEHRP
# NVEDVDEFNIRGVQSTTSILELR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g471
###
# start gene g472
Scaffold_16	AUGUSTUS	gene	118285	119310	0.91	+	.	g472
Scaffold_16	AUGUSTUS	transcript	118285	119310	0.91	+	.	g472.t1
Scaffold_16	AUGUSTUS	start_codon	118285	118287	.	+	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_16	AUGUSTUS	CDS	118285	119310	0.91	+	0	transcript_id "g472.t1"; gene_id "g472";
Scaffold_16	AUGUSTUS	stop_codon	119308	119310	.	+	0	transcript_id "g472.t1"; gene_id "g472";
# protein sequence = [MFEGLLTATTHDTRQPYGAGLLRFNQFCDAESIPEGARMPASAILLGAFVAEFMGTCTGSCIQNWLSGLRLWHLYNNA
# VWHGQEGWLPSLKKAAERKGAVFKRAQRGPIERHHLLTLHSHLDLSTPHGASTWAIATTAYWGCRRLGEIIPKSATKVTPEHDIFRSTRVTRSVVGGR
# RTISFHLPWTKTTREKGGECFLTEIPGDPLCPVAAVENHLKVNHSPPPNTPFFAFREGPSWTIWVKSAFIGWFTSIFRLHNLEEVFGHSFRIGGSLAY
# LLLGVPPEVIMKIGGWTSLCFLIYWRRLEKVIPLAVAQAMQSESRMRAFASSYNLPFTTEDLEFDLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g472
###
# start gene g473
Scaffold_16	AUGUSTUS	gene	125280	125672	0.6	+	.	g473
Scaffold_16	AUGUSTUS	transcript	125280	125672	0.6	+	.	g473.t1
Scaffold_16	AUGUSTUS	start_codon	125280	125282	.	+	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_16	AUGUSTUS	CDS	125280	125672	0.6	+	0	transcript_id "g473.t1"; gene_id "g473";
Scaffold_16	AUGUSTUS	stop_codon	125670	125672	.	+	0	transcript_id "g473.t1"; gene_id "g473";
# protein sequence = [MFNVMARLDVPTYDDPLVQRQLEQAFPSNSRQTVIWRTVVGVINMGSTAIMLLSQLSVLSTVLKNQQDGTLIALLSFS
# HSILSSNSDTQSLFTRGMSLFSFGFKGMTFAQCGLLLLTMLTLSNCLVSGRL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g473
###
# start gene g474
Scaffold_16	AUGUSTUS	gene	133677	134093	0.92	-	.	g474
Scaffold_16	AUGUSTUS	transcript	133677	134093	0.92	-	.	g474.t1
Scaffold_16	AUGUSTUS	stop_codon	133677	133679	.	-	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_16	AUGUSTUS	CDS	133677	134093	0.92	-	0	transcript_id "g474.t1"; gene_id "g474";
Scaffold_16	AUGUSTUS	start_codon	134091	134093	.	-	0	transcript_id "g474.t1"; gene_id "g474";
# protein sequence = [MSSLETANDLPMQDSNLSTDQRAVPSTVLPSVFSFDSSLLEVDEHEQPYRTPDKGQYRDLSSNSPFPSSYMHQSSMGA
# EHRYPNNVLLGDSSSTMMYNFLHGSPFLNVNSEVSSRSSTEIPPPMEKELFQIYHPQAMQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g474
###
# start gene g475
Scaffold_16	AUGUSTUS	gene	137264	137953	0.57	+	.	g475
Scaffold_16	AUGUSTUS	transcript	137264	137953	0.57	+	.	g475.t1
Scaffold_16	AUGUSTUS	start_codon	137264	137266	.	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_16	AUGUSTUS	CDS	137264	137953	0.57	+	0	transcript_id "g475.t1"; gene_id "g475";
Scaffold_16	AUGUSTUS	stop_codon	137951	137953	.	+	0	transcript_id "g475.t1"; gene_id "g475";
# protein sequence = [MQLNSPLPMSPPLPPRVDASPVPPMPAEPVLLAGLSLPPAAISQLLTRAASELNLRPVRFPLLGEYKDCFTGEEFVAW
# LKDNVQGLGGSLDRAEQAAKDLTERDGLLRRIGELGNDFEHSEEAFYQFRPKVCSLFIIAIIPNLSSQAFELPDKSTDTTSPIKLQPDELLKRTNTIF
# NAVSKALQTNQSSEPTHMKARHEAEDADKAYRVAVRQLDRQRLGLEERLEDTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g475
###
# start gene g476
Scaffold_16	AUGUSTUS	gene	142484	143206	0.85	+	.	g476
Scaffold_16	AUGUSTUS	transcript	142484	143206	0.85	+	.	g476.t1
Scaffold_16	AUGUSTUS	start_codon	142484	142486	.	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_16	AUGUSTUS	CDS	142484	142882	0.86	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_16	AUGUSTUS	CDS	143042	143206	0.85	+	0	transcript_id "g476.t1"; gene_id "g476";
Scaffold_16	AUGUSTUS	stop_codon	143204	143206	.	+	0	transcript_id "g476.t1"; gene_id "g476";
# protein sequence = [MSAEQPTEQLTEQHAAGIVQPRAFNPLRDDIRWDRGPLTRVPDPNRAGVIVFTPQDSAQTSREGLGVWRKNNQAYKLF
# GTTNQFTRITNDINKAKDNGLPYANASTSEGLIYTYIRKPAQLQDLARLRCNRYVRALRLAVQLKVSDPQGFIDPTTQSTNSIQFIDIHYGSDVVAQA
# MLEIVDKQLSG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g476
###
# start gene g477
Scaffold_16	AUGUSTUS	gene	144067	144600	0.49	+	.	g477
Scaffold_16	AUGUSTUS	transcript	144067	144600	0.49	+	.	g477.t1
Scaffold_16	AUGUSTUS	start_codon	144067	144069	.	+	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_16	AUGUSTUS	CDS	144067	144600	0.49	+	0	transcript_id "g477.t1"; gene_id "g477";
Scaffold_16	AUGUSTUS	stop_codon	144598	144600	.	+	0	transcript_id "g477.t1"; gene_id "g477";
# protein sequence = [MSAEQPTEQLDEQLAAGIVQPRAFSPLRDNIRWDQGPLTRPPDPNRAGVIQFTPRDSAQTSREGLGVWRRGNQAYKLF
# GTTNQFTRITNDINTARTNGLPYANASTSQGLVYTYENPPNFRTLQGFAVIATWYDAPWRFFSGRGTGSPPFGTSSGWLRTTLSLGKDIPLADDVLLI
# F]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g477
###
# start gene g478
Scaffold_16	AUGUSTUS	gene	167801	168571	0.4	+	.	g478
Scaffold_16	AUGUSTUS	transcript	167801	168571	0.4	+	.	g478.t1
Scaffold_16	AUGUSTUS	start_codon	167801	167803	.	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_16	AUGUSTUS	CDS	167801	167831	0.44	+	0	transcript_id "g478.t1"; gene_id "g478";
Scaffold_16	AUGUSTUS	CDS	167952	168571	0.68	+	2	transcript_id "g478.t1"; gene_id "g478";
Scaffold_16	AUGUSTUS	stop_codon	168569	168571	.	+	0	transcript_id "g478.t1"; gene_id "g478";
# protein sequence = [MKQSGTETNSTKLVLFHILCSVSKTADSYARQTIQPRAEPADLILLDPKTVASILRRAISTPETQDCKPELITTRQEL
# SSTFGGTITQFVTGYPVAYSSMLRKVKKIPNATQHKQRYFIFPNKTPEFNAHFPSRPGAHGLMFGMRPRMEHLLKDKNASIFELFVPVNRAQCGVNMF
# TVPTSKVPVEYYGTYKLVKQGSMLAQDFARQPQSVYIPKL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g478
###
# start gene g479
Scaffold_16	AUGUSTUS	gene	172067	174121	0.28	+	.	g479
Scaffold_16	AUGUSTUS	transcript	172067	174121	0.28	+	.	g479.t1
Scaffold_16	AUGUSTUS	start_codon	172067	172069	.	+	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_16	AUGUSTUS	CDS	172067	174121	0.28	+	0	transcript_id "g479.t1"; gene_id "g479";
Scaffold_16	AUGUSTUS	stop_codon	174119	174121	.	+	0	transcript_id "g479.t1"; gene_id "g479";
# protein sequence = [MGDEADAPIIIPPRGQILRRTNRTKIRKPALPGDGGGHRFGASRRGGRSAAAAAAAITTTTTSERTSSDYSSSDHEPE
# VRPRLLSNEFPPVRPESFSEETSIYDAYVNEEEEVYPSTVVVTTSPPPQEAPRVSLQQTPAANPPPEPEPISVQPLPDVDVEAVLDQPAPDAVLHQPQ
# PQRLLSPQVISEPSPPPGTPSPPSSPITEPPAAPLSFLSSPPPPHQHHRKEKDKKGLFGKWGSDKGGKKAKDHARANPRKRKEKDSGFFGSLFGGKKS
# KDSESFASTSSAHGHTAGREAAQALLGASKSSKSYQPPPSPGAQAINNYSRYPIHVERAIYRLSHIKLANPRRPLYEQVLISNLMFWYLGVINKAQNP
# TANGQTGVGQTAAGGAPNPTDKEQQEKEQREAEQKEKERLEQERQEREQREQREREMEMKKQKEALPKRGPLTKPAPMGTGGGRRAEIPIRGPQYEMQ
# HREMEQAYGGYAGYNSGPTSQQGMPQGRRTPGQGQRASPSPQSAPRLVQPADSQTPDNFYYSPDAAQSQPQQSVYQQHQQQRLPPGAMPPVEKSNWAT
# PGSPRQSNSSPPPILGSNPQRRSQSPPNAYSQQGAYGNNMSTGGGRTPGRSLSATAVPSPSPPNANGRIRKGVSAHAVPSKARPRTPESPLLAYPTNG
# VAEEEDVPLAVWQQQRKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g479
###
# start gene g480
Scaffold_16	AUGUSTUS	gene	175233	177836	1	+	.	g480
Scaffold_16	AUGUSTUS	transcript	175233	177836	1	+	.	g480.t1
Scaffold_16	AUGUSTUS	start_codon	175233	175235	.	+	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_16	AUGUSTUS	CDS	175233	177836	1	+	0	transcript_id "g480.t1"; gene_id "g480";
Scaffold_16	AUGUSTUS	stop_codon	177834	177836	.	+	0	transcript_id "g480.t1"; gene_id "g480";
# protein sequence = [MSPPGSPRLIDSYTAPKEILQEFADLAEEENVDPFAETAKTRQIAARQSDYHNRRFERVAVDSADAFQEGGSEEGGYK
# DAMRLARLEQEEVRVKRAIEEKERQEREEGKMKMDLDKTPPAAELQDVEMELASAKELAMSREQPGAKRKRRWDNPEPSDENADPNKMDTGEWSKEAL
# EASAPKKRRSRWDATPAETPVAETPKRSRWDQTPVVQDTPMVPIIMNAPGLSQDDKHNRYLTDEELDAILPATGYVIVTPPPGYAPMVQPRKLQAPSV
# TEVGGFHIQESSDAAAVAAAAGLAPELPTEIPGVGNLAFFKPEDAQYFAKIMKEEDETELSVDEMKERKIMRLLLKIKNGTPPVRKTALRQITDKARE
# FGAGPLFDKILPLLMERTLEDQERHLLVKVIDRVLYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLSKAAGLAHMISTMRPDIDHADEY
# VRNTTARAFSVVASALGIPSLLPFLKAVCRSKKSWQARHTGIRIVQQIAIMMGCAVLPHLRNLVDCIAHGLSDEQQKVRTMTALGLAALAEAAAPYGI
# ESFDNVLKPLWLGIRLHRGKGLAAFLKAIGFIIPLMDPEYASYYTKEVTVILIREFQTSDEEMKKIVLKVVKQCAATEGVTPAYIKHDILPDFFKSFW
# VRRMALDRRNYRQVVETTVELAQKAGVSEIVGRIVNELKDEAEPYRKMVMETITKVVATLGASDIDERLEVRLVDGIIYSFQEQTTEDQVMLDGFGTV
# VNALGIRVKPYLTQIVSTILWRLNNKSAKVRQQAADLTTRLAVVIKQCGEDQLLSKLGLVLFEQLGEEYPDTLGSIIAAEGAIANVVGMTQMNPPVKD
# LCECH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g480
###
# start gene g481
Scaffold_16	AUGUSTUS	gene	179322	181792	0.06	+	.	g481
Scaffold_16	AUGUSTUS	transcript	179322	181792	0.06	+	.	g481.t1
Scaffold_16	AUGUSTUS	start_codon	179322	179324	.	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_16	AUGUSTUS	CDS	179322	179692	0.47	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_16	AUGUSTUS	CDS	179752	180079	0.76	+	1	transcript_id "g481.t1"; gene_id "g481";
Scaffold_16	AUGUSTUS	CDS	180134	180355	0.59	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_16	AUGUSTUS	CDS	180432	180848	0.29	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_16	AUGUSTUS	CDS	180959	181119	0.62	+	0	transcript_id "g481.t1"; gene_id "g481";
Scaffold_16	AUGUSTUS	CDS	181240	181792	0.63	+	1	transcript_id "g481.t1"; gene_id "g481";
Scaffold_16	AUGUSTUS	stop_codon	181790	181792	.	+	0	transcript_id "g481.t1"; gene_id "g481";
# protein sequence = [MAEAAHVQCAAAVRLLSTLVKGLPDHVPLASTESRISEIFKKVPEPLPSADPDEHWTTFNRRMDLLYGNDVRGADGKL
# LNITRGPLGMDLVVGYIQSAVDAGHLLWEAALPKFARLVTGVQNISKDPPVRTKTPPRMTIEEVNDEEAPAPTIQKSQHTKAKTSTSKESVPGKSSAK
# RKKTTASGVDIWADTLSADDADYILPKRSRIEEDSESEVFDSNNEEIISTTERGKGLKERSKKRAARGAEQRDTETTRLGKNKVISIDSGSESNGQSA
# QHKVDTEEAREQAKGARRGPSNASMQHFHEPVAMITRIHTSVHSVRSIERTVKGPKVSFDDEGKLPKLNIPCYPFERVQRKVETTERSDEGNGTEQST
# AEGLNLKRSADLMRNYLKDGELNPEALTTERGFLRLFAAWILDEDLPWTTGEAPSLRLLFKYLKVRYMLPSDTTSVKSKIAYAKDTWTTKQMVYTFAC
# TIGSFIDDDWRLVEMVVDFKPLEEKEHEGDLTTDNASVNDVLVATVACCVLARYGVEWNPDGHIRCIAHVINLTVQDLLASMDEAEWSSNIDYYELNK
# DAPFHYSVDEDVEQIALEAEGDSEQVDGEEDVEIGTAIQKEEAKKKKAELKQQCEESEQTVAESMKGTSALRRVCHFYDCHISFLFPFYSSGNELASF
# LCEREKKESNGHSNQPI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/6
# CDS introns: 0/5
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g481
###
# start gene g482
Scaffold_16	AUGUSTUS	gene	184534	185224	0.38	+	.	g482
Scaffold_16	AUGUSTUS	transcript	184534	185224	0.38	+	.	g482.t1
Scaffold_16	AUGUSTUS	start_codon	184534	184536	.	+	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_16	AUGUSTUS	CDS	184534	184735	0.42	+	0	transcript_id "g482.t1"; gene_id "g482";
Scaffold_16	AUGUSTUS	CDS	184794	185224	0.93	+	2	transcript_id "g482.t1"; gene_id "g482";
Scaffold_16	AUGUSTUS	stop_codon	185222	185224	.	+	0	transcript_id "g482.t1"; gene_id "g482";
# protein sequence = [MVSSTDLDPFVSLRGRNALSGVPKTVSSPKVPDLISPSPANKAQAVPPRALRRNREIESLKADASSFLASPQSIHSKD
# SDNELLRGSPSVDPAPRTSTSTKVPVDSKKPKSKTTIKVVEDSKASISSPAGMAYKRVRLPPRSRKIAPATAKGKSRQVVVSEDDSASNEVESEDEEE
# DEDEEEDSAPPPKRLKTTSSISGKISFFISLLMF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g482
###
# start gene g483
Scaffold_16	AUGUSTUS	gene	185842	186499	0.35	+	.	g483
Scaffold_16	AUGUSTUS	transcript	185842	186499	0.35	+	.	g483.t1
Scaffold_16	AUGUSTUS	start_codon	185842	185844	.	+	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_16	AUGUSTUS	CDS	185842	185890	0.35	+	0	transcript_id "g483.t1"; gene_id "g483";
Scaffold_16	AUGUSTUS	CDS	185952	186499	0.65	+	2	transcript_id "g483.t1"; gene_id "g483";
Scaffold_16	AUGUSTUS	stop_codon	186497	186499	.	+	0	transcript_id "g483.t1"; gene_id "g483";
# protein sequence = [MDALNALHKASTSSTHNLANSLRRATDLNDQLKQIGSLFDTTRELFLRSILDLQNAGEDPVVVLEALKAAEPNRRAIN
# LNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIELLCSIHSGESTAHIDKHGHLVEASPPPDSATEALEGLKEVERGSADEGASSPVGGSVPMELDLP
# TIESLAERTLSPEKGAESAQIL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g483
###
# start gene g484
Scaffold_16	AUGUSTUS	gene	189233	189484	0.77	-	.	g484
Scaffold_16	AUGUSTUS	transcript	189233	189484	0.77	-	.	g484.t1
Scaffold_16	AUGUSTUS	stop_codon	189233	189235	.	-	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_16	AUGUSTUS	CDS	189233	189484	0.77	-	0	transcript_id "g484.t1"; gene_id "g484";
Scaffold_16	AUGUSTUS	start_codon	189482	189484	.	-	0	transcript_id "g484.t1"; gene_id "g484";
# protein sequence = [MESTQREGRSLQSIAAFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELS
# EGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g484
###
# start gene g485
Scaffold_16	AUGUSTUS	gene	189527	190342	0.39	-	.	g485
Scaffold_16	AUGUSTUS	transcript	189527	190342	0.39	-	.	g485.t1
Scaffold_16	AUGUSTUS	stop_codon	189527	189529	.	-	0	transcript_id "g485.t1"; gene_id "g485";
Scaffold_16	AUGUSTUS	CDS	189527	190342	0.39	-	0	transcript_id "g485.t1"; gene_id "g485";
Scaffold_16	AUGUSTUS	start_codon	190340	190342	.	-	0	transcript_id "g485.t1"; gene_id "g485";
# protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE
# VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI
# VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRLNENIDIQLKIGISNQVNWSRLGILELKRVWIERCIQDIEDLWS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g485
###
# start gene g486
Scaffold_16	AUGUSTUS	gene	190514	190813	0.93	-	.	g486
Scaffold_16	AUGUSTUS	transcript	190514	190813	0.93	-	.	g486.t1
Scaffold_16	AUGUSTUS	stop_codon	190514	190516	.	-	0	transcript_id "g486.t1"; gene_id "g486";
Scaffold_16	AUGUSTUS	CDS	190514	190813	0.93	-	0	transcript_id "g486.t1"; gene_id "g486";
Scaffold_16	AUGUSTUS	start_codon	190811	190813	.	-	0	transcript_id "g486.t1"; gene_id "g486";
# protein sequence = [MLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKK
# FQVDDQGRLYHRILINLINHN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g486
###
# start gene g487
Scaffold_16	AUGUSTUS	gene	190943	193249	0.4	-	.	g487
Scaffold_16	AUGUSTUS	transcript	190943	193249	0.4	-	.	g487.t1
Scaffold_16	AUGUSTUS	stop_codon	190943	190945	.	-	0	transcript_id "g487.t1"; gene_id "g487";
Scaffold_16	AUGUSTUS	CDS	190943	192744	0.63	-	2	transcript_id "g487.t1"; gene_id "g487";
Scaffold_16	AUGUSTUS	CDS	192854	193170	0.77	-	1	transcript_id "g487.t1"; gene_id "g487";
Scaffold_16	AUGUSTUS	CDS	193227	193249	0.56	-	0	transcript_id "g487.t1"; gene_id "g487";
Scaffold_16	AUGUSTUS	start_codon	193247	193249	.	-	0	transcript_id "g487.t1"; gene_id "g487";
# protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY
# ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEEQEVFTKYKPVDKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEII
# DKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCV
# IKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYI
# LRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQ
# VVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQID
# PTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGP
# DGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFYYGRWGNGRAVSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g487
###
# start gene g488
Scaffold_16	AUGUSTUS	gene	193821	195029	0.53	-	.	g488
Scaffold_16	AUGUSTUS	transcript	193821	195029	0.53	-	.	g488.t1
Scaffold_16	AUGUSTUS	stop_codon	193821	193823	.	-	0	transcript_id "g488.t1"; gene_id "g488";
Scaffold_16	AUGUSTUS	CDS	193821	195029	0.53	-	0	transcript_id "g488.t1"; gene_id "g488";
Scaffold_16	AUGUSTUS	start_codon	195027	195029	.	-	0	transcript_id "g488.t1"; gene_id "g488";
# protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK
# KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD
# LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESF
# LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTL
# GLARNIPFKFGEVTVYLQLHVQKKHHFKCY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g488
###
# start gene g489
Scaffold_16	AUGUSTUS	gene	195100	195645	0.64	-	.	g489
Scaffold_16	AUGUSTUS	transcript	195100	195645	0.64	-	.	g489.t1
Scaffold_16	AUGUSTUS	stop_codon	195100	195102	.	-	0	transcript_id "g489.t1"; gene_id "g489";
Scaffold_16	AUGUSTUS	CDS	195100	195645	0.64	-	0	transcript_id "g489.t1"; gene_id "g489";
Scaffold_16	AUGUSTUS	start_codon	195643	195645	.	-	0	transcript_id "g489.t1"; gene_id "g489";
# protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD
# HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIENYQ
# IDLGI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g489
###
# start gene g490
Scaffold_16	AUGUSTUS	gene	195698	196431	0.57	-	.	g490
Scaffold_16	AUGUSTUS	transcript	195698	196431	0.57	-	.	g490.t1
Scaffold_16	AUGUSTUS	stop_codon	195698	195700	.	-	0	transcript_id "g490.t1"; gene_id "g490";
Scaffold_16	AUGUSTUS	CDS	195698	196162	0.65	-	0	transcript_id "g490.t1"; gene_id "g490";
Scaffold_16	AUGUSTUS	CDS	196240	196431	0.57	-	0	transcript_id "g490.t1"; gene_id "g490";
Scaffold_16	AUGUSTUS	start_codon	196429	196431	.	-	0	transcript_id "g490.t1"; gene_id "g490";
# protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSEKMRIFRLLFDAEM
# KKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHI
# NLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIQGN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g490
###
# start gene g491
Scaffold_16	AUGUSTUS	gene	209530	209931	1	-	.	g491
Scaffold_16	AUGUSTUS	transcript	209530	209931	1	-	.	g491.t1
Scaffold_16	AUGUSTUS	stop_codon	209530	209532	.	-	0	transcript_id "g491.t1"; gene_id "g491";
Scaffold_16	AUGUSTUS	CDS	209530	209931	1	-	0	transcript_id "g491.t1"; gene_id "g491";
Scaffold_16	AUGUSTUS	start_codon	209929	209931	.	-	0	transcript_id "g491.t1"; gene_id "g491";
# protein sequence = [MPFLQIQISILLLCLAPSTDTKSGDEKVPVQLWVNHEGQSDEHWVLVIDKVYGFHAIAPEEKPAKPGQLEFKSGLDPQ
# AKLKPQQLPTVQKKADKLMNLDCDATFKDQADMTKVFGELVTKIDMSKPADEVGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g491
###
# start gene g492
Scaffold_16	AUGUSTUS	gene	220464	220694	0.66	-	.	g492
Scaffold_16	AUGUSTUS	transcript	220464	220694	0.66	-	.	g492.t1
Scaffold_16	AUGUSTUS	stop_codon	220464	220466	.	-	0	transcript_id "g492.t1"; gene_id "g492";
Scaffold_16	AUGUSTUS	CDS	220464	220694	0.66	-	0	transcript_id "g492.t1"; gene_id "g492";
Scaffold_16	AUGUSTUS	start_codon	220692	220694	.	-	0	transcript_id "g492.t1"; gene_id "g492";
# protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLTTAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQLQNWASEQPDLAKAK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g492
###
# start gene g493
Scaffold_16	AUGUSTUS	gene	224925	225821	0.86	-	.	g493
Scaffold_16	AUGUSTUS	transcript	224925	225821	0.86	-	.	g493.t1
Scaffold_16	AUGUSTUS	stop_codon	224925	224927	.	-	0	transcript_id "g493.t1"; gene_id "g493";
Scaffold_16	AUGUSTUS	CDS	224925	225821	0.86	-	0	transcript_id "g493.t1"; gene_id "g493";
Scaffold_16	AUGUSTUS	start_codon	225819	225821	.	-	0	transcript_id "g493.t1"; gene_id "g493";
# protein sequence = [MTIQSWAKRVMNIVLIGETGVGKTAMLNLLANVCAGVPMEEFEEKNELNNEEGGSTAGSQTNKPRFYSITSANGHKVN
# ILDTPGLADTRGIDKDKEHQAAIAEAIKTNFDVIDAVIILANGTLPRLGAATEYTLTTISGMFPNSIVDNIAFVLTMVSNPSSNNFTRTSLPKQLQNS
# RIWPVDNPFAQWLKYQKELLKDPPISEDDLQEMLGSARRGYNKTLKMLSELFQYLDKCRVQPTHSIFDLYIMSTDIEVRISNVIAGMTQTEDKRMKLK
# KLQEDYQTLVSFFSPSVEQALMII]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g493
###
# start gene g494
Scaffold_16	AUGUSTUS	gene	227833	228773	0.32	+	.	g494
Scaffold_16	AUGUSTUS	transcript	227833	228773	0.32	+	.	g494.t1
Scaffold_16	AUGUSTUS	start_codon	227833	227835	.	+	0	transcript_id "g494.t1"; gene_id "g494";
Scaffold_16	AUGUSTUS	CDS	227833	228331	0.36	+	0	transcript_id "g494.t1"; gene_id "g494";
Scaffold_16	AUGUSTUS	CDS	228457	228773	0.7	+	2	transcript_id "g494.t1"; gene_id "g494";
Scaffold_16	AUGUSTUS	stop_codon	228771	228773	.	+	0	transcript_id "g494.t1"; gene_id "g494";
# protein sequence = [MRKRTIRTSFHLLIRKQRNSSRRWKTVSGLYSVTIDPVDSGNSQLSSDDKETLDLWKRFRDLSIVEYEKLYRRLNVRF
# DVYGGESLVKEDLIMDSLEKLRSKNLLTKKTERESRIGAAALAAETISDGQDIGDDDQAPDALALDFDQYNLGKPVVQKGGSCFSYPFCDQQDLHVRQ
# FFKALSLMEEPFADELEHVNFGKIHGMSSRKGEVKFLSDILDASKEAMLDQMKKNDEKMKDVTDPEYTSDEVGMTCVKIQDMSAKRSVTFSPLFV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g494
###
# start gene g495
Scaffold_16	AUGUSTUS	gene	231130	231690	0.37	-	.	g495
Scaffold_16	AUGUSTUS	transcript	231130	231690	0.37	-	.	g495.t1
Scaffold_16	AUGUSTUS	stop_codon	231130	231132	.	-	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_16	AUGUSTUS	CDS	231130	231316	0.42	-	1	transcript_id "g495.t1"; gene_id "g495";
Scaffold_16	AUGUSTUS	CDS	231455	231690	0.4	-	0	transcript_id "g495.t1"; gene_id "g495";
Scaffold_16	AUGUSTUS	start_codon	231688	231690	.	-	0	transcript_id "g495.t1"; gene_id "g495";
# protein sequence = [MGAGTEVTEFREDRLPSAEIEPYSLDDETKPASMIKLVSPVVTRCHMIVVPVTGIPDDDVEDEYECGREEGCNEVAPE
# GDDVEAETEDVSIDDVDFPDTPVDFLDGVGCVDVSEGDITDVNDSPLTLDADGGGVAGMSES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g495
###
# start gene g496
Scaffold_16	AUGUSTUS	gene	232916	233633	0.62	+	.	g496
Scaffold_16	AUGUSTUS	transcript	232916	233633	0.62	+	.	g496.t1
Scaffold_16	AUGUSTUS	start_codon	232916	232918	.	+	0	transcript_id "g496.t1"; gene_id "g496";
Scaffold_16	AUGUSTUS	CDS	232916	233056	0.62	+	0	transcript_id "g496.t1"; gene_id "g496";
Scaffold_16	AUGUSTUS	CDS	233207	233247	0.83	+	0	transcript_id "g496.t1"; gene_id "g496";
Scaffold_16	AUGUSTUS	CDS	233360	233377	0.85	+	1	transcript_id "g496.t1"; gene_id "g496";
Scaffold_16	AUGUSTUS	CDS	233540	233633	0.86	+	1	transcript_id "g496.t1"; gene_id "g496";
Scaffold_16	AUGUSTUS	stop_codon	233631	233633	.	+	0	transcript_id "g496.t1"; gene_id "g496";
# protein sequence = [MQWRTRMCNSSASQAVLVKKVEEAAVNAKGFKGVALEVSDIQETSIVARCTILVRVVVRLSMLILSSAERIRKQVDDA
# VKAGAKKLIPEELFPEAKM]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g496
###
# start gene g497
Scaffold_16	AUGUSTUS	gene	235781	236323	0.3	-	.	g497
Scaffold_16	AUGUSTUS	transcript	235781	236323	0.3	-	.	g497.t1
Scaffold_16	AUGUSTUS	stop_codon	235781	235783	.	-	0	transcript_id "g497.t1"; gene_id "g497";
Scaffold_16	AUGUSTUS	CDS	235781	236138	0.74	-	1	transcript_id "g497.t1"; gene_id "g497";
Scaffold_16	AUGUSTUS	CDS	236187	236323	0.31	-	0	transcript_id "g497.t1"; gene_id "g497";
Scaffold_16	AUGUSTUS	start_codon	236321	236323	.	-	0	transcript_id "g497.t1"; gene_id "g497";
# protein sequence = [MRRAAHAVLNVRASAQYQPVQIEEAVIFAHKLLYDTSSPLSTKIARSASTMISVIYGKQLLESSEKPKQSDALPENHS
# SETFGSSPLDPLQALTDTVHTFTNALAPGAHLVDFLPILDYLPTAMAKWKRNAKRTFQQTTNLYENYYNTTVSTNTWFSGRSDYNY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g497
###
# start gene g498
Scaffold_16	AUGUSTUS	gene	241045	242421	1	+	.	g498
Scaffold_16	AUGUSTUS	transcript	241045	242421	1	+	.	g498.t1
Scaffold_16	AUGUSTUS	start_codon	241045	241047	.	+	0	transcript_id "g498.t1"; gene_id "g498";
Scaffold_16	AUGUSTUS	CDS	241045	242421	1	+	0	transcript_id "g498.t1"; gene_id "g498";
Scaffold_16	AUGUSTUS	stop_codon	242419	242421	.	+	0	transcript_id "g498.t1"; gene_id "g498";
# protein sequence = [MASADPPIPFEPRVNVDTPELNERLRSCYGLADTQLSEIKEMLRSSQMDIADYDSEIKRVKLAYDTETSRIHAEYNMN
# AAVLRVRYEAEVGHAQTAHSAKMHRIRLRCQGLKKYTEKLTTLLSPIRRIPSEILLRILVHFCDQNDLTSYEPGDASALTISAVCTRWRQLAISQPAL
# WANLKVKFDDQCEDDEEKTQALLVSRVELHLARSQNHPLTLSLFPLSSKNHPALILVARESRRWRRLSYGGDDFGSNWNSCLQSLPLPMLEAVRFEET
# EYCDGQSPPISIFPAPNIKELNLRCIFIDQHVTATFDGAWEMLTDLSYHFTEDLEGFLSILDCCPKLRRLTLEGENSDLIPVHPIRSHPIASLKILNL
# VNPPNDHDSMLECILTSLLLPDLTELVLLHIGDVEEPFLMPYRILEHFFPTFALSSVDFDLGTDLYDRHRYDCTISPPAISTGTNL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g498
###
# start gene g499
Scaffold_16	AUGUSTUS	gene	248143	249233	0.34	+	.	g499
Scaffold_16	AUGUSTUS	transcript	248143	249233	0.34	+	.	g499.t1
Scaffold_16	AUGUSTUS	start_codon	248143	248145	.	+	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_16	AUGUSTUS	CDS	248143	248151	0.65	+	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_16	AUGUSTUS	CDS	248206	248247	0.37	+	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_16	AUGUSTUS	CDS	248406	249233	0.96	+	0	transcript_id "g499.t1"; gene_id "g499";
Scaffold_16	AUGUSTUS	stop_codon	249231	249233	.	+	0	transcript_id "g499.t1"; gene_id "g499";
# protein sequence = [MQLLFLAKTVQTVPISPETVRGGSSSDLILDNHDVTLDVSNTARLSSNRARAEGPTIIQAHIVVNTSLETPDDVLFSI
# HDAAETILNLVTSDIRKSVKQHRDVDLPEDLAVELSSMYVYPTGGKEYYTVEYIIFDGMSDGKSWVHPRTEAQNWKMLIGKQSFTGLKDRSPYSYNPK
# KLDANLHAEGYRLILSTQGGKFQVNFSITVTLFTLADSGHLKQRGPWQGTKKAECVPLPSPNRKVKLLHDTDRDIERISVSFPVRYLNFCHENLLICD
# IVCGLRSASGHEQNEGVG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g499
###
# start gene g500
Scaffold_16	AUGUSTUS	gene	266021	266488	0.81	+	.	g500
Scaffold_16	AUGUSTUS	transcript	266021	266488	0.81	+	.	g500.t1
Scaffold_16	AUGUSTUS	start_codon	266021	266023	.	+	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_16	AUGUSTUS	CDS	266021	266488	0.81	+	0	transcript_id "g500.t1"; gene_id "g500";
Scaffold_16	AUGUSTUS	stop_codon	266486	266488	.	+	0	transcript_id "g500.t1"; gene_id "g500";
# protein sequence = [MISVIYGKQLLESSEKSKQSDALTEKHSSETSGPSSDPLHALLDTVHTFTNALAPGSHLVEFLPILDYLPTAMAKWKR
# NAKRDFQQTASVYESYYNLTVRIFPSFCAGRRSDMVHHSVKVNSSNPQPNLCVSLAENEVAGELTAVEKVWVTGAIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g500
###
# start gene g501
Scaffold_16	AUGUSTUS	gene	271467	272003	0.64	+	.	g501
Scaffold_16	AUGUSTUS	transcript	271467	272003	0.64	+	.	g501.t1
Scaffold_16	AUGUSTUS	start_codon	271467	271469	.	+	0	transcript_id "g501.t1"; gene_id "g501";
Scaffold_16	AUGUSTUS	CDS	271467	272003	0.64	+	0	transcript_id "g501.t1"; gene_id "g501";
Scaffold_16	AUGUSTUS	stop_codon	272001	272003	.	+	0	transcript_id "g501.t1"; gene_id "g501";
# protein sequence = [MDAAPGNTDLPLQTKPIEACVTIHSVSLLPADTQKSLQAAIEELLKPMIPAITKDIQRGFKKVLPKLNIEDFPKVSGI
# PVTSIQYKQHTSPEGMYAFDMGVRGKLDILHDEERCNLPDCGCYNVKNALGSSYYGEISQACVEDGKKIYTGFIGGNNIETGVMDKLIEFKNGKVSLI
# TC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g501
###
# start gene g502
Scaffold_16	AUGUSTUS	gene	272553	273329	0.27	+	.	g502
Scaffold_16	AUGUSTUS	transcript	272553	273329	0.27	+	.	g502.t1
Scaffold_16	AUGUSTUS	start_codon	272553	272555	.	+	0	transcript_id "g502.t1"; gene_id "g502";
Scaffold_16	AUGUSTUS	CDS	272553	273329	0.27	+	0	transcript_id "g502.t1"; gene_id "g502";
Scaffold_16	AUGUSTUS	stop_codon	273327	273329	.	+	0	transcript_id "g502.t1"; gene_id "g502";
# protein sequence = [MCRPVQDLFITPPLVGLINITKGFSIPIAMQLLFCMHILSLGLLAGTFFLESIFARPVNSENVGNSLELLPLPSRIHP
# NSDSSSTSSQNDGIHDCHYLPLHLPIYAMEAQVILHDEIPDVKIENLLKTTIETMLEPIIPAIVDSIAQSRPKLGNFLKSLGLITIPVTRVGYVSTPG
# VSEVRKGSYNFDLNFLGQWTPVHDSKHQMLSNPRNAGIWSWTGSMKVLQQSRPSHISGFSTGKLLIIKTVCLSSESISLPGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g502
###
# start gene g503
Scaffold_16	AUGUSTUS	gene	279981	280917	0.45	+	.	g503
Scaffold_16	AUGUSTUS	transcript	279981	280917	0.45	+	.	g503.t1
Scaffold_16	AUGUSTUS	start_codon	279981	279983	.	+	0	transcript_id "g503.t1"; gene_id "g503";
Scaffold_16	AUGUSTUS	CDS	279981	280247	0.53	+	0	transcript_id "g503.t1"; gene_id "g503";
Scaffold_16	AUGUSTUS	CDS	280645	280917	0.69	+	0	transcript_id "g503.t1"; gene_id "g503";
Scaffold_16	AUGUSTUS	stop_codon	280915	280917	.	+	0	transcript_id "g503.t1"; gene_id "g503";
# protein sequence = [MPIWKPIQDSIELEDDADVEDDFDDDEDLFSPDPKEITRRVEMSTERGERSSYQKKNPRPRPPYENYDKPPVAVKSQQ
# EMISFYKSLASEMSALEWAQRNQGLFSDVESGENGVSSTAAATVASTPPAEEAKELELEVDIDIVTPTTEQNSDDVLETPTQQSESKIPKVNTSETDI
# HRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g503
###
# start gene g504
Scaffold_16	AUGUSTUS	gene	280979	281605	0.9	+	.	g504
Scaffold_16	AUGUSTUS	transcript	280979	281605	0.9	+	.	g504.t1
Scaffold_16	AUGUSTUS	start_codon	280979	280981	.	+	0	transcript_id "g504.t1"; gene_id "g504";
Scaffold_16	AUGUSTUS	CDS	280979	281605	0.9	+	0	transcript_id "g504.t1"; gene_id "g504";
Scaffold_16	AUGUSTUS	stop_codon	281603	281605	.	+	0	transcript_id "g504.t1"; gene_id "g504";
# protein sequence = [MDNSEPPANTFGSWNTDLDKADPSAAGWGGMELDDITENLWGGDDADTWEIPPPPTLFPILGPTALPLTHTSGIVEWS
# MRRIRYVVNPGDDNDSSAANVIASKFPSDGPSADAVESDFSSRLSKVVMEPWLDWETSGEEGDTASPQIKGTSRGSVKVYEKGQGVMYEYSDVRSNAF
# AAAPSPNGTSLPAHDPSSTRSLSLLRQRPLSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g504
###
# start gene g505
Scaffold_16	AUGUSTUS	gene	292309	293085	0.21	+	.	g505
Scaffold_16	AUGUSTUS	transcript	292309	293085	0.21	+	.	g505.t1
Scaffold_16	AUGUSTUS	start_codon	292309	292311	.	+	0	transcript_id "g505.t1"; gene_id "g505";
Scaffold_16	AUGUSTUS	CDS	292309	292353	0.21	+	0	transcript_id "g505.t1"; gene_id "g505";
Scaffold_16	AUGUSTUS	CDS	292444	292579	0.53	+	0	transcript_id "g505.t1"; gene_id "g505";
Scaffold_16	AUGUSTUS	CDS	292661	293085	1	+	2	transcript_id "g505.t1"; gene_id "g505";
Scaffold_16	AUGUSTUS	stop_codon	293083	293085	.	+	0	transcript_id "g505.t1"; gene_id "g505";
# protein sequence = [MNSASRTSWCLELNANRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSN
# LDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTSTEMLFSPK
# TVERATTPFTRGVTPMMEDKGHVSA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g505
###
# start gene g506
Scaffold_16	AUGUSTUS	gene	293346	296200	0.05	-	.	g506
Scaffold_16	AUGUSTUS	transcript	293346	296200	0.05	-	.	g506.t1
Scaffold_16	AUGUSTUS	stop_codon	293346	293348	.	-	0	transcript_id "g506.t1"; gene_id "g506";
Scaffold_16	AUGUSTUS	CDS	293346	294274	0.46	-	2	transcript_id "g506.t1"; gene_id "g506";
Scaffold_16	AUGUSTUS	CDS	294580	295074	0.34	-	2	transcript_id "g506.t1"; gene_id "g506";
Scaffold_16	AUGUSTUS	CDS	295450	296200	0.19	-	0	transcript_id "g506.t1"; gene_id "g506";
Scaffold_16	AUGUSTUS	start_codon	296198	296200	.	-	0	transcript_id "g506.t1"; gene_id "g506";
# protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC
# VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSAYISRCVTYI
# LRDEIPHVTIPYIDDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLXEVLQLLWINDQIDPRSGYLYETA
# QEANDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLLNPSDESLGEMSKDERIKF
# IRLIKKFQVDDQGRLYHRNTDQPDQHTIGGGKEKLHMLNSAHDXEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKI
# ERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVR
# RRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIEL
# PNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGEDQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g506
###
# start gene g507
Scaffold_16	AUGUSTUS	gene	297263	299258	0.45	-	.	g507
Scaffold_16	AUGUSTUS	transcript	297263	299258	0.45	-	.	g507.t1
Scaffold_16	AUGUSTUS	stop_codon	297263	297265	.	-	0	transcript_id "g507.t1"; gene_id "g507";
Scaffold_16	AUGUSTUS	CDS	297263	298595	0.88	-	1	transcript_id "g507.t1"; gene_id "g507";
Scaffold_16	AUGUSTUS	CDS	298744	299258	0.5	-	0	transcript_id "g507.t1"; gene_id "g507";
Scaffold_16	AUGUSTUS	start_codon	299256	299258	.	-	0	transcript_id "g507.t1"; gene_id "g507";
# protein sequence = [MTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTDHFMNECPHLLEFTKRGWMMP
# EGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHRRRCVSVLVFD
# GVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVESDDEDTKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQT
# NQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCI
# RIEDLWQDQADMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQG
# SQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSH
# KRVTVGTYPRGQKGRNNQIYDIMNQRMLHLNEKSTGELIQREIFIPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g507
###
# start gene g508
Scaffold_16	AUGUSTUS	gene	299342	299926	0.7	-	.	g508
Scaffold_16	AUGUSTUS	transcript	299342	299926	0.7	-	.	g508.t1
Scaffold_16	AUGUSTUS	stop_codon	299342	299344	.	-	0	transcript_id "g508.t1"; gene_id "g508";
Scaffold_16	AUGUSTUS	CDS	299342	299926	0.7	-	0	transcript_id "g508.t1"; gene_id "g508";
Scaffold_16	AUGUSTUS	start_codon	299924	299926	.	-	0	transcript_id "g508.t1"; gene_id "g508";
# protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMIHSDAVRLFLAPMTPEVRRGVLET
# VVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIK
# LESLIPRELTEEQQQWLR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g508
###
# start gene g509
Scaffold_16	AUGUSTUS	gene	300031	302139	0.23	-	.	g509
Scaffold_16	AUGUSTUS	transcript	300031	302139	0.23	-	.	g509.t1
Scaffold_16	AUGUSTUS	stop_codon	300031	300033	.	-	0	transcript_id "g509.t1"; gene_id "g509";
Scaffold_16	AUGUSTUS	CDS	300031	300564	0.5	-	0	transcript_id "g509.t1"; gene_id "g509";
Scaffold_16	AUGUSTUS	CDS	302128	302139	0.4	-	0	transcript_id "g509.t1"; gene_id "g509";
Scaffold_16	AUGUSTUS	start_codon	302137	302139	.	-	0	transcript_id "g509.t1"; gene_id "g509";
# protein sequence = [MTIHLEHPNPTNESSRPSSSQIPTEESRGSSVSRGTGSSISRGRLTSLPRNLKKSNLDPKRKRKEINPIDIEEDIIEL
# IAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGLH
# LTRLK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g509
###
# start gene g510
Scaffold_16	AUGUSTUS	gene	304544	304864	0.81	-	.	g510
Scaffold_16	AUGUSTUS	transcript	304544	304864	0.81	-	.	g510.t1
Scaffold_16	AUGUSTUS	stop_codon	304544	304546	.	-	0	transcript_id "g510.t1"; gene_id "g510";
Scaffold_16	AUGUSTUS	CDS	304544	304864	0.81	-	0	transcript_id "g510.t1"; gene_id "g510";
Scaffold_16	AUGUSTUS	start_codon	304862	304864	.	-	0	transcript_id "g510.t1"; gene_id "g510";
# protein sequence = [MILTEAGKPFIAQNPKKGSSDFKAGSTNQQNNSQPSGSLALFTPKPKPFSGGRPNNNGKPQNSSSSANLAVNAPPSTI
# LSKYNKFEPQCDKKARVFSTYQNIISSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g510
###
# start gene g511
Scaffold_16	AUGUSTUS	gene	306190	306795	0.8	-	.	g511
Scaffold_16	AUGUSTUS	transcript	306190	306795	0.8	-	.	g511.t1
Scaffold_16	AUGUSTUS	stop_codon	306190	306192	.	-	0	transcript_id "g511.t1"; gene_id "g511";
Scaffold_16	AUGUSTUS	CDS	306190	306795	0.8	-	0	transcript_id "g511.t1"; gene_id "g511";
Scaffold_16	AUGUSTUS	start_codon	306793	306795	.	-	0	transcript_id "g511.t1"; gene_id "g511";
# protein sequence = [MPPKTRAQSRANSKENTFFTTAQSFTPFSKSISAIGRPCCHNRGSGPATVPNTSTLPEAMEEEQQFKYSTLYTGDGQP
# IQVLTPCRGQPPVVAPTRGRSITQMDSPILQAIARHRGKQPQRHATLNSPRDLPPHFNLDTGDHDDQDPPVDPTIWALTTIMTIWVTTPAVYRMVSRV
# TPVDLVIPAVLAVLVDLVGPVPKFS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g511
###
# start gene g512
Scaffold_16	AUGUSTUS	gene	311462	312895	1	-	.	g512
Scaffold_16	AUGUSTUS	transcript	311462	312895	1	-	.	g512.t1
Scaffold_16	AUGUSTUS	stop_codon	311462	311464	.	-	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_16	AUGUSTUS	CDS	311462	312895	1	-	0	transcript_id "g512.t1"; gene_id "g512";
Scaffold_16	AUGUSTUS	start_codon	312893	312895	.	-	0	transcript_id "g512.t1"; gene_id "g512";
# protein sequence = [MDCPADRKVIKNRWVFDVKSDGCKKACLVVKGFSQIEGLDYDQVFSPVVQFETVRLLLALTALNNWYLTGLDVQNAYL
# YGVLHETIYMEQPEGFRIKGKEDKVLLLRKALYGLKQAGLVWWQTLDSYMKILGFKHLSSDAGIFVRRGKDGSLVIAIIYVDDTLFAGPDKKLVDSLK
# GKFMSHWECRDLGEAKEFLCMRINRRGKKIYIDQCAYLDKVLKRCGMENAKMADTPLPAGFQPGPTKGQSNSAFRSKFQMVIGSLLYLMLGTHPDISF
# AVTKLAQHAANPSQEHLNKALYICHYLLGTRSYALCYDGESGIGLSAWTDSDWASDPYTCRSQTVFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALS
# DCSRQVVWIRNLLEELGYKLDAIPIAGDNQGSIFMASNPVTSKHSKHIDIRYHYICEVVEHGLVQVFFVDGSNNPANLFTKNLGRIKFELFCSMLGLE
# FYSSTNP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g512
###
# start gene g513
Scaffold_16	AUGUSTUS	gene	314894	316072	0.4	-	.	g513
Scaffold_16	AUGUSTUS	transcript	314894	316072	0.4	-	.	g513.t1
Scaffold_16	AUGUSTUS	stop_codon	314894	314896	.	-	0	transcript_id "g513.t1"; gene_id "g513";
Scaffold_16	AUGUSTUS	CDS	314894	315108	0.88	-	2	transcript_id "g513.t1"; gene_id "g513";
Scaffold_16	AUGUSTUS	CDS	315583	316072	0.45	-	0	transcript_id "g513.t1"; gene_id "g513";
Scaffold_16	AUGUSTUS	start_codon	316070	316072	.	-	0	transcript_id "g513.t1"; gene_id "g513";
# protein sequence = [MSHSTEELKKLTLTKVRIEVMNAFSGDTIGNSQPQNANKFSNVHCKGNDPKFSQQQHGNGSNQQQKGQNGNDDSNKKK
# RKRGSGKNKKAKKNANAAQADADSMIFSPIGSTVDFGPVRTDLTPSVQDVCKHSIHPPYNPPPNATPFVFKKTRMAINRARNIGVQKSTKWWMNDSGC
# SEHTTFDLSDFIEYEDLEEKVLIATATQLPTLLALERLDNFKDVEVACIRHESLQYSI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g513
###
# start gene g514
Scaffold_16	AUGUSTUS	gene	318756	321072	0.22	+	.	g514
Scaffold_16	AUGUSTUS	transcript	318756	321072	0.22	+	.	g514.t1
Scaffold_16	AUGUSTUS	start_codon	318756	318758	.	+	0	transcript_id "g514.t1"; gene_id "g514";
Scaffold_16	AUGUSTUS	CDS	318756	319367	0.3	+	0	transcript_id "g514.t1"; gene_id "g514";
Scaffold_16	AUGUSTUS	CDS	319484	319823	0.69	+	0	transcript_id "g514.t1"; gene_id "g514";
Scaffold_16	AUGUSTUS	CDS	320778	320816	0.94	+	2	transcript_id "g514.t1"; gene_id "g514";
Scaffold_16	AUGUSTUS	CDS	320888	321072	0.99	+	2	transcript_id "g514.t1"; gene_id "g514";
Scaffold_16	AUGUSTUS	stop_codon	321070	321072	.	+	0	transcript_id "g514.t1"; gene_id "g514";
# protein sequence = [MLELKEQVPEVPLSWYFKYILPPLPDGIDTKKIVASLKKSKAIKNNSWAGIPEHPRDDSRHEDDVYAGLENVFERIVD
# AAKTQIPGLEQKSALKLTPHAKATSERDSTTMPDGHFTSIDEAVRLSRSGEEPSLYQVWNSHEFKKGNERVRDIMNQVRIPYPTSPISVLIMDLLVCF
# SGCLRHATNHGLGPVSAVYVWDVDHESLEPEKLVHVFLAFAFASRTDAGWDPSMSFILPASPTEKRQYRIRVGDKTYITVKMLSDHAADSPIGRGTRV
# WLVIDEAGPPDCYYVLKDVWVDNGRETEDEIRSNLLKDVELKCDFPSIDGGRNFFRQAKISVIEETAFDIHEYVVQALRLPCNNPQVNSIELVGVSRP
# QKRKIDEAESGHEDSSNKR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g514
###
# start gene g515
Scaffold_16	AUGUSTUS	gene	321826	322302	0.99	-	.	g515
Scaffold_16	AUGUSTUS	transcript	321826	322302	0.99	-	.	g515.t1
Scaffold_16	AUGUSTUS	stop_codon	321826	321828	.	-	0	transcript_id "g515.t1"; gene_id "g515";
Scaffold_16	AUGUSTUS	CDS	321826	322302	0.99	-	0	transcript_id "g515.t1"; gene_id "g515";
Scaffold_16	AUGUSTUS	start_codon	322300	322302	.	-	0	transcript_id "g515.t1"; gene_id "g515";
# protein sequence = [MQSPSTSWIPASSGHVGYVASILDPHLQNPERDQSLKTHEEFANIHSHGQMEPSTTHRQPSPSPPFHHFPSSSYSSLS
# GWAGKEEENGLMESANSDSYPLRGEAIGEPVMTLRAPPSLYGFSSNSETIAGSQWKPRREDANWIMNTATDANSGQSSTP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g515
###
# start gene g516
Scaffold_16	AUGUSTUS	gene	324261	326031	0.64	-	.	g516
Scaffold_16	AUGUSTUS	transcript	324261	326031	0.64	-	.	g516.t1
Scaffold_16	AUGUSTUS	stop_codon	324261	324263	.	-	0	transcript_id "g516.t1"; gene_id "g516";
Scaffold_16	AUGUSTUS	CDS	324261	325243	0.79	-	2	transcript_id "g516.t1"; gene_id "g516";
Scaffold_16	AUGUSTUS	CDS	325323	326031	0.68	-	0	transcript_id "g516.t1"; gene_id "g516";
Scaffold_16	AUGUSTUS	start_codon	326029	326031	.	-	0	transcript_id "g516.t1"; gene_id "g516";
# protein sequence = [MDATHSYNPSSTREDENNSTPENQYHRHQYPTTTRFLPPIDAFDDSLDEEEDDDMPPGIMVDELSPLPPRLFIHDDAD
# EDMPPSGIVNNDTLDTQPRNRKEGKVGDDPPPLVLPPATLSRGGSGLTSDGGNPSRTINTRNKPARTGPLTFNYTFLPDMSLATASDGSPGARITEVA
# SDLGGLNPENTTYSSFPTVSGVEYDPGAIHSVAYPTYPTSYPPTSYHHIPRPPNAFILFRIWRSLPPPERAEWEARARIAQEEHRLRYPDWRFSPAGG
# GSGGGGKSRSKGNRGKGRGRGRGRGRLKAGQGGDSVTSSAGNEASADMVEESGQDKANEEPQEPNEGGLRRIQLVPRASSSTSKPVSFRTVDTLSNPK
# DPATTSTQTLSASSAGSAVVVDDPSEISTRNLITSNLQREVVTADVFRTLSATDSNSNMLSTGIDESQSSERESDQPREQGGSETVAIDSLSSASTWY
# PSATAIVKNETDARVDAIADMLAQGFEGRALEVAVREWEVADEKQKERKRKDRERKERREGRERGMKEREKRKGNAKEMDIVGMAAQKSHECG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g516
###
# start gene g517
Scaffold_16	AUGUSTUS	gene	330333	330872	0.69	-	.	g517
Scaffold_16	AUGUSTUS	transcript	330333	330872	0.69	-	.	g517.t1
Scaffold_16	AUGUSTUS	stop_codon	330333	330335	.	-	0	transcript_id "g517.t1"; gene_id "g517";
Scaffold_16	AUGUSTUS	CDS	330333	330515	0.71	-	0	transcript_id "g517.t1"; gene_id "g517";
Scaffold_16	AUGUSTUS	CDS	330600	330872	0.79	-	0	transcript_id "g517.t1"; gene_id "g517";
Scaffold_16	AUGUSTUS	start_codon	330870	330872	.	-	0	transcript_id "g517.t1"; gene_id "g517";
# protein sequence = [MSTVENLKIQASQDLLPIYSNIATNGDSAWTEVEGDGWRDLLPSWTTNGVIGRTRLPLPIALTRPVAPPPLLPIRLYR
# LAHTPLLPTSSALTTVVSAVLALGFAFLVRPIIQTGLEIGLAAAANLLAEGLAAAGLESAAVLVPASVATIGG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g517
###
# start gene g518
Scaffold_16	AUGUSTUS	gene	332844	333548	1	-	.	g518
Scaffold_16	AUGUSTUS	transcript	332844	333548	1	-	.	g518.t1
Scaffold_16	AUGUSTUS	stop_codon	332844	332846	.	-	0	transcript_id "g518.t1"; gene_id "g518";
Scaffold_16	AUGUSTUS	CDS	332844	333548	1	-	0	transcript_id "g518.t1"; gene_id "g518";
Scaffold_16	AUGUSTUS	start_codon	333546	333548	.	-	0	transcript_id "g518.t1"; gene_id "g518";
# protein sequence = [MLFQLILLPAKRDVFDERGLSPDAPNISNATSATTNALVQHVEEDDHGHIHDDPYPIKGKLFVHPSLFEVGTPPEFRD
# VMKNAIESMLEPIIPEILAVYEQNRPDLKLQEPPTRIPLIRIFKNPAITDMYDFRLTFSKYFGHIDKKCLILEGEDKNKVSFEFQPELLTGKMGEDAR
# LKNRLLISFMDGKTVVSSILFFSTTVHSFVLITQDVTRNNGLLSHFKSKTKGTNQGSS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g518
###
# start gene g519
Scaffold_16	AUGUSTUS	gene	335813	336943	1	+	.	g519
Scaffold_16	AUGUSTUS	transcript	335813	336943	1	+	.	g519.t1
Scaffold_16	AUGUSTUS	start_codon	335813	335815	.	+	0	transcript_id "g519.t1"; gene_id "g519";
Scaffold_16	AUGUSTUS	CDS	335813	336943	1	+	0	transcript_id "g519.t1"; gene_id "g519";
Scaffold_16	AUGUSTUS	stop_codon	336941	336943	.	+	0	transcript_id "g519.t1"; gene_id "g519";
# protein sequence = [MSQPENEKQSQSRSRPASRASNPDVESKPNQSRPTSQASNRSQSQNEPTQQDEPRNQDEDQSRSASQDEPKQQSKSRP
# ASQASNKPPSRPASQASHASKPPSKAASRTSSPSVSRDSRPPRTPRGRSRTPRSLSSASGGSDEENRAPTPTVDNPEPELPDVDEEDGEGDNAVYNNA
# KGNKQTREPESFDDDGNGDKDDKDGKGEKEKKKRRRRGKKGTKGFGVDKWPHGDKPGRLEPPHGVNDWPHEDEEGEGVGTSGRVLQRPKGVRDFSPAY
# AASDAGSNVSTASSVSGLSLGDWSRSSSSLAGVDTWPYGDNPGIMVKPLDHWGKPIMNPDGTLVQKENWTGLPSYDELRGMDLDTHDDHVLSSNWNWT
# LMWR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g519
###
# start gene g520
Scaffold_16	AUGUSTUS	gene	337553	338753	0.86	+	.	g520
Scaffold_16	AUGUSTUS	transcript	337553	338753	0.86	+	.	g520.t1
Scaffold_16	AUGUSTUS	start_codon	337553	337555	.	+	0	transcript_id "g520.t1"; gene_id "g520";
Scaffold_16	AUGUSTUS	CDS	337553	337923	0.86	+	0	transcript_id "g520.t1"; gene_id "g520";
Scaffold_16	AUGUSTUS	CDS	338054	338753	0.86	+	1	transcript_id "g520.t1"; gene_id "g520";
Scaffold_16	AUGUSTUS	stop_codon	338751	338753	.	+	0	transcript_id "g520.t1"; gene_id "g520";
# protein sequence = [MFKRIERKRKRQEEEEALGLDEEVKEALGMGGVDSDSEESDDEESGSEENGDENEESEEVEEEEEGDSNDVDEEETED
# VDMKFKDDSDSEEEKPPTISKRALKKVSSNYNSSSLIDIVRYNLTYPSTKDSKIRERHAIWKKEKLQVASKVSSTLKTTPSTTPRRQQRTVTTTTTTS
# SKSSPTIKDPVAASRVDAVDSAQNNNTGGLEKENGARPKSQTQSKSKSKPDAAVTHVKGKAALKSPSLSSAGKSVAGDADVGAEGKKKQAATRRSESN
# VIVKKKKKKKENNGKRDIVLSNEGDINGYEREGAIAKFKPQKSSPTRTNTTVASAIPPKPKRPKHQHTPKDIDTKLTKKKKQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g520
###
# start gene g521
Scaffold_16	AUGUSTUS	gene	345737	346255	0.46	-	.	g521
Scaffold_16	AUGUSTUS	transcript	345737	346255	0.46	-	.	g521.t1
Scaffold_16	AUGUSTUS	stop_codon	345737	345739	.	-	0	transcript_id "g521.t1"; gene_id "g521";
Scaffold_16	AUGUSTUS	CDS	345737	346255	0.46	-	0	transcript_id "g521.t1"; gene_id "g521";
Scaffold_16	AUGUSTUS	start_codon	346253	346255	.	-	0	transcript_id "g521.t1"; gene_id "g521";
# protein sequence = [MIKLFKGTCEAVRAMHEWRPAKGAKKGNTTNEARSNAHQNGSSSNQGQGRSNGNAPQVQSNNSQSRAQTNAGGDDEDD
# DHRFPEPEGDAEGGYSYGPSSRGTGKPSRSGSGSVPLINRDRGEEEGLMGSQADDRGGEALFDGDEDVAGIDGEGGAGERGEIVPYAHRDIKPG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g521
###
# start gene g522
Scaffold_16	AUGUSTUS	gene	348269	348781	0.99	-	.	g522
Scaffold_16	AUGUSTUS	transcript	348269	348781	0.99	-	.	g522.t1
Scaffold_16	AUGUSTUS	stop_codon	348269	348271	.	-	0	transcript_id "g522.t1"; gene_id "g522";
Scaffold_16	AUGUSTUS	CDS	348269	348781	0.99	-	0	transcript_id "g522.t1"; gene_id "g522";
Scaffold_16	AUGUSTUS	start_codon	348779	348781	.	-	0	transcript_id "g522.t1"; gene_id "g522";
# protein sequence = [MLDFKLDNEANQVSVTYTEVKLWVIRDKASRKTMKAYIYIGEQGFGLGDVPPLSDSVPPKKKFNIGKPPQDPTELLGP
# AFFANTQDRDRTLDELRTLNQNYGKIEERYYSYLTEILRRLAWHQTGLLDPMFAFDDELLQKWNDRVDKIVKKINEKKEKKRKDAQAQGKSN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g522
###
# start gene g523
Scaffold_16	AUGUSTUS	gene	356262	359046	0.14	+	.	g523
Scaffold_16	AUGUSTUS	transcript	356262	359046	0.14	+	.	g523.t1
Scaffold_16	AUGUSTUS	start_codon	356262	356264	.	+	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_16	AUGUSTUS	CDS	356262	356322	0.56	+	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_16	AUGUSTUS	CDS	356461	356695	0.88	+	2	transcript_id "g523.t1"; gene_id "g523";
Scaffold_16	AUGUSTUS	CDS	356745	357135	0.35	+	1	transcript_id "g523.t1"; gene_id "g523";
Scaffold_16	AUGUSTUS	CDS	358273	359046	0.84	+	0	transcript_id "g523.t1"; gene_id "g523";
Scaffold_16	AUGUSTUS	stop_codon	359044	359046	.	+	0	transcript_id "g523.t1"; gene_id "g523";
# protein sequence = [MIGQSQSGTGKTAAFVLTMLIIAMGKFTSVQTEYAIKENLPRNATRITAQIIVGTPGTMIDLLRRKVIDASGVRVFVL
# DEADNMLDQDGLGDQTLRVKNLLPKSQVQIILFSATFPDHVRAFASKFAPNANKIELQREELSVDSIRQFYMDCRDEEHKYDILVTLYTLLTIGQSII
# FCQHRHTADRISARMTAEGHHVASLHGAKDATERDQIIDRFREGKEKVCISDIRVLQNDTAADGGVQWPWYLGLYGNYTIWNYAVGGAVCSNNLTPLY
# GEPDVSSGQQAWFIQDHIDAGNASQQKLLLDPSSFVVVQFIGTNDVGIGSFLTADQAANVSLPDVVDCQLDSIRTMHLLGARNFILNSLIPLQLTGLY
# SNSSAPTIYYPEVHDGDAWNKGMYNLVHSLNRMLSDGINVLNAEWAGDGRVEWFNTYEFFEKMYNNPTQYFNGSIPANVTGHCHQCPDPDDYTKCGMY
# VSNIVLSYPLRHINDL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g523
###
# start gene g524
Scaffold_16	AUGUSTUS	gene	363943	365018	0.66	-	.	g524
Scaffold_16	AUGUSTUS	transcript	363943	365018	0.66	-	.	g524.t1
Scaffold_16	AUGUSTUS	stop_codon	363943	363945	.	-	0	transcript_id "g524.t1"; gene_id "g524";
Scaffold_16	AUGUSTUS	CDS	363943	364592	0.97	-	2	transcript_id "g524.t1"; gene_id "g524";
Scaffold_16	AUGUSTUS	CDS	364739	365018	0.66	-	0	transcript_id "g524.t1"; gene_id "g524";
Scaffold_16	AUGUSTUS	start_codon	365016	365018	.	-	0	transcript_id "g524.t1"; gene_id "g524";
# protein sequence = [MQTEYSFQLILRTTSGTFPSNVIRVRTHSIEDTSGISVCFGNCQDEVLLENAKMALREMNAKWSDKIQIDTTHFVCTT
# PAATPNGAQASGNSTGWSLSAYTTSEPNHLPPHTPSAHNPCPKLLILRLLLPPALTVHLCLHRRVNRLPLQTCPPLLRPTLRLLTNQILLAHPIPEEE
# ASSNAESTSPPSRESSASSSQDDSGTSTPTATKRKSRSGTMNRDFRFPPSNATPEAAEVVPARKSPPPALPVHQQGLTDDEGEQTAKMITPSAIEVPP
# PPPVEKERSTGSLGSHQSNDEGDDEVGDTVEVDLN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g524
###
# start gene g525
Scaffold_16	AUGUSTUS	gene	368988	370292	0.89	+	.	g525
Scaffold_16	AUGUSTUS	transcript	368988	370292	0.89	+	.	g525.t1
Scaffold_16	AUGUSTUS	start_codon	368988	368990	.	+	0	transcript_id "g525.t1"; gene_id "g525";
Scaffold_16	AUGUSTUS	CDS	368988	370292	0.89	+	0	transcript_id "g525.t1"; gene_id "g525";
Scaffold_16	AUGUSTUS	stop_codon	370290	370292	.	+	0	transcript_id "g525.t1"; gene_id "g525";
# protein sequence = [MYDEIIADSEGEDELFGPIAPGAIYIMYGISQLRYSFFSYLLAPVIGPKITTPSAASTSANVSTISEFSTSKATAIDS
# ISNFSSTASHAHAASTIITTATATTSRPRPKPKPLTRNIGHTSAISSGNSSNNASTGNASHIEMFDMTLSIADRAKMRKRNKDGNHTSSSSGALAQLD
# ILEISSDDELALLPANKPKKSKKTAEKNTTKKSSSLTTAATTSNHMRYDSPDPDPNHSSSFSLPVVATSPALARNGIRASSIMLPPSDPPQSTPSEDF
# DIPAIETLPNPPSSASASAVSESFVLRAHRDLTDSNIPPTPAPFFADPSSSPFPIDNNPNIPDKNFNNTNSIEIHTTRVMDSVLMPPPPGPSPIVQPE
# AKNSRTKKKKVNDDEDEYMIDGEEWTGTEPKGKGKKSKSKAKVNDKVDTFIDAHLLIFHYFP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g525
###
# start gene g526
Scaffold_16	AUGUSTUS	gene	370616	370996	0.86	+	.	g526
Scaffold_16	AUGUSTUS	transcript	370616	370996	0.86	+	.	g526.t1
Scaffold_16	AUGUSTUS	start_codon	370616	370618	.	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_16	AUGUSTUS	CDS	370616	370996	0.86	+	0	transcript_id "g526.t1"; gene_id "g526";
Scaffold_16	AUGUSTUS	stop_codon	370994	370996	.	+	0	transcript_id "g526.t1"; gene_id "g526";
# protein sequence = [MRKSDDKDEARDAFGAADGVVDLSGGLDLDVDIGQSTSSRSSLRKGKKGKKGRVVMSEDEDEDAVSDMYMEDQGRNAF
# DMVSITTTKPKTKPKSNAKKRVVSGDEEEGAAEDIGSLKVSFSFTVVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g526
###
# start gene g527
Scaffold_16	AUGUSTUS	gene	374442	375494	0.96	-	.	g527
Scaffold_16	AUGUSTUS	transcript	374442	375494	0.96	-	.	g527.t1
Scaffold_16	AUGUSTUS	stop_codon	374442	374444	.	-	0	transcript_id "g527.t1"; gene_id "g527";
Scaffold_16	AUGUSTUS	CDS	374442	375494	0.96	-	0	transcript_id "g527.t1"; gene_id "g527";
Scaffold_16	AUGUSTUS	start_codon	375492	375494	.	-	0	transcript_id "g527.t1"; gene_id "g527";
# protein sequence = [MSLPKRESDLGYRECLFSNLPSRYSQAISILYFPKTRPSDPPLADIPKPLSDRDPHFESPSVNISEHVDTFPLSPRWS
# AASSHAKHPLTDLEASKHSIFVCQFLSHNLHFLTQTRTFSKFSLPAPQSFASGEPIPFFLSLVFPDSPAQAALYTKTITVTLMKQLTVRSAKSPLRKL
# FSRSKSRVSSPKSSKTSTPLHSRSASPIPFEDDSDDVSSHSDSSSSSTVNLDAYGPPVVRRWKLTSGHLETRSEYSEGVYLLRGWISAGELGRGCSWR
# VGQIARLQYFLVVEIASPAWMEDHIPAFHLEKEIEITTDCWETMNRELQSMGGVPTPALGLERCLLERESDYYEVI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g527
###
# start gene g528
Scaffold_16	AUGUSTUS	gene	375801	376121	0.44	-	.	g528
Scaffold_16	AUGUSTUS	transcript	375801	376121	0.44	-	.	g528.t1
Scaffold_16	AUGUSTUS	stop_codon	375801	375803	.	-	0	transcript_id "g528.t1"; gene_id "g528";
Scaffold_16	AUGUSTUS	CDS	375801	376121	0.44	-	0	transcript_id "g528.t1"; gene_id "g528";
Scaffold_16	AUGUSTUS	start_codon	376119	376121	.	-	0	transcript_id "g528.t1"; gene_id "g528";
# protein sequence = [MLNFPAEPDSLDFDTIGSTALSTPAYSPVPSRTEISLDAKRLSPHGPSWVYKTKHMSIDLGRRLWGTSSPAYGLHDKI
# EGSIRLSGPHPELIEDISVTVSSDCYLS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g528
###
# start gene g529
Scaffold_16	AUGUSTUS	gene	377016	377906	0.55	-	.	g529
Scaffold_16	AUGUSTUS	transcript	377016	377906	0.55	-	.	g529.t1
Scaffold_16	AUGUSTUS	stop_codon	377016	377018	.	-	0	transcript_id "g529.t1"; gene_id "g529";
Scaffold_16	AUGUSTUS	CDS	377016	377501	0.59	-	0	transcript_id "g529.t1"; gene_id "g529";
Scaffold_16	AUGUSTUS	CDS	377844	377906	0.83	-	0	transcript_id "g529.t1"; gene_id "g529";
Scaffold_16	AUGUSTUS	start_codon	377904	377906	.	-	0	transcript_id "g529.t1"; gene_id "g529";
# protein sequence = [MIDLAKTLNNDPDMINLAQIFYSHLLFSEGVSAAGDSSSAPAANSTSNSSASAAAAIAPSTSTTSATVDNAGTGAAPA
# TGTSTVSAAANPAVSSTVAVDSSSGSASGFQLQNGEDAIQLNSQFASLTATSSCTDGQQACVGGGFAQCVGGTFQITQCAGGTQCFALPLVNNPGTVC
# FSSSEQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g529
###
# start gene g530
Scaffold_16	AUGUSTUS	gene	389711	390654	0.5	+	.	g530
Scaffold_16	AUGUSTUS	transcript	389711	390654	0.5	+	.	g530.t1
Scaffold_16	AUGUSTUS	start_codon	389711	389713	.	+	0	transcript_id "g530.t1"; gene_id "g530";
Scaffold_16	AUGUSTUS	CDS	389711	389842	0.7	+	0	transcript_id "g530.t1"; gene_id "g530";
Scaffold_16	AUGUSTUS	CDS	389968	390654	0.6	+	0	transcript_id "g530.t1"; gene_id "g530";
Scaffold_16	AUGUSTUS	stop_codon	390652	390654	.	+	0	transcript_id "g530.t1"; gene_id "g530";
# protein sequence = [MPLLTTKIEGKGNGIKTVIPNMADVARALSRPPAILPNSSAANLNPETELIILKQGRSEDIIRDCKACGERTGVDMRH
# KLTTFILKNPPVKVKKGKKKTGTGDAAAGVGGGGGDSPDAEASPAENGEESDDELTKKIKAEAKDLNNETTLAKEDWSADTSPEAVKQRIKALEGGMS
# GVSLGGDDEGSDDDANSPYGQLGKWVEENRDSHEGDTKTFLVAVYKKAEDLGIEKKHKSVLVLAQALFTDDVLNEIPKYGPLFAKVRYYQIHVSNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g530
###
# start gene g531
Scaffold_16	AUGUSTUS	gene	400400	400687	0.89	+	.	g531
Scaffold_16	AUGUSTUS	transcript	400400	400687	0.89	+	.	g531.t1
Scaffold_16	AUGUSTUS	start_codon	400400	400402	.	+	0	transcript_id "g531.t1"; gene_id "g531";
Scaffold_16	AUGUSTUS	CDS	400400	400687	0.89	+	0	transcript_id "g531.t1"; gene_id "g531";
Scaffold_16	AUGUSTUS	stop_codon	400685	400687	.	+	0	transcript_id "g531.t1"; gene_id "g531";
# protein sequence = [MFMRYRGGGVGHIDLQSSEDYGVSPGSEDEDDSDKLVMVAGGRSNPDDEEQLDNEEFDSDDDSEAAEHNWLLDYLDPS
# HQYDSSDDSNESESSSE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g531
###
# start gene g532
Scaffold_16	AUGUSTUS	gene	403707	404879	0.41	-	.	g532
Scaffold_16	AUGUSTUS	transcript	403707	404879	0.41	-	.	g532.t1
Scaffold_16	AUGUSTUS	stop_codon	403707	403709	.	-	0	transcript_id "g532.t1"; gene_id "g532";
Scaffold_16	AUGUSTUS	CDS	403707	404181	0.6	-	1	transcript_id "g532.t1"; gene_id "g532";
Scaffold_16	AUGUSTUS	CDS	404580	404685	0.71	-	2	transcript_id "g532.t1"; gene_id "g532";
Scaffold_16	AUGUSTUS	CDS	404786	404879	0.45	-	0	transcript_id "g532.t1"; gene_id "g532";
Scaffold_16	AUGUSTUS	start_codon	404877	404879	.	-	0	transcript_id "g532.t1"; gene_id "g532";
# protein sequence = [MASSSFVKGLSLDIDPSHNIPAYFVNLLDVSVTTFEVLELEFYFWMAEVHEDPFTHGPPEQARSGNCAPNTSVLRFEE
# KDEAEIQAVRIYQSPRIGLGLSHPSVSSSFDNPRVVFLSKPYRYFIHPELLTSNGRPQTFLGILSSLKAASPDKPEPKKLIDDIRDKSGMKTHTVAKY
# LEYYSSGHGCSNLKSFIGSASKDSPSNYLRLMGILWDERSRTVKNTVD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g532
###
# start gene g533
Scaffold_16	AUGUSTUS	gene	409194	410091	0.23	+	.	g533
Scaffold_16	AUGUSTUS	transcript	409194	410091	0.23	+	.	g533.t1
Scaffold_16	AUGUSTUS	start_codon	409194	409196	.	+	0	transcript_id "g533.t1"; gene_id "g533";
Scaffold_16	AUGUSTUS	CDS	409194	409635	0.24	+	0	transcript_id "g533.t1"; gene_id "g533";
Scaffold_16	AUGUSTUS	CDS	409691	410091	0.25	+	2	transcript_id "g533.t1"; gene_id "g533";
Scaffold_16	AUGUSTUS	stop_codon	410089	410091	.	+	0	transcript_id "g533.t1"; gene_id "g533";
# protein sequence = [MLSAALVTLLLSLSTTQANSSWGHPTNADPFSYDPGFDIKAVATIAKALPSHSWEYGTATEALLELYNSSYSVFGSAP
# FPVPFLVPDGVPSLSYAAQNIVLGSGANGLSDGDGAVGDPASLGVGAIMLGKTNASFAQGANEEFAYIAALGRLDVYGSPFLAYYAADTYNTSLLRLA
# VDQCGLYRQALKSNLTSSVSYDGLWEHIVGPQSADFGLWGTGNGWASAGMTRVLATVINAPSSTTYGWKDNAVRNLTSWIQEIVDGAMGAPMIDGLLR
# NYLNDT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g533
###
# start gene g534
Scaffold_16	AUGUSTUS	gene	417212	418685	0.57	-	.	g534
Scaffold_16	AUGUSTUS	transcript	417212	418685	0.57	-	.	g534.t1
Scaffold_16	AUGUSTUS	stop_codon	417212	417214	.	-	0	transcript_id "g534.t1"; gene_id "g534";
Scaffold_16	AUGUSTUS	CDS	417212	418226	0.57	-	1	transcript_id "g534.t1"; gene_id "g534";
Scaffold_16	AUGUSTUS	CDS	418351	418685	0.57	-	0	transcript_id "g534.t1"; gene_id "g534";
Scaffold_16	AUGUSTUS	start_codon	418683	418685	.	-	0	transcript_id "g534.t1"; gene_id "g534";
# protein sequence = [MSTDTAPSTVFDEALSRSRQSGAGSLASIWAPQPQPLDTTWPKALDSFSRAAESETQLATRPELQNHSGPMITREDVF
# GPSPPKDMPSVGAIGDGRKKVTPDFEPHTVCIFLFETSPGTPDFSPVSISSALLTPTDLSPTRPCSDINLKQQLQMPYEMMAAGTRGPAFFTHPALLF
# EPGSPTRLSNSPPYLSSQASISTANSGGNNYSIISNASSSPIFRTYNHEQSSPTSPSLGSYPSYPSAPQGNFTSNHQLYAALSAQNLSQTNVAHRADV
# HAATGALRSSIHGTIGSSLSSGDWHIPQQVLPAHQLLSQSTCNQPQQFQQLPLNGEWLRTEDASLLAHNSLVPSAPSSCLGSTTPNVFGLGLTLDATP
# NYVSGVSNGGSGLEDSIHAPPSLRSSTSSSGISSQLHQQSHAHVDERHHRHQSSTGNAGHVREPSSPTHGAHEVSRI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g534
###
# start gene g535
Scaffold_16	AUGUSTUS	gene	423098	423933	0.86	-	.	g535
Scaffold_16	AUGUSTUS	transcript	423098	423933	0.86	-	.	g535.t1
Scaffold_16	AUGUSTUS	stop_codon	423098	423100	.	-	0	transcript_id "g535.t1"; gene_id "g535";
Scaffold_16	AUGUSTUS	CDS	423098	423753	0.99	-	2	transcript_id "g535.t1"; gene_id "g535";
Scaffold_16	AUGUSTUS	CDS	423855	423933	0.86	-	0	transcript_id "g535.t1"; gene_id "g535";
Scaffold_16	AUGUSTUS	start_codon	423931	423933	.	-	0	transcript_id "g535.t1"; gene_id "g535";
# protein sequence = [MEQADIGDESFPEDINSSSKPSFPRLQNPPEGVILVLVGKKVVREAWEIEAERKAKVRAAKFAQEEGIEWGNSPRRPV
# NKSSGSSSGVVEKEAWEIEAEQGLLTEGGKRRAKAQAAAAAGTSGSTSASTAKRPVSKAEIVKEAWEIEAEQGLLTEGGRRRARAAALAAEAKEKEKA
# ALSTSSPAPSLANSQYYTRATNALALPASTPPSKAISHGRAFSFNPSSSAFTGSPSPNDLLCHYPLHL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g535
###
# start gene g536
Scaffold_16	AUGUSTUS	gene	426053	427674	0.92	-	.	g536
Scaffold_16	AUGUSTUS	transcript	426053	427674	0.92	-	.	g536.t1
Scaffold_16	AUGUSTUS	stop_codon	426053	426055	.	-	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_16	AUGUSTUS	CDS	426053	427267	1	-	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_16	AUGUSTUS	CDS	427338	427502	0.95	-	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_16	AUGUSTUS	CDS	427582	427674	0.97	-	0	transcript_id "g536.t1"; gene_id "g536";
Scaffold_16	AUGUSTUS	start_codon	427672	427674	.	-	0	transcript_id "g536.t1"; gene_id "g536";
# protein sequence = [MPAFTKSIPVALLVGASALASPIAPQNMTGQDLCITPCILSTGHQICALPYNDINTDDPATFTKFCPSNIDISSFEQS
# VKECKIALNGNYVNGNASLNSSSTSNSNSTLQSNAAQSTVLNAATPQNGSAPGVMENGSVGLQTNGPARTSVSGPAENTRVGLAQTNGPARVSESASE
# SGSPSSTLGNSLAADLSASSTNSDLSTFGVDTGAGSSLSPGTITGLSASPSLPSHSGVDLSTLTGLANGLGLSYGVPSVNTGSTTASAFQHLSADVQP
# DSISSPARNGVTNTTNGHSTGTGTSVTRPNQVTNSVSHQSSSVSPPDVSESANGQIGTSPSSRVAVADPVNKNTAGGPSGRVGITRPAQPSTPSIPSI
# SGPLDVSQSTGSQTGSSTGVEVSGSAKPGNASGTSAHVNVASSGAAQSSPSSSDRLDIPSADEQVGSSVSNNLETSVSNGANIGQTATQKASLRCRRI
# AAHRYSKVKVWLQEYDFCDI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g536
###
# start gene g537
Scaffold_16	AUGUSTUS	gene	429392	429895	0.79	-	.	g537
Scaffold_16	AUGUSTUS	transcript	429392	429895	0.79	-	.	g537.t1
Scaffold_16	AUGUSTUS	stop_codon	429392	429394	.	-	0	transcript_id "g537.t1"; gene_id "g537";
Scaffold_16	AUGUSTUS	CDS	429392	429700	0.96	-	0	transcript_id "g537.t1"; gene_id "g537";
Scaffold_16	AUGUSTUS	CDS	429785	429895	0.79	-	0	transcript_id "g537.t1"; gene_id "g537";
Scaffold_16	AUGUSTUS	start_codon	429893	429895	.	-	0	transcript_id "g537.t1"; gene_id "g537";
# protein sequence = [MTGDLYIRDALDGTSLGYVSSAFNSFGEYGPMRLLGNRAGLIPLDQNGPDPDLPFMVGITGFANDASGLRPGKYKCAR
# KLFAVFANLERRSSYVYLGAGNRTAVDVSPDPETTRLAGLQGTRKGLRVQLYGCLASNEED]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g537
###
# start gene g538
Scaffold_16	AUGUSTUS	gene	432621	433633	0.53	+	.	g538
Scaffold_16	AUGUSTUS	transcript	432621	433633	0.53	+	.	g538.t1
Scaffold_16	AUGUSTUS	start_codon	432621	432623	.	+	0	transcript_id "g538.t1"; gene_id "g538";
Scaffold_16	AUGUSTUS	CDS	432621	432724	0.53	+	0	transcript_id "g538.t1"; gene_id "g538";
Scaffold_16	AUGUSTUS	CDS	432808	433633	0.97	+	1	transcript_id "g538.t1"; gene_id "g538";
Scaffold_16	AUGUSTUS	stop_codon	433631	433633	.	+	0	transcript_id "g538.t1"; gene_id "g538";
# protein sequence = [MSLASRTYLINAQECIPHICEQQTDSHINNAALGCAEDILLQSTEPFFSEASSGPSVSGVSRSSTPALSFASSRSSSR
# SPPTKLHHGPCLCNEDSGIESFNCLAELNGTPSEASTTFANAGSITTVGNDNASWDSPVGHPISGMYPNYSPPYPEFGMSYPSPPSKSSEAAPLHESN
# ECFDDGHLNNKETLAPPPSPPLRRLKRKVRSHRREDSDDEYEEPEDTGDDETYDPASSAGHGNLTTGKKRKAASNETTEERTCKKCGLVFTRSADIGR
# HCASAHSEMSEEMKQECTCVLCLKRLARPDAMNVT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g538
###
# start gene g539
Scaffold_16	AUGUSTUS	gene	436023	437171	0.21	-	.	g539
Scaffold_16	AUGUSTUS	transcript	436023	437171	0.21	-	.	g539.t1
Scaffold_16	AUGUSTUS	stop_codon	436023	436025	.	-	0	transcript_id "g539.t1"; gene_id "g539";
Scaffold_16	AUGUSTUS	CDS	436023	437171	0.21	-	0	transcript_id "g539.t1"; gene_id "g539";
Scaffold_16	AUGUSTUS	start_codon	437169	437171	.	-	0	transcript_id "g539.t1"; gene_id "g539";
# protein sequence = [MTDVSPPNSSNPNSGRLNSSFSFGGSPTSPQNNTGNAFLAVEASSLRRSKSDSYGRGGGHVRGSRSEDLRFGNVPGIN
# IADSGTGQQSNIGSGQGNGLLFPPSAHGDFIQHQQEQQRSHTPQYLLPRGHSHSYSYSGSGLSNNYEIGSLGLGSALPNLGAGMGLSSHNMGPSQRQG
# SPMSHIRRTSSGSRSERGISSWGLSNSGFDTGLGVNLGPGSTGGSNAGSISGSLRASPYPSPNVSPRGRYTELPPHDTLDFGLLNGGNPVAGFSSSSR
# GGTPNMPTMGLPSLPPLPSPGNSGKSMPSVVTVGGANVPLVVSKPTVTTGRTKAASHNRRKQEATFVCPVPGCGSTFTRSFNLKGEQLLLIQSYQSVN
# SVVGRSHSIS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g539
###
# start gene g540
Scaffold_16	AUGUSTUS	gene	437478	438392	0.25	-	.	g540
Scaffold_16	AUGUSTUS	transcript	437478	438392	0.25	-	.	g540.t1
Scaffold_16	AUGUSTUS	stop_codon	437478	437480	.	-	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_16	AUGUSTUS	CDS	437478	438392	0.25	-	0	transcript_id "g540.t1"; gene_id "g540";
Scaffold_16	AUGUSTUS	start_codon	438390	438392	.	-	0	transcript_id "g540.t1"; gene_id "g540";
# protein sequence = [MDVRSGGSPFINDLVDFNNPPASPPVTFEVIPDNNEPFIHNNGGSQSPSFTGAELDISSYNNSPFSGHSELSFDDDLD
# YPPSAGFGLFSAENHHSAARYDPSEYDNPTGNSLLMFNDNDYLSSYQGSYGDYSSPGSSNGSGNEGIRSRASSVSSNHQQPLSHLSPNLQAQHLPRSP
# HMAVAQSFEGMSFHSPAWGNEPLPEHSPRQAQFQSDVHPRSLSPQRAAGKPQSPPRLLMPDDEVPTINAPDDGDGAAGPALRIVPATPVSGGGAVTNQ
# VGEPGNMPFRRGQFSYFRSAHIAHVYFCRQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g540
###
# start gene g541
Scaffold_16	AUGUSTUS	gene	442795	443496	0.92	-	.	g541
Scaffold_16	AUGUSTUS	transcript	442795	443496	0.92	-	.	g541.t1
Scaffold_16	AUGUSTUS	stop_codon	442795	442797	.	-	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_16	AUGUSTUS	CDS	442795	443496	0.92	-	0	transcript_id "g541.t1"; gene_id "g541";
Scaffold_16	AUGUSTUS	start_codon	443494	443496	.	-	0	transcript_id "g541.t1"; gene_id "g541";
# protein sequence = [MNHLQSFLTGARYSALDSQIPSWAALYDVDDTATFSHYSYTRLRANRSLREADLVKRLGILDRRTCELIADSGESPLT
# TSLASKNPSKGIVTHGLGDNEQDAKEWFGKGVEILRSNQGWARTRIFKCIDNLRTGVSVPPSPEAQTVPRFFAVHGAPNWDALRVAISLMSFLAEFTT
# FTTSDIASESFIQVGADSLLSLRSSDVPLSDLRKWGLYKAYPGIAQGNIKGLTDHSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g541
###
# start gene g542
Scaffold_16	AUGUSTUS	gene	445778	446182	0.7	-	.	g542
Scaffold_16	AUGUSTUS	transcript	445778	446182	0.7	-	.	g542.t1
Scaffold_16	AUGUSTUS	stop_codon	445778	445780	.	-	0	transcript_id "g542.t1"; gene_id "g542";
Scaffold_16	AUGUSTUS	CDS	445778	446182	0.7	-	0	transcript_id "g542.t1"; gene_id "g542";
Scaffold_16	AUGUSTUS	start_codon	446180	446182	.	-	0	transcript_id "g542.t1"; gene_id "g542";
# protein sequence = [MCRNVWPGDMGISTHTELVSTFDLESSANSLLVMYSTQDPTTGALQYSGPPINAVGSDTYICWSLIGTHSVYMYTGDL
# DFVEKIWANYTNALAFLQSQVDETRLMNVPNSFANDWGRADGQGHNVAANALLYEV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g542
###
# start gene g543
Scaffold_16	AUGUSTUS	gene	446297	447118	0.39	-	.	g543
Scaffold_16	AUGUSTUS	transcript	446297	447118	0.39	-	.	g543.t1
Scaffold_16	AUGUSTUS	stop_codon	446297	446299	.	-	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_16	AUGUSTUS	CDS	446297	446836	0.91	-	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_16	AUGUSTUS	CDS	446921	447118	0.41	-	0	transcript_id "g543.t1"; gene_id "g543";
Scaffold_16	AUGUSTUS	start_codon	447116	447118	.	-	0	transcript_id "g543.t1"; gene_id "g543";
# protein sequence = [MNGILPLATIFLFASATAKAPAGPWDAFNFAPATRSFVPKSVYTTVGLVAGAENLLGNSSSTEGAIHDLVRKVGGRLS
# FQVDSTTSPAISLSFTESAMFISPTESDDSCTVSPDHDLDGVLSVPLPLAANKTFTQTVGDQRGGFRFLTIVSDGDAPVTISNVTVNATFMPQMDDLS
# AYTGYFYAQDSDFHDQDFLTKLWYGGAYTVQMNTIDSHEARQQPCPVPSGKVSLMIVLAITLEFCMYAL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g543
###
# start gene g544
Scaffold_16	AUGUSTUS	gene	449707	450213	0.97	-	.	g544
Scaffold_16	AUGUSTUS	transcript	449707	450213	0.97	-	.	g544.t1
Scaffold_16	AUGUSTUS	stop_codon	449707	449709	.	-	0	transcript_id "g544.t1"; gene_id "g544";
Scaffold_16	AUGUSTUS	CDS	449707	450213	0.97	-	0	transcript_id "g544.t1"; gene_id "g544";
Scaffold_16	AUGUSTUS	start_codon	450211	450213	.	-	0	transcript_id "g544.t1"; gene_id "g544";
# protein sequence = [MSSPSKPVGIPKRGSQSQSVTPAGTPDLRVLRAQVISGTPPVGLSIPPPNIPPRTSSPVPLGQLVEGTPASSSTARIQ
# LAGPSRTDSPLNLPLDLDDLPDEEKAKILRRHLVSKGERERERRENPEVTSLSEPVSQTRRSSGSGRIAREESEPFPVPYAAPGADVTCV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g544
###
# start gene g545
Scaffold_16	AUGUSTUS	gene	451035	452998	0.23	+	.	g545
Scaffold_16	AUGUSTUS	transcript	451035	452998	0.23	+	.	g545.t1
Scaffold_16	AUGUSTUS	start_codon	451035	451037	.	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_16	AUGUSTUS	CDS	451035	451215	0.4	+	0	transcript_id "g545.t1"; gene_id "g545";
Scaffold_16	AUGUSTUS	CDS	451318	451350	0.23	+	2	transcript_id "g545.t1"; gene_id "g545";
Scaffold_16	AUGUSTUS	CDS	451401	452998	0.83	+	2	transcript_id "g545.t1"; gene_id "g545";
Scaffold_16	AUGUSTUS	stop_codon	452996	452998	.	+	0	transcript_id "g545.t1"; gene_id "g545";
# protein sequence = [MSDRTGGPTSSNYAHRRRPENYEEEDEAGSDGEAVLALKARREPQDDEEARLHAQDLQLAHPNQHILPNGVRASPPFR
# HKKFAAASISASSPMTTNTSDSSTISAGLLPPALNPLVPISAYGERKAAKRARRQLKRESASASAHTSHPSQHSHTMSNTQYPSLLSKLSSRTRSLYL
# AGTDPETANSPPAFRCPRHLHTGCEICVEAKEEFSVKGAAGKGKGRDRAGSTSTFAAPSWPSTSSSMGLGIPSNQKVTPVGIAPDGGGVSGYQDPSIA
# GGCSVGVGEGLLKPSMNGSVLRRRTASPYTRRSSRGGGGESEADSTGSGYTKLSELLPRFLRLSALVSTELGREVREGREGKDSDELRSSTSSGSTGG
# GTTKQGVGGTFATLAPSREWYHLLAGILTRAALQGYLTAGWRGVNAVECLMGVGLGIDLPGVRSTFGAEMRTGVGESVTDPPREASPSSSAEEVDADG
# NFEAETDIFAEDEDLFKEFDPDELPSLQQAVAILFPSLGLIGNAESEDRWSDGDFRNHGELTKTYTTRRTRQPNAAEIEFATGMNERMRSVRILSLIY
# TLHTHCCLSFSKYQTQHLTFQHIWRTLLGHILQNR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g545
###
# start gene g546
Scaffold_16	AUGUSTUS	gene	453194	453952	0.78	+	.	g546
Scaffold_16	AUGUSTUS	transcript	453194	453952	0.78	+	.	g546.t1
Scaffold_16	AUGUSTUS	start_codon	453194	453196	.	+	0	transcript_id "g546.t1"; gene_id "g546";
Scaffold_16	AUGUSTUS	CDS	453194	453952	0.78	+	0	transcript_id "g546.t1"; gene_id "g546";
Scaffold_16	AUGUSTUS	stop_codon	453950	453952	.	+	0	transcript_id "g546.t1"; gene_id "g546";
# protein sequence = [MASTSLTMDSLVHSNPTTPTLSHPIPPRSTSQDHPQSTSSKKPSIDLYFIHPSVNPSFSFGTGSADNAVNTVSRENYN
# NVYNHVTNLTSAQSLPRSDTRQNPREQSFSAPISTPIYSTSLPTSHPQSRSNSFPQSYVGSSTQYQGRPSVTPRSTSNPIPTHVPTHHNILPASSPQY
# PYYSQNMISSQTMSPSSAGTAQQQQIPVWNAATGAWMPTATSQDMNQASSTEVASGKRTRSPERGQGAGPNAKRPK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g546
###
# start gene g547
Scaffold_16	AUGUSTUS	gene	458346	460201	0.46	+	.	g547
Scaffold_16	AUGUSTUS	transcript	458346	460201	0.46	+	.	g547.t1
Scaffold_16	AUGUSTUS	start_codon	458346	458348	.	+	0	transcript_id "g547.t1"; gene_id "g547";
Scaffold_16	AUGUSTUS	CDS	458346	459466	0.46	+	0	transcript_id "g547.t1"; gene_id "g547";
Scaffold_16	AUGUSTUS	CDS	459559	460201	0.62	+	1	transcript_id "g547.t1"; gene_id "g547";
Scaffold_16	AUGUSTUS	stop_codon	460199	460201	.	+	0	transcript_id "g547.t1"; gene_id "g547";
# protein sequence = [MTAKFPMDIPFGPFEAHSNIDPATPPTLPNLNTPNPPLGEAVGCSGSMSPTMASVILENVNTIPRTAEADLPPIPPLD
# LEPAPDLPPRQRSPHLQVSFPAPSRRSRPRQHRTRVQGPTPASQDDPYPTQGSEESLVGMEAHSLPLDIPGPRYQPYRVPRARTGSGFHHPPQAISTS
# DPDLEAGHHKGHLPTDQEQLPPWAQEQPQTITAMLDMAWYSGGKTSVPVESRLSHSMPLHSAHPAAENADSQLLTKETGMIGPANHAPNPGDLVLWNY
# VPQKIYPGARNHHLVQGSFSPQSGTENIPQQLQGVGREQVARGSLSAELQDSRLEIRENGTGSSTSKNHELFLRAAPAAGGPTSKSKRESPGGTGKLS
# KIPSATIPSPFPANAARPSSSGSHDHAAHLARPSSQIDMGMGTGTSPGTVNMGGNDPDLGIDNMALSAGDMAPGMAAHSQILDGIPQSMASPPGPPVL
# MHLSALQQAQDHHYLQEVHLPQAPSRQQAFMLGDEHRLPTETRMRTGSSYGRPFLSLETSLEVDPSKLRIGAEISTGYDYSNVDHNARKMGDIRGLGS
# SREDDPPVRLDTREPPAYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g547
###
# start gene g548
Scaffold_16	AUGUSTUS	gene	467169	468035	0.95	-	.	g548
Scaffold_16	AUGUSTUS	transcript	467169	468035	0.95	-	.	g548.t1
Scaffold_16	AUGUSTUS	stop_codon	467169	467171	.	-	0	transcript_id "g548.t1"; gene_id "g548";
Scaffold_16	AUGUSTUS	CDS	467169	468035	0.95	-	0	transcript_id "g548.t1"; gene_id "g548";
Scaffold_16	AUGUSTUS	start_codon	468033	468035	.	-	0	transcript_id "g548.t1"; gene_id "g548";
# protein sequence = [MDSSFDSVRVSGESDSLLSFSDARKQLLTSDALTNSSQFNPTLFTANSPHFDSVVSHGDLSYVAHSAVASSNTDHQSP
# LTNSSPTYQFEPPNLRNTATTQCPSEIPSANRWSGYSSPTSVPSSVSESPTVYTPSLLPYARYGLPFPEPLVAYNVSTPSPASADVEAVYPVQRSANI
# DTEFFPSTHERQRTHFRRLSPADRREQRKSHNVSRFSNRSSSTHIHDQSRSPEIVEWSNTALYVAQQKTMAFGELSVGLKKPFSPVLPLPALLFLPDL
# DLRFIMEEGSVTAI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g548
###
# start gene g549
Scaffold_16	AUGUSTUS	gene	470317	471492	0.82	-	.	g549
Scaffold_16	AUGUSTUS	transcript	470317	471492	0.82	-	.	g549.t1
Scaffold_16	AUGUSTUS	stop_codon	470317	470319	.	-	0	transcript_id "g549.t1"; gene_id "g549";
Scaffold_16	AUGUSTUS	CDS	470317	471310	0.93	-	1	transcript_id "g549.t1"; gene_id "g549";
Scaffold_16	AUGUSTUS	CDS	471482	471492	0.83	-	0	transcript_id "g549.t1"; gene_id "g549";
Scaffold_16	AUGUSTUS	start_codon	471490	471492	.	-	0	transcript_id "g549.t1"; gene_id "g549";
# protein sequence = [MYKRYCIIVQGPDPVSEDLLSVHSHDPRAEDCLLCPVNNVQEASAEYLTIVTQNFLGSELTNSEFGIRHDDTRPVSTE
# SAFFFYDSLSGPVVSSSDENISISATFDNLKLNDPLANAVNLPSSNPPAPPLPSATNVTLAFKDHHLRVQHIALKNSLIWTMDGEVSPAHLFPDSLGG
# PIHLTTMRGPVSCGRGRSLSSSAAYTTWRRRSPSVSSFASEGYFIDPGRGRGSSVVSDASESSSEHIDPRFLGPDIQSSTICGLPFCFNSQGSEGDEG
# RIRHTQVATKKTRMASEKRRKKGARFHCKVPGCHGSFTAKHNLISELDELYIHTRYQGYS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g549
###
# start gene g550
Scaffold_16	AUGUSTUS	gene	474132	474479	1	+	.	g550
Scaffold_16	AUGUSTUS	transcript	474132	474479	1	+	.	g550.t1
Scaffold_16	AUGUSTUS	start_codon	474132	474134	.	+	0	transcript_id "g550.t1"; gene_id "g550";
Scaffold_16	AUGUSTUS	CDS	474132	474479	1	+	0	transcript_id "g550.t1"; gene_id "g550";
Scaffold_16	AUGUSTUS	stop_codon	474477	474479	.	+	0	transcript_id "g550.t1"; gene_id "g550";
# protein sequence = [MVADLIRDSTVGQFINFISNGRFLPYEDQRPDFNIPTHFLTKQLATSDASTLCGDANENKKTSGAVTPSTVFTRENTF
# VVGEKLAEIDMKLDEKNDTSDPNVVGWYGDDDPDNPR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g550
###
# start gene g551
Scaffold_16	AUGUSTUS	gene	478541	478954	0.78	-	.	g551
Scaffold_16	AUGUSTUS	transcript	478541	478954	0.78	-	.	g551.t1
Scaffold_16	AUGUSTUS	stop_codon	478541	478543	.	-	0	transcript_id "g551.t1"; gene_id "g551";
Scaffold_16	AUGUSTUS	CDS	478541	478954	0.78	-	0	transcript_id "g551.t1"; gene_id "g551";
Scaffold_16	AUGUSTUS	start_codon	478952	478954	.	-	0	transcript_id "g551.t1"; gene_id "g551";
# protein sequence = [MKRNQPDLNDAERIEAAAYAKMSVLLLLDAASSELGLSGIPYNVRFTENTPFPCSKADAEAKGFSLNIAGIPTFQDAV
# GQAPMGCVAVAAKSQGTAVIERITPELREFYTGQLIPHQESLFWTRMRQFADYLKDWDP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g551
###
# start gene g552
Scaffold_16	AUGUSTUS	gene	485235	485813	0.5	+	.	g552
Scaffold_16	AUGUSTUS	transcript	485235	485813	0.5	+	.	g552.t1
Scaffold_16	AUGUSTUS	start_codon	485235	485237	.	+	0	transcript_id "g552.t1"; gene_id "g552";
Scaffold_16	AUGUSTUS	CDS	485235	485813	0.5	+	0	transcript_id "g552.t1"; gene_id "g552";
Scaffold_16	AUGUSTUS	stop_codon	485811	485813	.	+	0	transcript_id "g552.t1"; gene_id "g552";
# protein sequence = [MRSNHLSWSPITAMNSVQPRILIVGAGWAGFILSQQLDDSKYDITIIAPHQTFAYTPLLASAATGLFFSRLAEEPIRR
# AHRHMTYYRALATAADLDQKSVTCIPSILQPSGRDIPDANHPFTVEYDILIIAPGCVNQTFNTPGATEHCFFLKTVPDAEAIKAKLLSLLEVASLPTT
# SPERAKELLHIAVVGK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g552
###
# start gene g553
Scaffold_16	AUGUSTUS	gene	485922	486356	0.5	+	.	g553
Scaffold_16	AUGUSTUS	transcript	485922	486356	0.5	+	.	g553.t1
Scaffold_16	AUGUSTUS	start_codon	485922	485924	.	+	0	transcript_id "g553.t1"; gene_id "g553";
Scaffold_16	AUGUSTUS	CDS	485922	486356	0.5	+	0	transcript_id "g553.t1"; gene_id "g553";
Scaffold_16	AUGUSTUS	stop_codon	486354	486356	.	+	0	transcript_id "g553.t1"; gene_id "g553";
# protein sequence = [MSKTYPHLAGLPSITIHDVAPEILGVFHQKLKAHALRSFRKHGVEVKTNSHIEKIEEDALYTKEDGRIPVGMVAWATG
# NRQCDFVESLHGLSKATRLGRILTDQRLRALKEDQSVLENVYALGDAADIFGNGLPTTAEGMLHAI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g553
###
# start gene g554
Scaffold_16	AUGUSTUS	gene	489013	490561	0.39	+	.	g554
Scaffold_16	AUGUSTUS	transcript	489013	490561	0.39	+	.	g554.t1
Scaffold_16	AUGUSTUS	start_codon	489013	489015	.	+	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_16	AUGUSTUS	CDS	489013	489123	0.52	+	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_16	AUGUSTUS	CDS	489239	489673	0.44	+	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_16	AUGUSTUS	CDS	489866	490561	0.81	+	0	transcript_id "g554.t1"; gene_id "g554";
Scaffold_16	AUGUSTUS	stop_codon	490559	490561	.	+	0	transcript_id "g554.t1"; gene_id "g554";
# protein sequence = [MDAPARPRHILVIGGGVCGLVTLRNLVERGLFDKVELRPRWPSPAYPGLIGNVLPEFLSFSGAPFPQPPSTPQQPFPT
# LRETHDYLRTFASRYLEQGKIHLNTEVVRVEELQDGKGWNVTTRDWSADGKGQISSQVWDGVVICTGWYDDPLWPGTEGMDILKEKGLALHAKWYRGP
# QKYAGKDVVPVKRFALQGDGKITAELQDDTTIQDIDVVFVGSGYFPNPSFLYVRDPNSSTGSLAPLMSQVSRDAPQSRRIPSLHRHILYAYNPSLAFI
# GSVMCFTPFTIADVSSTWLALAWTNEVAYPSTPEELLQFEKDRIVDVEKRRGIEAQETGREASSLFTYSALGTSEEDYAAGLKREIVAARPELKDSLP
# EWSDERRTWRQSMYPVKYQSLQWLKTQRERIVDNGVINDNV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g554
###
# start gene g555
Scaffold_16	AUGUSTUS	gene	490784	491212	0.8	+	.	g555
Scaffold_16	AUGUSTUS	transcript	490784	491212	0.8	+	.	g555.t1
Scaffold_16	AUGUSTUS	start_codon	490784	490786	.	+	0	transcript_id "g555.t1"; gene_id "g555";
Scaffold_16	AUGUSTUS	CDS	490784	491212	0.8	+	0	transcript_id "g555.t1"; gene_id "g555";
Scaffold_16	AUGUSTUS	stop_codon	491210	491212	.	+	0	transcript_id "g555.t1"; gene_id "g555";
# protein sequence = [MTPLPPVITLEEHYASPNLLAIRPLNEFSYVLPKLIDLDEERITDMDAGAVTLQVLSHVATAVPSPDLARSTNDELYA
# AIQKHPERLAAFAILPMADPSDAAAELSRVTKDLHFVGALIDNHLDGRFYDDVFFGLYLSVHRN]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g555
###
# start gene g556
Scaffold_16	AUGUSTUS	gene	499135	500351	0.16	+	.	g556
Scaffold_16	AUGUSTUS	transcript	499135	500351	0.16	+	.	g556.t1
Scaffold_16	AUGUSTUS	start_codon	499135	499137	.	+	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_16	AUGUSTUS	CDS	499135	499614	0.33	+	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_16	AUGUSTUS	CDS	499998	500351	0.39	+	0	transcript_id "g556.t1"; gene_id "g556";
Scaffold_16	AUGUSTUS	stop_codon	500349	500351	.	+	0	transcript_id "g556.t1"; gene_id "g556";
# protein sequence = [MLTLTQSFNIPDGTCLLSVGDSSKVYLHRIHGGGQLSFSSIATLAMPPPDRNLLSHFSSSLAASFSTSFSRDGTKYAV
# ASQEGVVCVWDVRSTKPLKVYQTDKSKSWNDAGNGLASGYLSDDPYEWTRGLSKAPGWSARNVKFGNGGVDGCGKEIMTFTESPYVVLALEDTFRIPT
# RVSDSAEELYASASGSWRRGDNFERDSEEDLVVIPPLGDREVEDDVRALLGSHGIRSRRLGGVGVGISDHADENYDRNRDERMEIDDELDELGMEPEI
# EWD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g556
###
# start gene g557
Scaffold_16	AUGUSTUS	gene	504245	504678	0.64	+	.	g557
Scaffold_16	AUGUSTUS	transcript	504245	504678	0.64	+	.	g557.t1
Scaffold_16	AUGUSTUS	start_codon	504245	504247	.	+	0	transcript_id "g557.t1"; gene_id "g557";
Scaffold_16	AUGUSTUS	CDS	504245	504258	0.64	+	0	transcript_id "g557.t1"; gene_id "g557";
Scaffold_16	AUGUSTUS	CDS	504360	504678	0.68	+	1	transcript_id "g557.t1"; gene_id "g557";
Scaffold_16	AUGUSTUS	stop_codon	504676	504678	.	+	0	transcript_id "g557.t1"; gene_id "g557";
# protein sequence = [MTLNVVEFRRTQRNQYQAISTENRHMINIERRLQIIDSATRSKLRTTSCCIAPGDMFRLPSPEDGPNSGMNAGSDLMF
# PRFEFESFQSLLYKHDYQAITRIRSTQTRPEG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g557
###
# start gene g558
Scaffold_16	AUGUSTUS	gene	514802	515242	0.79	-	.	g558
Scaffold_16	AUGUSTUS	transcript	514802	515242	0.79	-	.	g558.t1
Scaffold_16	AUGUSTUS	stop_codon	514802	514804	.	-	0	transcript_id "g558.t1"; gene_id "g558";
Scaffold_16	AUGUSTUS	CDS	514802	515242	0.79	-	0	transcript_id "g558.t1"; gene_id "g558";
Scaffold_16	AUGUSTUS	start_codon	515240	515242	.	-	0	transcript_id "g558.t1"; gene_id "g558";
# protein sequence = [MITRSKTVQVATRVISDPTPLSAPNATDVDSAIAFNADVINVSPPLDTISPTPLSIADPISSDDPTHHPLTDEDDRDD
# EFHDEVRMYLDYSSDILRAQAEEVKLLRREVASAREEKAVSCSRTLRIITHVKMFTGLEKQTRGGRSR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g558
###
# start gene g559
Scaffold_16	AUGUSTUS	gene	518425	518979	0.92	+	.	g559
Scaffold_16	AUGUSTUS	transcript	518425	518979	0.92	+	.	g559.t1
Scaffold_16	AUGUSTUS	start_codon	518425	518427	.	+	0	transcript_id "g559.t1"; gene_id "g559";
Scaffold_16	AUGUSTUS	CDS	518425	518979	0.92	+	0	transcript_id "g559.t1"; gene_id "g559";
Scaffold_16	AUGUSTUS	stop_codon	518977	518979	.	+	0	transcript_id "g559.t1"; gene_id "g559";
# protein sequence = [MTTSSFAESDVSLHNMTTSFFAETDVSLADSTGMTSSEAMIQPGPFIVARPKGSARMAKLVVIACLPSLPKPTTPYQS
# ELEDQKLKGIQSGTCATAESAPLTLIDMSVFDSAGIIAQLDKQSKGSILPILTKASLDLKSLDGFEELLTSLLISREPEWGFKVIFIVVGSALLGGIV
# MFLALAFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g559
###
# start gene g560
Scaffold_16	AUGUSTUS	gene	524926	525504	0.8	+	.	g560
Scaffold_16	AUGUSTUS	transcript	524926	525504	0.8	+	.	g560.t1
Scaffold_16	AUGUSTUS	start_codon	524926	524928	.	+	0	transcript_id "g560.t1"; gene_id "g560";
Scaffold_16	AUGUSTUS	CDS	524926	525504	0.8	+	0	transcript_id "g560.t1"; gene_id "g560";
Scaffold_16	AUGUSTUS	stop_codon	525502	525504	.	+	0	transcript_id "g560.t1"; gene_id "g560";
# protein sequence = [MNSTHSTSSLTSLDTLPYPTGAPSSGWFFEAFHYLNTALGPQYIGLLQEWVDYERKHHWLNPHKLAGFSPEKRPTVLL
# DWMKNRPRPLPKVDKRGFFTPNFAEEVWAWWASLQPQWRLLDEGGLPVSFEQFGDDLSPLNKHGRNAWVGLLACIKWWGIGLKHYASDDHELYLSSWH
# SIVADMAKMLGKLVVD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g560
###
# start gene g561
Scaffold_16	AUGUSTUS	gene	549625	550299	0.98	+	.	g561
Scaffold_16	AUGUSTUS	transcript	549625	550299	0.98	+	.	g561.t1
Scaffold_16	AUGUSTUS	start_codon	549625	549627	.	+	0	transcript_id "g561.t1"; gene_id "g561";
Scaffold_16	AUGUSTUS	CDS	549625	549879	0.99	+	0	transcript_id "g561.t1"; gene_id "g561";
Scaffold_16	AUGUSTUS	CDS	549928	550299	0.98	+	0	transcript_id "g561.t1"; gene_id "g561";
Scaffold_16	AUGUSTUS	stop_codon	550297	550299	.	+	0	transcript_id "g561.t1"; gene_id "g561";
# protein sequence = [MQSECGGKKKATRKKKRRRAIPKASEDEESRTNTEETSSDDEELLEHDPSLQLLDELVPHEKRPKHRTGALGVLGKKV
# DTIEWCRDEIVKLNSTITSTRSQKQDGKFLGSVFILCNLQIGAHILAQCVSYHQVLQMNDKFIETHPDDIVWHNLDDDALKTRSKVSLSWLATTALIV
# LWSFPVAAIGGLSNIYAVCRKAEWLGWICRGV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g561
###
# start gene g562
Scaffold_16	AUGUSTUS	gene	552124	552477	0.59	+	.	g562
Scaffold_16	AUGUSTUS	transcript	552124	552477	0.59	+	.	g562.t1
Scaffold_16	AUGUSTUS	start_codon	552124	552126	.	+	0	transcript_id "g562.t1"; gene_id "g562";
Scaffold_16	AUGUSTUS	CDS	552124	552477	0.59	+	0	transcript_id "g562.t1"; gene_id "g562";
Scaffold_16	AUGUSTUS	stop_codon	552475	552477	.	+	0	transcript_id "g562.t1"; gene_id "g562";
# protein sequence = [MLLLQLRRTQQAQSTSDNSTASRRSETLPTNVNKAESQGDNNPTSSEDSLDEHAFDHPSTYVAQPCVWIPRDPLGLST
# VLVEYLEEAGVRASDEGAIMDAKGAVMVMKPPPESTSTS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g562
###
# start gene g563
Scaffold_16	AUGUSTUS	gene	555895	559430	0.32	+	.	g563
Scaffold_16	AUGUSTUS	transcript	555895	559430	0.32	+	.	g563.t1
Scaffold_16	AUGUSTUS	start_codon	555895	555897	.	+	0	transcript_id "g563.t1"; gene_id "g563";
Scaffold_16	AUGUSTUS	CDS	555895	556826	0.79	+	0	transcript_id "g563.t1"; gene_id "g563";
Scaffold_16	AUGUSTUS	CDS	557056	557212	0.53	+	1	transcript_id "g563.t1"; gene_id "g563";
Scaffold_16	AUGUSTUS	CDS	557333	557483	0.36	+	0	transcript_id "g563.t1"; gene_id "g563";
Scaffold_16	AUGUSTUS	CDS	557545	559430	0.35	+	2	transcript_id "g563.t1"; gene_id "g563";
Scaffold_16	AUGUSTUS	stop_codon	559428	559430	.	+	0	transcript_id "g563.t1"; gene_id "g563";
# protein sequence = [MSEIYGLDYDKAFLDSLPTAGHPVNNASSLPSSIDARGMMSSRLAPAIHTLTVSQFKDLHYQHILSHPPDSVLFPFLH
# GIEGDNEAQNLFFATQGQQAVVYNRRDDNEQPIHPQVNRARVPKYRGMMWVICEDDLENPDKDLRILVHRPSNLSSYASSEHYDDSSDSYFDDEDELD
# DNFDDSSSDSFGELMSPDSTTTYTKEPVVRPVSASQMDLDIQYNDGSDDVDDLHHNPGVVEIVEIGADDKHMHPVQHRALHPLPTPIRTTDLPNSHHS
# KSPTTTTTTTSGFSSSPLTDNGTEPSTALTEPESDDRPVRGSETSSHSKPHEYTRSGANHAAGGAQTEADCANDQKNPSQEDDDGEWEFPILASVSDI
# IIYSPNATGAAQSANALRLARRFKQAVERKRRERVGCKADNAAPSDTSAAHSTESSGASNDSNTPLDYNVFLLDANADEIKREMPHLVVKLCPEGEVP
# GSLGAALAGPSKSNHVSLFHHDEDGDVVMAENCDASISDHPVSNTSTRVKTVPNTVDFAQREKDEMRDLTRASEIVSMFPEGHTLAYLNPDPLHPPVY
# VQPSSHQIPTSNGDEVDLSNTKTFWNPHVGQVYLGNANDVPLPVNGMGEFGELDPRWDGHDSVEKDVYPPGNSPRHGYGYDICIECHDLAPFPTLAHL
# KASEEKVAALEQRWKDQVELSRKEKGETQANYSLPPRPPPHPNAIIHLPMPSSPPITAGTMSALMPVVRFLQKCIVPTDAVEIVNEPPISPATETSLQ
# NGSAEPLAENMKSRRWSSVSSLIPSFPGFPMHSNNPPPQPSLSPSSSTTSTSRHRSMTSPAPPAHLRQRSQTSSMHSRHTSLSYLASSSNASPFPWSR
# PLKILLYSADGYTESSVPALCLLMAMKGLSLPHAYLELQVAKRRSFFVYHADLGVLRKVESFVDDERRTWKEEIQKEEKRLRLERERMERLKNSKDQR
# AGEVSLSLFGGSTGALGFDFPTHMNPYRTWGSGDSSSNSLSDSSRLPLQPNRMRPMAKSVSFTRSPFLHPPKVAVIVLWEL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/4
# CDS introns: 0/3
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g563
###
# start gene g564
Scaffold_16	AUGUSTUS	gene	563287	564579	1	+	.	g564
Scaffold_16	AUGUSTUS	transcript	563287	564579	1	+	.	g564.t1
Scaffold_16	AUGUSTUS	start_codon	563287	563289	.	+	0	transcript_id "g564.t1"; gene_id "g564";
Scaffold_16	AUGUSTUS	CDS	563287	564579	1	+	0	transcript_id "g564.t1"; gene_id "g564";
Scaffold_16	AUGUSTUS	stop_codon	564577	564579	.	+	0	transcript_id "g564.t1"; gene_id "g564";
# protein sequence = [MLKAKGIASTDKPRAKTTTGPESKLHVVAGTRFSVKTEDALSKYAINSAPSRGISVSDWDTLLPSSDVDIKPEAQDEM
# GVIKVQGSASSVPGPSSLPGLVSLPEGLRSTLGPGSFVPSPSYISNLAESELPSLSGFFKCDDDGLEEQNTTRTENLARDDDELETVIVQQISQGTKG
# DDICGPTVQSGTEVSMAGTTAINPIVIDDDDDDDWIKTENSNNSSIRATSSSSFATSATSPPISPSPSDRTPMIDTRSVISALELLGPCKKRKRSSTP
# STIHMPQRKWRKAESNPPNDTQEKGNSFADDPRHSTTSVSTEHQQAPKIGIVKSDVGALDSTQIIDVDDDEEDRMLASEMETLQVCDLCFPFFILEGP
# LTIFLPIQRQTRLRILQAQRIERRQANLNRRLVDNQRKEGCSHAVVKQDDTLKEEGMI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g564
###
# start gene g565
Scaffold_16	AUGUSTUS	gene	572113	572830	0.64	-	.	g565
Scaffold_16	AUGUSTUS	transcript	572113	572830	0.64	-	.	g565.t1
Scaffold_16	AUGUSTUS	stop_codon	572113	572115	.	-	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_16	AUGUSTUS	CDS	572113	572262	0.68	-	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_16	AUGUSTUS	CDS	572414	572830	0.66	-	0	transcript_id "g565.t1"; gene_id "g565";
Scaffold_16	AUGUSTUS	start_codon	572828	572830	.	-	0	transcript_id "g565.t1"; gene_id "g565";
# protein sequence = [MPTSLQRSIALVGAGSLGQHILRALLTSPSHPNVVVLTRPESKNDLPGDLSSATIIPVDYTNVAALTTLFKEHSIEVV
# ISVVPPPAYTIVQHALADAAKASGTVKLFVPSEWGLPTEGAKEKGEKNLFAVKDEVAGEYVTGMFMAYVPWLVGIDVDGRVHIQGKGETPFTLTSQED
# IGGKAFECSKNI]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g565
###
# start gene g566
Scaffold_16	AUGUSTUS	gene	577418	578452	1	-	.	g566
Scaffold_16	AUGUSTUS	transcript	577418	578452	1	-	.	g566.t1
Scaffold_16	AUGUSTUS	stop_codon	577418	577420	.	-	0	transcript_id "g566.t1"; gene_id "g566";
Scaffold_16	AUGUSTUS	CDS	577418	578452	1	-	0	transcript_id "g566.t1"; gene_id "g566";
Scaffold_16	AUGUSTUS	start_codon	578450	578452	.	-	0	transcript_id "g566.t1"; gene_id "g566";
# protein sequence = [MLQETLHEEGVRSVTLEAFKLWLDSGPVPSPRGQLVSLSSKVDSNRPGTVNFTDNNNRLITFVDNDPLTLQDPRLPGC
# FGDRFSALILNDFTPVAIYPSPVVNKSLKKQPVGEEFISILGREDIRNASRFPALGGISPKNEPEVLMLDWGMRHPVYSQPFKGPITYSPLLERLATT
# LSSPSSPYLTIHWRMESVSPDVLPDCAHALVDTISNLLHSPDLSEGIQKVWFSGDYPVPLVEHLYPTSDRAQTRATIQNKSGTFRDFGEKHTEAVNIL
# VDAFREGAELDRWTITDLTAELARMEKDNELHDVHPEFLADSGALGILDKMVGMDAAIFVGGSKRCGRTR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g566
###
# start gene g567
Scaffold_16	AUGUSTUS	gene	594046	595041	0.5	-	.	g567
Scaffold_16	AUGUSTUS	transcript	594046	595041	0.5	-	.	g567.t1
Scaffold_16	AUGUSTUS	stop_codon	594046	594048	.	-	0	transcript_id "g567.t1"; gene_id "g567";
Scaffold_16	AUGUSTUS	CDS	594046	595041	0.5	-	0	transcript_id "g567.t1"; gene_id "g567";
Scaffold_16	AUGUSTUS	start_codon	595039	595041	.	-	0	transcript_id "g567.t1"; gene_id "g567";
# protein sequence = [MEYNIGAPKPPRPLVRKEPKVAKSDRNSTLDNYSPSLSMSSSFASSSSSFATSSTSSTKSRPSSAISFLRLFSKRKAS
# TAPPTIFEPLGTPVQPYFRSPESEVLANTTPLGKPIQSVDEPSSVKLTDHNEILEVLRETHPGHVSSQTYSRRASLTLPPTHSHNGAPEQLPVLSHGT
# EYSHLPPRPNRNPKRPKTAPSSQSNRRPLPHIPMNRTPSIATFNPEVISPSKQTTVPGPSRTENLDTRRIESPSLSLTRSKSISHSMMMVAPRPDSPF
# IDCHVSGPMQSYFATALGTNQLGASSTAGTNERPQGWTGEWNIDDMQDVIQKLRELR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g567
###
# start gene g568
Scaffold_16	AUGUSTUS	gene	600874	601188	0.4	-	.	g568
Scaffold_16	AUGUSTUS	transcript	600874	601188	0.4	-	.	g568.t1
Scaffold_16	AUGUSTUS	stop_codon	600874	600876	.	-	0	transcript_id "g568.t1"; gene_id "g568";
Scaffold_16	AUGUSTUS	CDS	600874	601188	0.4	-	0	transcript_id "g568.t1"; gene_id "g568";
Scaffold_16	AUGUSTUS	start_codon	601186	601188	.	-	0	transcript_id "g568.t1"; gene_id "g568";
# protein sequence = [MIQAQYGPDTKVDFAKNRHAEYYTCPFKLEVSEQNAFWRPVSKVTGYFEMKEVQNPKSIKVTGWLKQDGKTISEYEYP
# VRALLYPCTYSYPNTLHQPSESSSSH]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g568
###
# start gene g569
Scaffold_16	AUGUSTUS	gene	609508	610465	0.3	-	.	g569
Scaffold_16	AUGUSTUS	transcript	609508	610465	0.3	-	.	g569.t1
Scaffold_16	AUGUSTUS	stop_codon	609508	609510	.	-	0	transcript_id "g569.t1"; gene_id "g569";
Scaffold_16	AUGUSTUS	CDS	609508	610122	0.96	-	0	transcript_id "g569.t1"; gene_id "g569";
Scaffold_16	AUGUSTUS	CDS	610214	610465	0.31	-	0	transcript_id "g569.t1"; gene_id "g569";
Scaffold_16	AUGUSTUS	start_codon	610463	610465	.	-	0	transcript_id "g569.t1"; gene_id "g569";
# protein sequence = [MDNLMFKHAAKEGAVAFDETKIESIEFEGNGDPKTARPVAAQWTNKQGQSGRIAFDWLVDASGRAGVMSTQYLKNRVM
# RESFRNINTVHNLKTYLDKKGWAWFIPLNDGTTSVGFVTHQNTSTERRSKVGPDGKKPTVTEHYLDMFQYAPHVKDFLKEGEMIPGTTHSASDYSYWA
# GGYAGDHYRLVGDAASEDEFFRFIIDLEVTPNTLSDFVDPFFSTGIHISMSGGLSAAASICSSIRGDVDEMTARKWHDLKVGMLHVRSVIVHTPAVDT
# FVHPLGFFVDSCLQ]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g569
###
# start gene g570
Scaffold_16	AUGUSTUS	gene	614298	616990	0.53	-	.	g570
Scaffold_16	AUGUSTUS	transcript	614298	616990	0.53	-	.	g570.t1
Scaffold_16	AUGUSTUS	stop_codon	614298	614300	.	-	0	transcript_id "g570.t1"; gene_id "g570";
Scaffold_16	AUGUSTUS	CDS	614298	615431	0.98	-	0	transcript_id "g570.t1"; gene_id "g570";
Scaffold_16	AUGUSTUS	CDS	615518	616990	0.53	-	0	transcript_id "g570.t1"; gene_id "g570";
Scaffold_16	AUGUSTUS	start_codon	616988	616990	.	-	0	transcript_id "g570.t1"; gene_id "g570";
# protein sequence = [MFSFAILPLLAYSTLLAIFGFISVRITRWRRGHRPAALTLDDDDVELLPTNTSTLSPEFKAFPVPPPLPSLVPSHARS
# RSFSNLQHAVVVHDMPERERPKSPLHFGLSTPGSRLKSKQRSHSAGSISSPLSPKRRLHNNNRRPFISDPESDADTVVPPRHAIASTPNTPFAPQTQF
# GTLVDLSVPPVPAPSPLNPIFPNMAGSAHLWALHSYTRSSTVPAEELNLIDLHTPDPEQRASRNFEPVSVPLLQESKGSNAKEQGNTSSDLDGYEPDV
# EGEAGEQITGLGKDKEIDIGLEWDFESVSGSSMRVSSIPQAHQVSEERDLVDGNSMPSSPVEFLATQLHSIPITASSSLSEGYLRLDTEEVLAGKSED
# SLPLSSSSSSAILSSSSSLPSPPRHLVELDAGHRPIDVVIVENTGVEDEDELDLNLDNETLPSISRDDTSLDLDLIHRVYNDDDENAAGQLELGPGMF
# VARDRKMMNFMTFMKIMTALRDENIDVLTYTDNSSTNPESQEAIQDSLTPPPSHEKFSTLVSRAHPDNDVGLELRMFEDGLNDEPQANEGDVNVIEDD
# DEHIEETEGEFPDPDLLPLPELDIPLLLANITSPDPSLIAKEEEPSSSAATTASVSPTSQIPTPPASPPQQRRPLPRPLPAWSIRAADAPPLGLASRS
# PVLRHKSSFSLSVIEGSDARVVKEAESQLKTEIEIREKNEEGISSLSDEIIANEDVRPSTKTPVPSVAILPGAFPVDVHPLSDLMVPDDEEEDEEEAE
# TTTKETESSSTQDESVSRIQRGSSFYVHFYFHFCYQTSETPPCAIPIDIALAMQLRPGLGLGADPAWMVRFLMAMFGWFVVLISGSAGDGYGRTPYVG
# IRRSEE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g570
###
# start gene g571
Scaffold_16	AUGUSTUS	gene	618669	620012	0.75	+	.	g571
Scaffold_16	AUGUSTUS	transcript	618669	620012	0.75	+	.	g571.t1
Scaffold_16	AUGUSTUS	start_codon	618669	618671	.	+	0	transcript_id "g571.t1"; gene_id "g571";
Scaffold_16	AUGUSTUS	CDS	618669	620012	0.75	+	0	transcript_id "g571.t1"; gene_id "g571";
Scaffold_16	AUGUSTUS	stop_codon	620010	620012	.	+	0	transcript_id "g571.t1"; gene_id "g571";
# protein sequence = [MVMLRGVPASVSDLTDDSYSSRSSPRLSATISHPVSFTDKSNPSTTTSAKYSSEFPVAPNLKRCSFFPDPELEPLKPW
# QVALNRHMKNANILTFDRDETRSSDIFVERGNGPHTNIQHDDLISSAWRHPYPSSWLEMSISDEEEELDWDDEDDRSVQGSDGGSTTSINGFVDTNKP
# LPRTPLKPPNTISFRTQEIGATPTIRRTRSQTVPQHALEAYASPLPSPSTTTSKRVEYLHLADRPRPPLDNPFLSRISEKSEETVEEPRQSEATVNVQ
# FRSKDTRVVVPWHRSSFPSKVTFLPTLKRSSSSMRSLEHFWEQKFGRNDPEPETKYRRRDRFFRSKKRLEPLQEECASEHTPEPIDVPPFSVDGIPSA
# AETAQATYIRVLNEDGTSISFGKILSGGDSGDVGDKVKTIVCFIRHFLCPMCQDYMYSIGRNIDPVHLSGQDFGW]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g571
###
# start gene g572
Scaffold_16	AUGUSTUS	gene	620386	621015	0.37	+	.	g572
Scaffold_16	AUGUSTUS	transcript	620386	621015	0.37	+	.	g572.t1
Scaffold_16	AUGUSTUS	start_codon	620386	620388	.	+	0	transcript_id "g572.t1"; gene_id "g572";
Scaffold_16	AUGUSTUS	CDS	620386	621015	0.37	+	0	transcript_id "g572.t1"; gene_id "g572";
Scaffold_16	AUGUSTUS	stop_codon	621013	621015	.	+	0	transcript_id "g572.t1"; gene_id "g572";
# protein sequence = [MGDKALLGGEFVFEKVPGKDISCVWAHRMRYTTAHEEIKSVVGEAQASSVDVGSCSGTDCSTSFMTAMSSLSRISSSL
# DQASLAREMGFVDASSSDLCSTDLSLRDYERMTSRPVSSIYSTIASQISSTSSWRKFRHKELWLSKEKSRWNKMIGMLDQRLVAGSSGDNSSDSSTEG
# SELGHHLEVEIPEVVDDTRDEEEVFQRWFSTAP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g572
###
# start gene g573
Scaffold_16	AUGUSTUS	gene	627493	629206	0.59	+	.	g573
Scaffold_16	AUGUSTUS	transcript	627493	629206	0.59	+	.	g573.t1
Scaffold_16	AUGUSTUS	start_codon	627493	627495	.	+	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_16	AUGUSTUS	CDS	627493	627516	0.59	+	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_16	AUGUSTUS	CDS	627611	629206	0.99	+	0	transcript_id "g573.t1"; gene_id "g573";
Scaffold_16	AUGUSTUS	stop_codon	629204	629206	.	+	0	transcript_id "g573.t1"; gene_id "g573";
# protein sequence = [MLNNPPRPGCGLISEPVFSKCQFSLNEGRRLENISWRLWSQQIAGKSLKYRPLTPDSPSEGVLTHGSGTLLSGPFLSV
# YVNLTFGIGTITPLLSTFSPRRQPIGKILCDFIPNLQQTIQPLYPKLRLPSRLTKAEHEVRLASVLPTPAAELLSISIIPPTHSNDEAAARNIPSIVA
# SASTSPASGNSSSKSISPTSGSHALPGALASPFPLVVVVNPTPNPTPHPTPPATPVLPVVLASDAVRHTHVPLPPRISPDSPTLSRDRRQLNLTLATT
# LDLMPAFQTRSSAQPSIFGSCSPVSNNLLPPSPSANTSSSITSTSSANSNSSHLTASSSTSIHSNDTRSPNATLKPHDARKFFLKLDEHSSGSSDEPS
# PIRPDIATFTTSKVDAASSRAHGSPVAAFALGSYSTGMQNSNGDEGHSNQPPGLAFQSSVGQSSTSASGSWGESDVSGRRRRGPPLAKSSKGSSGRAS
# GSSDGRSRSRSHGQAHDGLMMRKKAQASVATGRRGPRSGANVVPPQTHGHTRGQGPVASGDSLQLGTCG]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g573
###
# start gene g574
Scaffold_16	AUGUSTUS	gene	629239	631359	0.66	+	.	g574
Scaffold_16	AUGUSTUS	transcript	629239	631359	0.66	+	.	g574.t1
Scaffold_16	AUGUSTUS	start_codon	629239	629241	.	+	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_16	AUGUSTUS	CDS	629239	631359	0.66	+	0	transcript_id "g574.t1"; gene_id "g574";
Scaffold_16	AUGUSTUS	stop_codon	631357	631359	.	+	0	transcript_id "g574.t1"; gene_id "g574";
# protein sequence = [MLLPSGTTFSSAHEHNRTEEKPTQVQRTHLVTPSPGHPVQVPPPMHSTTPARRTTFNIGSQSPSGSPSNTDLSTSSQA
# HTRSPPPSNAGPSIGCPPLVSPDRMRLQGHLPVTEARAGPLLRSPPPNVPFVVSSRQPRGLPHAASNLSAAEAVIQAPRTKRVVLADDDDDDWDETET
# DLDSDFEDDRKSDIDAEKGGTLVEPGIIGGGDHNDDGDWVSEEDEPESSQANLPAKQNPHPAPPQAPTQNNIKRPTGVSRHQSQPDIPNTAMVSRQKD
# LEQGQRLDQPRLHQRSQHPVVQSRTAHRSERDQAHALNDAKLRDAALEAQRQREMFAKVPKRSYSNLSTRSQSGLLSQLMNPDPNIFPGDHPYRRGYS
# DVAVGGRTGNGLARLGMQPMTNLTANAGVRNHKSNLTTGAPGPSATQRGSTSAAESSTSVAASSVSKVAPLGPTKSAVALPIANSVTASSYKGDLQTI
# AGFPKGKQRQIEPDSNAGAYRPKGRPQDEEMEMEEESEDDRDQAYHISKSVAEQKLAAIADRRTAKKGSSSAQAGPPAALPLHPHPYPAPQPHRSKSQ
# YIANTHERISTPPVQVPLPLGFPYNLPPAAPPSSPHTTRQLMLRKEMPESLRQNLLWSRKISNQELNGPRRNSSSALSPTLQPLTAIPTVVHVTKKRR
# PEPGESIPQEVEDARSDEDIMEPIRPVVMQRNRSWAGGGR]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g574
###
# start gene g575
Scaffold_16	AUGUSTUS	gene	635107	635877	0.46	+	.	g575
Scaffold_16	AUGUSTUS	transcript	635107	635877	0.46	+	.	g575.t1
Scaffold_16	AUGUSTUS	start_codon	635107	635109	.	+	0	transcript_id "g575.t1"; gene_id "g575";
Scaffold_16	AUGUSTUS	CDS	635107	635877	0.46	+	0	transcript_id "g575.t1"; gene_id "g575";
Scaffold_16	AUGUSTUS	stop_codon	635875	635877	.	+	0	transcript_id "g575.t1"; gene_id "g575";
# protein sequence = [MMLIRDILYELASVGELPLPNASPTATNKRERGAESPMSSAETSEGSPCLSLSDAPVSPDSRSIAGSRRVSAATSGNF
# DFLKPTATATSSLHHTVVGESALSTDSSPGMQLFSLPVYSNELGRLPLYGQVNFSARPHPNSQPLDWCPPHRAGSSSSNVPEIVTHSQYIPPEYYNYG
# HNESGVAPPTNSAVHDSMLYHNGPLNDTAGPGLSSVAAYSGDSPLHPSDGLLSSRNGVNMPMSLDSDTFAMWSNAPSGFE]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g575
###
# start gene g576
Scaffold_16	AUGUSTUS	gene	646802	648233	0.32	-	.	g576
Scaffold_16	AUGUSTUS	transcript	646802	648233	0.32	-	.	g576.t1
Scaffold_16	AUGUSTUS	stop_codon	646802	646804	.	-	0	transcript_id "g576.t1"; gene_id "g576";
Scaffold_16	AUGUSTUS	CDS	646802	647558	0.85	-	1	transcript_id "g576.t1"; gene_id "g576";
Scaffold_16	AUGUSTUS	CDS	648007	648233	0.32	-	0	transcript_id "g576.t1"; gene_id "g576";
Scaffold_16	AUGUSTUS	start_codon	648231	648233	.	-	0	transcript_id "g576.t1"; gene_id "g576";
# protein sequence = [MEYLGGGEIQYTSPTSPGTPILTVEQTRRIMRDAILGLEYLHHQGIIHRDIKPANLLWSTGHDRVKIADFGTAHFSYA
# QRLAAAKASNLPIIDDNEEDPLLLNDADLAKRAGSPAFLAPEIVWEFVEWPQAEKFYPTYTPLLPTTPGGSSPSEPVSADVVPVPAPPRPPVTKSIDI
# WALGVTLYCLLFGKTPFRPPGDEGDRITEWAGYYWVCNRDWRAEDKMGWDGVLTGGQKAREGQWNGWGWLMNGVTTTETDTKTREYSEGGDSAAKEEG
# QKGKPEGSKEGALVMHLLDHFLQKDLERRITLEEVKVHSVSPTSLMFHLTQFL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g576
###
# start gene g577
Scaffold_16	AUGUSTUS	gene	648674	649093	0.97	-	.	g577
Scaffold_16	AUGUSTUS	transcript	648674	649093	0.97	-	.	g577.t1
Scaffold_16	AUGUSTUS	stop_codon	648674	648676	.	-	0	transcript_id "g577.t1"; gene_id "g577";
Scaffold_16	AUGUSTUS	CDS	648674	649093	0.97	-	0	transcript_id "g577.t1"; gene_id "g577";
Scaffold_16	AUGUSTUS	start_codon	649091	649093	.	-	0	transcript_id "g577.t1"; gene_id "g577";
# protein sequence = [MSSFPEASSSCDSQVSIQSYPTLVSNPPPTTAQPAVVTTSLVQTTRLADGKKMINQYVMDAKVGSGQHGNVWRCYENK
# YYYSYYDGQDPEERERIERQRNSKVLAMKIVKRDNPKARRDRQYKMLRMRGGLGAVGAGRK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g577
###
# start gene g578
Scaffold_16	AUGUSTUS	gene	658359	659060	0.29	-	.	g578
Scaffold_16	AUGUSTUS	transcript	658359	659060	0.29	-	.	g578.t1
Scaffold_16	AUGUSTUS	stop_codon	658359	658361	.	-	0	transcript_id "g578.t1"; gene_id "g578";
Scaffold_16	AUGUSTUS	CDS	658359	659060	0.29	-	0	transcript_id "g578.t1"; gene_id "g578";
Scaffold_16	AUGUSTUS	start_codon	659058	659060	.	-	0	transcript_id "g578.t1"; gene_id "g578";
# protein sequence = [MELAGIWLLDLAHQLPLTISLTGIDISTRLFPKPTTYPSNITFSSQSITDLPPSWSNRFTLINQRLLTGALSKSQWIQ
# ALTEIFRVLKPGGWIQFMETGPTPNAYSGAKMKRMVDSWALLYRARGLVPEIQDVLGQLISETGFIEVQKHIIPLPLSPRRDSSSLSDSELDHYEEHK
# KNIIGFFVAAKQPFLMAGLFKGEVEFDQALEEMREEWDASEGCWWEWAIFYAKKPEC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g578
###
# start gene g579
Scaffold_16	AUGUSTUS	gene	664980	665759	0.61	+	.	g579
Scaffold_16	AUGUSTUS	transcript	664980	665759	0.61	+	.	g579.t1
Scaffold_16	AUGUSTUS	start_codon	664980	664982	.	+	0	transcript_id "g579.t1"; gene_id "g579";
Scaffold_16	AUGUSTUS	CDS	664980	665759	0.61	+	0	transcript_id "g579.t1"; gene_id "g579";
Scaffold_16	AUGUSTUS	stop_codon	665757	665759	.	+	0	transcript_id "g579.t1"; gene_id "g579";
# protein sequence = [MVIVSSQSFLEGVARDTLVGKISAYWTVQGGKNVWVDAMDITNSRVDLPGAPGSKVDPAIATARDAFNSGSSRLVGSG
# GSGPTIPRTFDVSALFRKRIIYPNPGTPAPVTRLPLPIAPKFATINTVIEALPSRKDDRHFPTISSTGLIHNRYSLLSSGKKQAPKRNVWADAVYKSS
# SVVSPLQRTCQPPRLAAKNSVVPQSFMKDYSSPDQHFVHQSNPLYIEWAPWHSNDYGVSLQPSPEDGGDRWTIAKRRKNRILS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g579
###
# start gene g580
Scaffold_16	AUGUSTUS	gene	668254	668601	0.52	+	.	g580
Scaffold_16	AUGUSTUS	transcript	668254	668601	0.52	+	.	g580.t1
Scaffold_16	AUGUSTUS	start_codon	668254	668256	.	+	0	transcript_id "g580.t1"; gene_id "g580";
Scaffold_16	AUGUSTUS	CDS	668254	668601	0.52	+	0	transcript_id "g580.t1"; gene_id "g580";
Scaffold_16	AUGUSTUS	stop_codon	668599	668601	.	+	0	transcript_id "g580.t1"; gene_id "g580";
# protein sequence = [MVQWLKQVLRLNIVHSHGGRPESAVLLPPPEPTFPVSDFENTARGSTDRVWGADGLPITNAEPRAALRKLARRTHVMM
# SKLSPLCIGVAEQQRDIMWIIWEGCVVENKIGGRGNT]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g580
###
# start gene g581
Scaffold_16	AUGUSTUS	gene	669629	670195	0.76	-	.	g581
Scaffold_16	AUGUSTUS	transcript	669629	670195	0.76	-	.	g581.t1
Scaffold_16	AUGUSTUS	stop_codon	669629	669631	.	-	0	transcript_id "g581.t1"; gene_id "g581";
Scaffold_16	AUGUSTUS	CDS	669629	670195	0.76	-	0	transcript_id "g581.t1"; gene_id "g581";
Scaffold_16	AUGUSTUS	start_codon	670193	670195	.	-	0	transcript_id "g581.t1"; gene_id "g581";
# protein sequence = [MALPRPEAPRLPTAPIASMEGASFMHPTYGLLQPCYIEPGSNQSYRSPHSECTRIVTDEVTQEIIKSPLTHNSTLEDT
# LAIPTLIIPYNGFFVTHIMLHHFCGNLFNGSIIWSNWVVREKEGYHQNNENVSKDIIIGFDNRFEVEWVHETKSTRGGLAFKGGFWGKGKKAKAPMGT
# GKESAEVWFGKV]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g581
###
# start gene g582
Scaffold_16	AUGUSTUS	gene	682521	683404	0.87	-	.	g582
Scaffold_16	AUGUSTUS	transcript	682521	683404	0.87	-	.	g582.t1
Scaffold_16	AUGUSTUS	stop_codon	682521	682523	.	-	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_16	AUGUSTUS	CDS	682521	683180	0.94	-	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_16	AUGUSTUS	CDS	683240	683404	0.9	-	0	transcript_id "g582.t1"; gene_id "g582";
Scaffold_16	AUGUSTUS	start_codon	683402	683404	.	-	0	transcript_id "g582.t1"; gene_id "g582";
# protein sequence = [MSVRSAPSTEVTQATDTVIKTIVDLVQHTGAEKLKLVDAKLIPLVQWAKDYAGYRFRHKEIIRILRDEGQLNDLSDQL
# RKLAEDSLQAGDAFVLARAEADWEGDWVHPRWKKAAMERAQAAEKQRKEDLLVAERRRVDVYTRLRDVCNTNIEDLPFNYSEDSDSEDEILQAASVGA
# PGPSSSSNSTAHNPANRTSSSIDTMRRTGPLFSNLAKPGSAIPGTTSIVNRAPQAGPDAQQQKRKAEAFLHGDFNKRSRPDRTLSYTLSESSIHLILF]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g582
###
# start gene g583
Scaffold_16	AUGUSTUS	gene	684337	685707	0.88	-	.	g583
Scaffold_16	AUGUSTUS	transcript	684337	685707	0.88	-	.	g583.t1
Scaffold_16	AUGUSTUS	stop_codon	684337	684339	.	-	0	transcript_id "g583.t1"; gene_id "g583";
Scaffold_16	AUGUSTUS	CDS	684337	685707	0.88	-	0	transcript_id "g583.t1"; gene_id "g583";
Scaffold_16	AUGUSTUS	start_codon	685705	685707	.	-	0	transcript_id "g583.t1"; gene_id "g583";
# protein sequence = [MPRLQSPAKVIITTKSPAMAFVQPESSNSLRRLSSSMTNSSSRPYSPTPVSGFESSSLAARGLALVTLSSPPPLRFNS
# DFTGWLLPDGVDTSIPDDNSELPDLTHCSFAFASASNPNLSTSTISSDSEDIPPTPGRGVGLGFGLGFGCGARVFCHDNEIAATSLKETALTFDAASV
# SNEIIGSLDVRGRSGGGSRFIASGYDEALGLPTTSCFEGNVEKELDSTPKVPSETISNFKDNIPCFSFSSTPRNRTSSSSASQCPSSTSPSLRSHSRS
# QAPGFTDVSSSKRPEGCSNENSVGKPTTSKPAAAKRGSIRRTISLHRRGGPDVTLATISSSLKRSTSSGSSSPTITVPTANRLFSRVPSRILGRGPRE
# AVADLKKAKECPAVTVHPRYTPQKQAKAENGPRHVRPSQELVAHVEERQEYRGRQALIECTELGAKIVLEIGNESPRSMNSEVP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g583
###
# start gene g584
Scaffold_16	AUGUSTUS	gene	692232	693113	0.69	-	.	g584
Scaffold_16	AUGUSTUS	transcript	692232	693113	0.69	-	.	g584.t1
Scaffold_16	AUGUSTUS	stop_codon	692232	692234	.	-	0	transcript_id "g584.t1"; gene_id "g584";
Scaffold_16	AUGUSTUS	CDS	692232	693113	0.69	-	0	transcript_id "g584.t1"; gene_id "g584";
Scaffold_16	AUGUSTUS	start_codon	693111	693113	.	-	0	transcript_id "g584.t1"; gene_id "g584";
# protein sequence = [MENAKMADTPLPAGFQPEPTKGQSNSALRSKFQMVIGSLLYLMLGTRPDISFAVTKLAQHAANPSQEHLNKALYICRY
# LLGTRSYALCYDGESGIGLSAWTDSDWASDPYTRRSQTGFFMKLANGIFSWTSHAQKTIAHSSTEAEYMALSDCSRQVVWIRNLLEELGYKLDAIPIA
# GDNQGSIFMASNPVTSKHSKHIDIRYHYIREVVERGLVQVFFVDGSNNPADLFTKNLGRIKFELFPQCLDLSSTRPPILRLSALSDAYRYCFEQSTLL
# CCSARGCVERGYAVHMPLL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g584
###
# start gene g585
Scaffold_16	AUGUSTUS	gene	693435	694385	0.3	-	.	g585
Scaffold_16	AUGUSTUS	transcript	693435	694385	0.3	-	.	g585.t1
Scaffold_16	AUGUSTUS	stop_codon	693435	693437	.	-	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_16	AUGUSTUS	CDS	693435	694050	0.95	-	1	transcript_id "g585.t1"; gene_id "g585";
Scaffold_16	AUGUSTUS	CDS	694105	694385	0.3	-	0	transcript_id "g585.t1"; gene_id "g585";
Scaffold_16	AUGUSTUS	start_codon	694383	694385	.	-	0	transcript_id "g585.t1"; gene_id "g585";
# protein sequence = [MFPSFINLPLPKGQDPEQDVAPPVPAEQPARDPSPPPQPRNEQPPAEEQLRRSGRVRRPPTRLTGDPRSSTKLPTEQQ
# VERPKRDIQRRAPTASTEHPTPENGEQPSVTPGDEANTLIRLCREGGAELIYFLMAKAVPFEGELKSSENVREWTYKDITRLPKAEREEWLKACQEEL
# EALKRRGTFELMDRPADRKVIKNRWVFDIKSDGRKKARLVVKGFSQIEGLDYDQVFSPVVRFETVRLLLALTALNNWYLLDSMFKCLSIWSYMRLSTW
# NSLKVFESKAKRIKSSYCAKLCMD]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g585
###
# start gene g586
Scaffold_16	AUGUSTUS	gene	695078	695485	0.68	-	.	g586
Scaffold_16	AUGUSTUS	transcript	695078	695485	0.68	-	.	g586.t1
Scaffold_16	AUGUSTUS	stop_codon	695078	695080	.	-	0	transcript_id "g586.t1"; gene_id "g586";
Scaffold_16	AUGUSTUS	CDS	695078	695485	0.68	-	0	transcript_id "g586.t1"; gene_id "g586";
Scaffold_16	AUGUSTUS	start_codon	695483	695485	.	-	0	transcript_id "g586.t1"; gene_id "g586";
# protein sequence = [MSDGGGEFRSNALDEFFKNKGIKHNGHLLISTSRMEELKGLSRLLLRKVNHSAFKPVFLIPGGNSLLAHAVHVYNRTP
# MHRHKWKTPYEILYNKVPCIDHLRVFGCGAYVYLHEEVWTNNVATRQEAGGGRSGYA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g586
###
# start gene g587
Scaffold_16	AUGUSTUS	gene	697946	699891	0.36	-	.	g587
Scaffold_16	AUGUSTUS	transcript	697946	699891	0.36	-	.	g587.t1
Scaffold_16	AUGUSTUS	stop_codon	697946	697948	.	-	0	transcript_id "g587.t1"; gene_id "g587";
Scaffold_16	AUGUSTUS	CDS	697946	699193	0.36	-	0	transcript_id "g587.t1"; gene_id "g587";
Scaffold_16	AUGUSTUS	CDS	699373	699891	0.67	-	0	transcript_id "g587.t1"; gene_id "g587";
Scaffold_16	AUGUSTUS	start_codon	699889	699891	.	-	0	transcript_id "g587.t1"; gene_id "g587";
# protein sequence = [MSSALFTTVTTTLKGDNYGTWTPEMEAFLQATGLGSAITSDLPVEPSPLDTEDLDSVKAWKEYDDLLKSWKEIDSKAV
# GNIHLHLSPSIRILAKHQGNTAKELWEFLQKTYKVKGLGSVFNDFAAAMAVKVPYKGNPLTAMTDIGIPAHLEALILYLSFHHAILLLSRLCLNSQQK
# GQNGNNNSNKKKHKCGSGKNKKAKKNANAAQADADSMIFSPIGSTVDFGPVRIDLTPSVQDVRKHSIHPPYNPPPNATSLRLHKKTRMAINRARNFGV
# RATAEVICTLELTGHILELDSDDKLDPPTKRTHAMSPVDDVENGSKAPMPPPPSPPMDFEVPGTASFDPDELLNFDLDREILAITGFMDTMGSVPSSD
# LDHTKCTNAPSLVAVAKTCKLAFEPDLLSHLYNYRIDAKYISNEHFCVHDVSYSVCKKCKGKQRNQPKWWMNDSGCSEHTTFDLSDLIEYEDLEEKVL
# IATATTTAYITGVETILIHFKDVRGRMHLARIAPVFYMKELSHRLIAQGRFLQDGKTVCGNADKVDFWDNDGLFLSFEPRTHSDMIYILKDYLPQPMA
# VNLVIHSVDYTTMHHHMGHC]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/2
# CDS introns: 0/1
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g587
###
# start gene g588
Scaffold_16	AUGUSTUS	gene	706603	706932	0.76	+	.	g588
Scaffold_16	AUGUSTUS	transcript	706603	706932	0.76	+	.	g588.t1
Scaffold_16	AUGUSTUS	start_codon	706603	706605	.	+	0	transcript_id "g588.t1"; gene_id "g588";
Scaffold_16	AUGUSTUS	CDS	706603	706932	0.76	+	0	transcript_id "g588.t1"; gene_id "g588";
Scaffold_16	AUGUSTUS	stop_codon	706930	706932	.	+	0	transcript_id "g588.t1"; gene_id "g588";
# protein sequence = [MKSASVIAYATLVGAAAAFVVPQARDSSMNSTTIDDTSLLNYVLSLKNLENSFYAGALNSFTQDDFVNDSLPTWSRAR
# FEQIAEHQQAHVDLLSNAIGSGAAQACNYTL]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g588
###
# start gene g589
Scaffold_16	AUGUSTUS	gene	706973	707560	0.73	+	.	g589
Scaffold_16	AUGUSTUS	transcript	706973	707560	0.73	+	.	g589.t1
Scaffold_16	AUGUSTUS	start_codon	706973	706975	.	+	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_16	AUGUSTUS	CDS	706973	707560	0.73	+	0	transcript_id "g589.t1"; gene_id "g589";
Scaffold_16	AUGUSTUS	stop_codon	707558	707560	.	+	0	transcript_id "g589.t1"; gene_id "g589";
# protein sequence = [MFCSPYTSPSTFAALAEVISGVCVSAFVGAAQYITSSDYLTTAAAVLSTEARHAAWIAGPVNHQNAWSGALDTPLSLD
# AAYTLASQYISGCPSSNPTLPVTAFSSLTIANALLGQASTVTANNVTVEGQYVAFLSGVTPTFVQVVGGQVVVPTTIMGTSYAVLTSSNVSVDDSTIT
# AGVVVLQFPYNSNGALEIA]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g589
###
# start gene g590
Scaffold_16	AUGUSTUS	gene	709763	710095	0.94	-	.	g590
Scaffold_16	AUGUSTUS	transcript	709763	710095	0.94	-	.	g590.t1
Scaffold_16	AUGUSTUS	stop_codon	709763	709765	.	-	0	transcript_id "g590.t1"; gene_id "g590";
Scaffold_16	AUGUSTUS	CDS	709763	710095	0.94	-	0	transcript_id "g590.t1"; gene_id "g590";
Scaffold_16	AUGUSTUS	start_codon	710093	710095	.	-	0	transcript_id "g590.t1"; gene_id "g590";
# protein sequence = [MIIVRIGLGIDVLATSQPYSTIGVVEVQAAGPMDHPEQSCTQTATANTDNIQPFELKYEDPEMQAAGPTAIEYHLEQT
# CVLTGTTHTNNVLSIQPFELKYELPIEAQALP]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g590
###
# start gene g591
Scaffold_16	AUGUSTUS	gene	722355	723876	0.34	+	.	g591
Scaffold_16	AUGUSTUS	transcript	722355	723876	0.34	+	.	g591.t1
Scaffold_16	AUGUSTUS	start_codon	722355	722357	.	+	0	transcript_id "g591.t1"; gene_id "g591";
Scaffold_16	AUGUSTUS	CDS	722355	722412	0.96	+	0	transcript_id "g591.t1"; gene_id "g591";
Scaffold_16	AUGUSTUS	CDS	722524	722752	0.36	+	2	transcript_id "g591.t1"; gene_id "g591";
Scaffold_16	AUGUSTUS	CDS	722805	723876	0.99	+	1	transcript_id "g591.t1"; gene_id "g591";
Scaffold_16	AUGUSTUS	stop_codon	723874	723876	.	+	0	transcript_id "g591.t1"; gene_id "g591";
# protein sequence = [MARRAQWKVEVGTEDGSPSQEYIQNSFHSYLKSSLTQAKVERLLDADLLSSAEGDLMITGAFLRFPGNSYSIVSAIQD
# LHCVSILQHYAVPPIRLQKLSPPFAPFLRVWAQTVPSIQTLAPEYQHDLARIICDLEPVASPLNPNIHGIAADLRAVAIEISQRRSFQDRYAADLQAA
# LDSGNEPSSPRAKKASFVPPPSYEMSPPSSVQSSPNTQNLPLPPPSPTYSVGHQADIHDLASQSSSHLIPYTPSAGSGWPSRSPSPSILTPDSPAIEF
# IRETLYAALGDVLESHSSLREMLKVDPSRAYFAAVAYAILDVATTSLTPEGAIVGVLGTPLTLDDCPPPLRRFMLELAAIGRQAAEIQEADDVRAMKY
# ASQGKCIPTPRMERVQQMLVEGIGCSTQHSDGEEGRRSVEGKAVAFANRINGLSLALTHLKAFKDRQDQVFKVLAGIGAS]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/3
# CDS introns: 0/2
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g591
###
# start gene g592
Scaffold_16	AUGUSTUS	gene	725375	726028	0.98	-	.	g592
Scaffold_16	AUGUSTUS	transcript	725375	726028	0.98	-	.	g592.t1
Scaffold_16	AUGUSTUS	stop_codon	725375	725377	.	-	0	transcript_id "g592.t1"; gene_id "g592";
Scaffold_16	AUGUSTUS	CDS	725375	726028	0.98	-	0	transcript_id "g592.t1"; gene_id "g592";
Scaffold_16	AUGUSTUS	start_codon	726026	726028	.	-	0	transcript_id "g592.t1"; gene_id "g592";
# protein sequence = [MSSSSSTSDTSEPPSTPPSFELNTPLISDSNSEGLPSEFMLDSTTWSAIESASLECTSHCLPSTMLTYEDLCNAMTSS
# SDLINDVAGLPDYSDSKSSQNQLSTLPWEDETYSHIQHTIDLCSNSAILSSTHPLDSFDTFLSYQNLDHSSTALSPLPMSPMSDTSSAITLLPADGET
# TNSLNNSSHVHRNEYGYATVPFWEPANSDPHSFLAQWTSTY]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g592
###
# start gene g593
Scaffold_16	AUGUSTUS	gene	734403	734525	0.81	-	.	g593
Scaffold_16	AUGUSTUS	transcript	734403	734525	0.81	-	.	g593.t1
Scaffold_16	AUGUSTUS	stop_codon	734403	734405	.	-	0	transcript_id "g593.t1"; gene_id "g593";
Scaffold_16	AUGUSTUS	CDS	734403	734525	0.81	-	0	transcript_id "g593.t1"; gene_id "g593";
Scaffold_16	AUGUSTUS	start_codon	734523	734525	.	-	0	transcript_id "g593.t1"; gene_id "g593";
# protein sequence = [MSFNDEKDKNIYDGKLDAESGSTGPIGDDEQVFEEERELK]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g593
###
# start gene g594
Scaffold_16	AUGUSTUS	gene	748113	749180	0.76	-	.	g594
Scaffold_16	AUGUSTUS	transcript	748113	749180	0.76	-	.	g594.t1
Scaffold_16	AUGUSTUS	stop_codon	748113	748115	.	-	0	transcript_id "g594.t1"; gene_id "g594";
Scaffold_16	AUGUSTUS	CDS	748113	749180	0.76	-	0	transcript_id "g594.t1"; gene_id "g594";
Scaffold_16	AUGUSTUS	start_codon	749178	749180	.	-	0	transcript_id "g594.t1"; gene_id "g594";
# protein sequence = [MGVACSPDLANLFGFWFESRKQIWKRPEFGFYGRYIDDCLALVYAHSADEALALCENNINFDGCTIEWNVSEHFQHFL
# DMTLYLDEKGDLQHMPFRKAMSHQERIPWISHHPLDVKRGSFIGEMSRLATLSSTQSHYLVAIKDLASLYVKRGYPSKAVYHWLNNNKKERWDNRLSL
# NNQHDGLSATEDVLVLKTTFNSAWDYFSASELGKRITRYWKEWLIHAEKGDYSSKHPKYRFGEDSLKDTVGSLRSVIDSGAPAGVLTAPVTVPDIRLT
# GLADARWLVSRKRTRNLFDLANLWKKEVFQRMDVDTATNIAQGIPSDNYLDDVEMEDIQTKGDRPVPGDLEYIHYGHAMES]
# Evidence for and against this transcript:
# % of transcript supported by hints (any source): 0
# CDS exons: 0/1
# CDS introns: 0/0
# 5'UTR exons and introns: 0/0
# 3'UTR exons and introns: 0/0
# hint groups fully obeyed: 0
# incompatible hint groups: 0
# end gene g594
###
# command line:
# augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000001