# This output was generated with AUGUSTUS (version 3.4.0). # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Sources of extrinsic information: M RM # Initializing the parameters using config directory /opt/augustus-3.4.0/config/ ... # saccharomyces version. Using default transition matrix. # Looks like split/input_1/input_1.fa_chunk_0000000 is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 27876, name = Scaffold_30) ----- # # Predicted genes for sequence number 1 on both strands # start gene g1 Scaffold_30 AUGUSTUS gene 14380 15390 0.89 - . g1 Scaffold_30 AUGUSTUS transcript 14380 15390 0.89 - . g1.t1 Scaffold_30 AUGUSTUS stop_codon 14380 14382 . - 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_30 AUGUSTUS CDS 14380 15390 0.89 - 0 transcript_id "g1.t1"; gene_id "g1"; Scaffold_30 AUGUSTUS start_codon 15388 15390 . - 0 transcript_id "g1.t1"; gene_id "g1"; # protein sequence = [MATVAKMDNGEYIMSYEVCHNYCRIHVKTSPDGSTWDAADLGTVVATDDGLYPGQSPYTIWDESTKQLVVASQAVRYR # LDNSTAEEQYRVVFTNHAYGVGNWSWSPSPWTVGADAPSCANYSPHLLPVGHGMVRYTAPSAEGTTQFCSERTGAAPIAALPYKADFSENREAGWINF # GGNWTVIHREYEFQPLIKDAVTVAGSSGWNDYVVSANIMISGTSGTAGLKARVSASTTGPYKLKGYMATINATSGELAVWKYNDRTTLLHSKGHTGGI # RANQWYHLSLSVNSTRLTATLNQSHGDSHTSLSVTDPSFQEGMVGLFGTGGSGRFKDVEVAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g1 ### # # ----- prediction on sequence number 2 (length = 33025, name = Scaffold_29) ----- # # Predicted genes for sequence number 2 on both strands # start gene g2 Scaffold_29 AUGUSTUS gene 1 1465 0.25 + . g2 Scaffold_29 AUGUSTUS transcript 1 1465 0.25 + . g2.t1 Scaffold_29 AUGUSTUS CDS 148 493 0.55 + 2 transcript_id "g2.t1"; gene_id "g2"; Scaffold_29 AUGUSTUS CDS 577 1465 0.51 + 1 transcript_id "g2.t1"; gene_id "g2"; Scaffold_29 AUGUSTUS stop_codon 1463 1465 . + 0 transcript_id "g2.t1"; gene_id "g2"; # protein sequence = [KIDNLKTTLSKLKSEISSEKYQLTKIDDLLNGNTVHMSNKEKKEFKKERRKIIFNHENLIQKINLKIEKLSKDYSKLE # EIIFNKENEIKDLEISLKDKSLNELNEIYFKSNISTNTNEKALKLHNLNINNSPGSFSINNSSGLNHIIEEITTNPMYVKISQILNSTESSFEGETPN # NKYKQLQIEETLRFFWNQELNKIFNGKKSLFSNSIGIDILMNSISKLDKVLNTIKTDKRYLKNKNYRNHILLSENGLIISIVLSNVIPHIMKYKASQN # TATLFNRIGKELHSNLLNNEWIKYDKNEKATLTVEKYYVEQNNNKYEIEKGLSKEEFYIRLDAILGIISSDDYFKLGCDLAEIVSENSNLFNFMNVAN # EDNTVQRIIVPGHKLEDQIVKLLAVDTEKLVMICEPCK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g2 ### # start gene g3 Scaffold_29 AUGUSTUS gene 2225 2845 0.38 + . g3 Scaffold_29 AUGUSTUS transcript 2225 2845 0.38 + . g3.t1 Scaffold_29 AUGUSTUS start_codon 2225 2227 . + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_29 AUGUSTUS CDS 2225 2845 0.38 + 0 transcript_id "g3.t1"; gene_id "g3"; Scaffold_29 AUGUSTUS stop_codon 2843 2845 . + 0 transcript_id "g3.t1"; gene_id "g3"; # protein sequence = [MMEADEPLLFLSCCVELKNYYSDPNKFLSNLPVYLDATCSGLQHLSTMINDTNLAKYVNIVKSNKEDIPNDVYTHMVL # FVNKKIQEYIKVDYSLAILDNININRKFIKPGIMTISYGATTRGIAEQLKNNHFRQIDLVKGKSLTYELISKEFNKTDFDIHLTVKQIYVLAKAIHSV # LYDVFPNLTILVKYLKDMNKLLKKLKLPTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g3 ### # start gene g4 Scaffold_29 AUGUSTUS gene 2951 3391 0.99 + . g4 Scaffold_29 AUGUSTUS transcript 2951 3391 0.99 + . g4.t1 Scaffold_29 AUGUSTUS start_codon 2951 2953 . + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_29 AUGUSTUS CDS 2951 3391 0.99 + 0 transcript_id "g4.t1"; gene_id "g4"; Scaffold_29 AUGUSTUS stop_codon 3389 3391 . + 0 transcript_id "g4.t1"; gene_id "g4"; # protein sequence = [MDRNVTDIRKQNNSIVPNVVHSFDASNIALLVENISSNFSVNKMNLLTIHDCFATNANDVDEMVLKVKLAFIALYSEK # SFIDSYHNFILEFINKTGFIIKEKSTSKGENISYVYTENANIQIPKVPSFTINKNLKFDILGSQYFIN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g4 ### # start gene g5 Scaffold_29 AUGUSTUS gene 4297 5133 0.96 - . g5 Scaffold_29 AUGUSTUS transcript 4297 5133 0.96 - . g5.t1 Scaffold_29 AUGUSTUS stop_codon 4297 4299 . - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_29 AUGUSTUS CDS 4297 5133 0.96 - 0 transcript_id "g5.t1"; gene_id "g5"; Scaffold_29 AUGUSTUS start_codon 5131 5133 . - 0 transcript_id "g5.t1"; gene_id "g5"; # protein sequence = [MAKSNELFSKFVEKYSQIKINAEKEGNNAKRSTAKLILNSLYGRFGLKYEPYTIDFVESNVADQIAINHEVFDRVSFD # NNIDFIKYTTAPSELLKELNREVYNKLKNKTDLDGEHVVRALTISAMITSYASILMNPFLNMPDNPCYYTDTDSLFMKYPLEDKYTGKELGKFSFKGI # AKRAYFISPKTYCLIMEDDSVIIKCKGLDNKLLNENHFKELLSGNNVTIDTSKIFTNLKKGTGSIKSMKLTIKPEINNRKFIKSEGLNFDSEPYHVID # GVIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g5 ### # start gene g6 Scaffold_29 AUGUSTUS gene 5215 6120 0.64 - . g6 Scaffold_29 AUGUSTUS transcript 5215 6120 0.64 - . g6.t1 Scaffold_29 AUGUSTUS stop_codon 5215 5217 . - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_29 AUGUSTUS CDS 5215 6120 0.64 - 0 transcript_id "g6.t1"; gene_id "g6"; Scaffold_29 AUGUSTUS start_codon 6118 6120 . - 0 transcript_id "g6.t1"; gene_id "g6"; # protein sequence = [MFKNCFDDMFNHNNYTWYAHNLGGFDSVFILNILFKFYTKTKVQFKDGKPLSIKVSITTKDNNNKNNTKNLVFKDSYK # IQPFSIRNLIKANDITTQKLYFPYLFLRTDNINYEGKLPDKSFYDNISDLEYNKIAYEFKDKIWVLKDELLKYMKNDIVSLYQIIDKFSKEMFDLENL # NITSVSTLSSITLKTYLTNYYNKKKTPIHIPRHANYLDIKNAYFGGRVEVFKGFVENIYIYDVVSLYPSCMLKDLPIGNICRSIDTNIDNYFGFCYAS # VNVPKGIRAPILPFRLDNGSIIYPTGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g6 ### # start gene g7 Scaffold_29 AUGUSTUS gene 6178 7167 0.41 - . g7 Scaffold_29 AUGUSTUS transcript 6178 7167 0.41 - . g7.t1 Scaffold_29 AUGUSTUS stop_codon 6178 6180 . - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_29 AUGUSTUS CDS 6178 6944 0.75 - 2 transcript_id "g7.t1"; gene_id "g7"; Scaffold_29 AUGUSTUS CDS 7032 7167 0.46 - 0 transcript_id "g7.t1"; gene_id "g7"; Scaffold_29 AUGUSTUS start_codon 7165 7167 . - 0 transcript_id "g7.t1"; gene_id "g7"; # protein sequence = [MSLRDIVNYKTGIIKTNPYQGLLKGKEESKFKLGDAKLYPTPSEYAVIGRDILNEEYITYGKHFLISSESDINAVITR # IEGNILVNSVSLNSGEIELAENNNDLESGMRLIVFLIRSVSFDLKVKNLANKLLLSKTETEKKRTKSINKKELLKLNNTRIKALFNSLPNSNLIKDFG # FQIDSHYTDSSGIIGSLYQYKNSKILIHNTNIKEWEGFEGIVFKNDLEYFRFTDKTIGLNAFLRTIGNTTIKFVNNTIIYIDSKINSKLVEPLKMELA # RDTNYGTFDIETALDINNKFIPVSCG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g7 ### # # ----- prediction on sequence number 3 (length = 98480, name = Scaffold_26) ----- # # Predicted genes for sequence number 3 on both strands # start gene g8 Scaffold_26 AUGUSTUS gene 251 727 0.58 - . g8 Scaffold_26 AUGUSTUS transcript 251 727 0.58 - . g8.t1 Scaffold_26 AUGUSTUS stop_codon 251 253 . - 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_26 AUGUSTUS CDS 251 578 0.95 - 1 transcript_id "g8.t1"; gene_id "g8"; Scaffold_26 AUGUSTUS CDS 642 727 0.61 - 0 transcript_id "g8.t1"; gene_id "g8"; Scaffold_26 AUGUSTUS start_codon 725 727 . - 0 transcript_id "g8.t1"; gene_id "g8"; # protein sequence = [MVVVPKLTLDFQNRNDPDAATKFQEMAAAYEILSDPNTRVLYDEGGMEGLQGGRSGGPNMDDLFTQFFTGGGSGFSFG # FDMGPGPSRFSRQNDSVLPHEVTLEDLYNGKTVKMNMESRCYAAHARGAFSGHDLNLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g8 ### # start gene g9 Scaffold_26 AUGUSTUS gene 5731 6411 0.74 + . g9 Scaffold_26 AUGUSTUS transcript 5731 6411 0.74 + . g9.t1 Scaffold_26 AUGUSTUS start_codon 5731 5733 . + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_26 AUGUSTUS CDS 5731 6411 0.74 + 0 transcript_id "g9.t1"; gene_id "g9"; Scaffold_26 AUGUSTUS stop_codon 6409 6411 . + 0 transcript_id "g9.t1"; gene_id "g9"; # protein sequence = [MSMHSRDFSDSPPSTRMSSHSPESAIVRLDDPAWDQTIVMSDTQSDLPNSSASSSYPLPPMSAPPSSKSMQYNPYPST # SRSSSGSGSAYMNSQSNYSQSGDRSLNNINYSIPLVRLDVREEPRTHYPYSPSPYDSNVQNTPPPSAPPHLHSQRDSSISYSIRRPIIEPYTLESGFP # QLPHHVSHHGMHVSSPSPRLQENGVGPELPAPRHIYNTTPEAINRTPSMS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g9 ### # start gene g10 Scaffold_26 AUGUSTUS gene 10882 11406 0.8 + . g10 Scaffold_26 AUGUSTUS transcript 10882 11406 0.8 + . g10.t1 Scaffold_26 AUGUSTUS start_codon 10882 10884 . + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_26 AUGUSTUS CDS 10882 11406 0.8 + 0 transcript_id "g10.t1"; gene_id "g10"; Scaffold_26 AUGUSTUS stop_codon 11404 11406 . + 0 transcript_id "g10.t1"; gene_id "g10"; # protein sequence = [MGDILYFRGRKGWSRPALLIYWIALGSLSVAGWNRQLARSRRFRAWNTAGENLIVPGSGGAFMGPPFVDGLVPQSSGN # SSDTQNGSSVSGGSGSTMGLTFPNLSNLPNLPHLPNGVATDLLDAADKHVPTLRLNARRKFFHALTVIMFVPGVAFDVRAFPGIIEAFKVLTFQYC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g10 ### # start gene g11 Scaffold_26 AUGUSTUS gene 12515 13332 0.24 + . g11 Scaffold_26 AUGUSTUS transcript 12515 13332 0.24 + . g11.t1 Scaffold_26 AUGUSTUS start_codon 12515 12517 . + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_26 AUGUSTUS CDS 12515 12652 0.36 + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_26 AUGUSTUS CDS 12764 12926 0.45 + 0 transcript_id "g11.t1"; gene_id "g11"; Scaffold_26 AUGUSTUS CDS 12980 13332 0.72 + 2 transcript_id "g11.t1"; gene_id "g11"; Scaffold_26 AUGUSTUS stop_codon 13330 13332 . + 0 transcript_id "g11.t1"; gene_id "g11"; # protein sequence = [MENEVLPVTPTSQTPSKTNVGILTLQEPRTFFQTYLISTSLRVLLEALDAFGVEYIELTSPAASEQSRADCEAICKLG # LKAKILTHIRCHMDDARIAVETGVDGVDVVIGTSSFLREFSHGKDMAYITKTAIEVINYVKSKGIEVRFSSEDSFRSDLVDLLSIYQTVDKIGVNRVG # IADTVGCANPRQVYDLVRTLRGVVTCDIEIHLHNDTGMGMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g11 ### # start gene g12 Scaffold_26 AUGUSTUS gene 14793 16881 0.23 + . g12 Scaffold_26 AUGUSTUS transcript 14793 16881 0.23 + . g12.t1 Scaffold_26 AUGUSTUS start_codon 14793 14795 . + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_26 AUGUSTUS CDS 14793 15565 0.3 + 0 transcript_id "g12.t1"; gene_id "g12"; Scaffold_26 AUGUSTUS CDS 15639 15872 0.73 + 1 transcript_id "g12.t1"; gene_id "g12"; Scaffold_26 AUGUSTUS CDS 16080 16881 0.94 + 1 transcript_id "g12.t1"; gene_id "g12"; Scaffold_26 AUGUSTUS stop_codon 16879 16881 . + 0 transcript_id "g12.t1"; gene_id "g12"; # protein sequence = [MQYSSHSFNGTSSGKAATLASISTSDAPLPSSTLPMLPKRAKKSSRPATAPAKEDVALLPSLQPSGKIRQPDIVYANL # QALHEDDSSSDHTNSRPESVPTTPSEPASSSTMQTSSSTMIMMQEPHSMLKDSTSHPESSLTSSPQSVGMFRNYTNTYDWAVFISAYASGRWDPHRTP # NPPDGLGHSMSPMRKLGSGRKPEDDENDEVEQNRTPTANTPSVTSSGNVSPVEQATRTERFISARSSSNQFRSGPPITSFPDADSPAENSQYPPQKAK # AGLFLNLPNLLSMSSSSGTSPGLEPSPASPSPLNVALQSNALHSNMHHSPLDDSSPLSKQTNSSQLHSNSSHLHTSSSRTHIFPNAPTLNAATLRLAG # TYVNISPLALPSPEHELTDPMRAAGAPGRNILVTVPGTVPEDTDSALASSEDGSPSDRVLVDNDPVDASSSGKELFRTHSRNSSTDVKKFADGGDGRE # GGRWLDNSESTGSLVITPGGTTRRIRISQEQKKFWKGTRDVDRPLGTYGQFSASDSHSIGSPLAKGKGKTVKIHSPGLNNGDDDYFTRGRRVLCGFVV # NKMVVNVLPKSMSVLPISRSFICQADLQVLNWIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g12 ### # start gene g13 Scaffold_26 AUGUSTUS gene 17064 19127 0.32 + . g13 Scaffold_26 AUGUSTUS transcript 17064 19127 0.32 + . g13.t1 Scaffold_26 AUGUSTUS start_codon 17064 17066 . + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_26 AUGUSTUS CDS 17064 17569 0.63 + 0 transcript_id "g13.t1"; gene_id "g13"; Scaffold_26 AUGUSTUS CDS 17678 17808 1 + 1 transcript_id "g13.t1"; gene_id "g13"; Scaffold_26 AUGUSTUS CDS 18300 18408 0.57 + 2 transcript_id "g13.t1"; gene_id "g13"; Scaffold_26 AUGUSTUS CDS 18554 19127 0.54 + 1 transcript_id "g13.t1"; gene_id "g13"; Scaffold_26 AUGUSTUS stop_codon 19125 19127 . + 0 transcript_id "g13.t1"; gene_id "g13"; # protein sequence = [MVPHPSGTMSVPVPAITNGTSHTDAITAISNPTDSDSSIDGQLVRRMTLVRQSSAPLPVGSGSNSLLKGSMAVGMPIP # PRILSSLNEAEKSELVPVTEDSFSSPEASESNNNHRYSAAPSEKPKISNIAVGHGVLSSNASIEAMGALINVGQSPSMRAVKEEQMFRELGFNIWNTG # SDLNFDRIAHLAKLVFNTKGVFISLLDGNEQWFKSEFIDDAPREEFTPRHRHTLKEFAAIAMREMELWRDKVGRECLEIDMEQQDPQSPQGSPASAYE # EQSSNPSLSMSGSSMERVYDRAAKLVQRTLDVEGVIVMDVSHCEVLENMSGESTVNVVMHHGDPDVTETTTKSLTADEYAKLNVFFAKNPDGKISEGI # VPQSFRLFLPTTRIQYALSEYCVRSIASSSNWIFTAVPIYNIDKRPFALLCAYNASEHTKRFVSFRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g13 ### # start gene g14 Scaffold_26 AUGUSTUS gene 19729 21200 0.13 + . g14 Scaffold_26 AUGUSTUS transcript 19729 21200 0.13 + . g14.t1 Scaffold_26 AUGUSTUS start_codon 19729 19731 . + 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_26 AUGUSTUS CDS 19729 19902 0.28 + 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_26 AUGUSTUS CDS 20253 20260 0.62 + 0 transcript_id "g14.t1"; gene_id "g14"; Scaffold_26 AUGUSTUS CDS 20342 21200 0.62 + 1 transcript_id "g14.t1"; gene_id "g14"; Scaffold_26 AUGUSTUS stop_codon 21198 21200 . + 0 transcript_id "g14.t1"; gene_id "g14"; # protein sequence = [MQLVEDAVDGCWIGHCARTAIMEDTGTGIGSVYSPPKEDEGQTRKHVEAVIDIGPRLERGSIVTSDSVGGKVDVWSEE # NVGTEIKITFPVEVVEADEVVEMGHLRLDDVNPSPTVSLVGFEDPHKGIRLMRSVLKTYITKWWGLEILENHDGELGNIVILNEDVSVVVKATQRHDT # SRPFVVLSALRGNPTMMSAASDHELIGGFCRIIYKPGGPSRIRSVLRLCLHAMKIGSKSSHPSLFEERQVSNQSFVHNGALSAANTIVPRRYSEDSHL # LTPRPSMSPRSTTAHPNGSSSWKMPTSTVVEEKTDLSDPDTNEPTITLDSGGTLLKSSIRSIDTQLQKLECY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g14 ### # start gene g15 Scaffold_26 AUGUSTUS gene 23979 24749 0.87 + . g15 Scaffold_26 AUGUSTUS transcript 23979 24749 0.87 + . g15.t1 Scaffold_26 AUGUSTUS start_codon 23979 23981 . + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_26 AUGUSTUS CDS 23979 24749 0.87 + 0 transcript_id "g15.t1"; gene_id "g15"; Scaffold_26 AUGUSTUS stop_codon 24747 24749 . + 0 transcript_id "g15.t1"; gene_id "g15"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTLPLILPLLTPTLWTLMQPTPVMGILGKHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g15 ### # start gene g16 Scaffold_26 AUGUSTUS gene 25195 28910 0.53 + . g16 Scaffold_26 AUGUSTUS transcript 25195 28910 0.53 + . g16.t1 Scaffold_26 AUGUSTUS start_codon 25195 25197 . + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_26 AUGUSTUS CDS 25195 26547 0.53 + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_26 AUGUSTUS CDS 26634 28910 0.8 + 0 transcript_id "g16.t1"; gene_id "g16"; Scaffold_26 AUGUSTUS stop_codon 28908 28910 . + 0 transcript_id "g16.t1"; gene_id "g16"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAHDLYLRPEKCEFEQQQIEY # LGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTRQKAFDTLREAFISAPILALWTPDRPT # RIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYL # SRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDN # GLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLIT # QLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLARLGIKSDLTSGYRPQSNGQTERANQE # VEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRK # AHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEE # ILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g16 ### # start gene g17 Scaffold_26 AUGUSTUS gene 42004 42924 1 - . g17 Scaffold_26 AUGUSTUS transcript 42004 42924 1 - . g17.t1 Scaffold_26 AUGUSTUS stop_codon 42004 42006 . - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_26 AUGUSTUS CDS 42004 42924 1 - 0 transcript_id "g17.t1"; gene_id "g17"; Scaffold_26 AUGUSTUS start_codon 42922 42924 . - 0 transcript_id "g17.t1"; gene_id "g17"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLILHRRLCLLPSTPLCKGRCS # ATGTFAVGFTDNSGDPSWGLTSLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAA # DRSHHSYCPSTPSFYPRRVREFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGHHPIFLAHGAPVLFVPKKD # GNFALRGLPVNASPRRTLSLPLISDLLTSETS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g17 ### # start gene g18 Scaffold_26 AUGUSTUS gene 43804 44314 0.96 - . g18 Scaffold_26 AUGUSTUS transcript 43804 44314 0.96 - . g18.t1 Scaffold_26 AUGUSTUS stop_codon 43804 43806 . - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_26 AUGUSTUS CDS 43804 44074 0.99 - 1 transcript_id "g18.t1"; gene_id "g18"; Scaffold_26 AUGUSTUS CDS 44190 44314 0.96 - 0 transcript_id "g18.t1"; gene_id "g18"; Scaffold_26 AUGUSTUS start_codon 44312 44314 . - 0 transcript_id "g18.t1"; gene_id "g18"; # protein sequence = [MLELLSGSRAPLRPLVPSSPLSAVPLTALNQEQGQGARGIRRGSAKEWFVPDILDPDLDSLPAWTSSFKALVKELQDN # FGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g18 ### # start gene g19 Scaffold_26 AUGUSTUS gene 54567 54839 0.4 + . g19 Scaffold_26 AUGUSTUS transcript 54567 54839 0.4 + . g19.t1 Scaffold_26 AUGUSTUS start_codon 54567 54569 . + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_26 AUGUSTUS CDS 54567 54839 0.4 + 0 transcript_id "g19.t1"; gene_id "g19"; Scaffold_26 AUGUSTUS stop_codon 54837 54839 . + 0 transcript_id "g19.t1"; gene_id "g19"; # protein sequence = [MTAWMTIPAVYRGEPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTILTTLSRPSDNSESKSK # VKEPEVFDGSDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g19 ### # start gene g20 Scaffold_26 AUGUSTUS gene 58581 59235 0.37 + . g20 Scaffold_26 AUGUSTUS transcript 58581 59235 0.37 + . g20.t1 Scaffold_26 AUGUSTUS start_codon 58581 58583 . + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_26 AUGUSTUS CDS 58581 58720 0.37 + 0 transcript_id "g20.t1"; gene_id "g20"; Scaffold_26 AUGUSTUS CDS 58815 59235 0.6 + 1 transcript_id "g20.t1"; gene_id "g20"; Scaffold_26 AUGUSTUS stop_codon 59233 59235 . + 0 transcript_id "g20.t1"; gene_id "g20"; # protein sequence = [MMRSVPSKDLDAFASLRGKGSLAGASKRNPLAPPLEIKSSTSILRHLFCFYLSILLFLIQLPLRSTRSRDSDNELLSG # FPLVDAAPRASSPTKVPVSRKEPKSKTAVKVVEDSKASDPPTSALVYKRVRLPPRSRKIAPAASKGKARQTIVTEADSASSEVESEDEDEEEDSAPLQ # NASKRHLPFW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g20 ### # start gene g21 Scaffold_26 AUGUSTUS gene 61596 62216 0.84 + . g21 Scaffold_26 AUGUSTUS transcript 61596 62216 0.84 + . g21.t1 Scaffold_26 AUGUSTUS start_codon 61596 61598 . + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_26 AUGUSTUS CDS 61596 61763 0.85 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_26 AUGUSTUS CDS 61809 62216 0.92 + 0 transcript_id "g21.t1"; gene_id "g21"; Scaffold_26 AUGUSTUS stop_codon 62214 62216 . + 0 transcript_id "g21.t1"; gene_id "g21"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLPVTLRSHVRQISNLTARQSIID # TLCLGHKLFPDIVSDSHFEQHLKFMAFANDARVCINFIRDYTTIVFQNTFVRNRLLDRARSVHSDHEASTRSDNSRFIRKSKKKATRFASSRDVKREP # RSVRFDSDVEVNSQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g21 ### # start gene g22 Scaffold_26 AUGUSTUS gene 63282 63587 0.51 - . g22 Scaffold_26 AUGUSTUS transcript 63282 63587 0.51 - . g22.t1 Scaffold_26 AUGUSTUS stop_codon 63282 63284 . - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_26 AUGUSTUS CDS 63282 63587 0.51 - 0 transcript_id "g22.t1"; gene_id "g22"; Scaffold_26 AUGUSTUS start_codon 63585 63587 . - 0 transcript_id "g22.t1"; gene_id "g22"; # protein sequence = [MVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIF # DAIPHLRLSDTDSDEELSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g22 ### # start gene g23 Scaffold_26 AUGUSTUS gene 63919 65744 0.57 - . g23 Scaffold_26 AUGUSTUS transcript 63919 65744 0.57 - . g23.t1 Scaffold_26 AUGUSTUS stop_codon 63919 63921 . - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_26 AUGUSTUS CDS 63919 64688 0.57 - 2 transcript_id "g23.t1"; gene_id "g23"; Scaffold_26 AUGUSTUS CDS 64814 65744 0.91 - 0 transcript_id "g23.t1"; gene_id "g23"; Scaffold_26 AUGUSTUS start_codon 65742 65744 . - 0 transcript_id "g23.t1"; gene_id "g23"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGP # NATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADD # IELDVQEALDEERSYEIRRNHMLESKTQHVKSSVGIYESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLG # HKGVFATNDFLQKRFWWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENART # LGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g23 ### # start gene g24 Scaffold_26 AUGUSTUS gene 65858 66544 0.76 - . g24 Scaffold_26 AUGUSTUS transcript 65858 66544 0.76 - . g24.t1 Scaffold_26 AUGUSTUS stop_codon 65858 65860 . - 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_26 AUGUSTUS CDS 65858 66544 0.76 - 0 transcript_id "g24.t1"; gene_id "g24"; Scaffold_26 AUGUSTUS start_codon 66542 66544 . - 0 transcript_id "g24.t1"; gene_id "g24"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g24 ### # start gene g25 Scaffold_26 AUGUSTUS gene 66817 67080 0.81 - . g25 Scaffold_26 AUGUSTUS transcript 66817 67080 0.81 - . g25.t1 Scaffold_26 AUGUSTUS stop_codon 66817 66819 . - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_26 AUGUSTUS CDS 66817 67080 0.81 - 0 transcript_id "g25.t1"; gene_id "g25"; Scaffold_26 AUGUSTUS start_codon 67078 67080 . - 0 transcript_id "g25.t1"; gene_id "g25"; # protein sequence = [MVRYEILKRGTESFPKISTEFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDE # TNKQVIMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g25 ### # start gene g26 Scaffold_26 AUGUSTUS gene 68259 71027 1 - . g26 Scaffold_26 AUGUSTUS transcript 68259 71027 1 - . g26.t1 Scaffold_26 AUGUSTUS stop_codon 68259 68261 . - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_26 AUGUSTUS CDS 68259 71027 1 - 0 transcript_id "g26.t1"; gene_id "g26"; Scaffold_26 AUGUSTUS start_codon 71025 71027 . - 0 transcript_id "g26.t1"; gene_id "g26"; # protein sequence = [MDGFPDHKLRRRGYYSRTPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLNEGSQREP # NHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAH # QPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQG # ARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEK # HDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTTFNWTGTQQEAFDTL # REAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLE # FWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQVLEGLETV # KKHGLQRLANGIAEWEEDNGLVYYRAGYMYQQTTIYAPRYSVNAMIIQLLDIPDYMGHLTWSAPTSGGRHCVLLWRKYVEGCEICARKKIQRHPRAVT # QPLDVPSGLWEEVGVDLITQLPNSQGYDAVWSVQTCMENKSMLFLAPAPLQPKVSPISITEKSSVSMVSPSTSKSDRGPQFAAKLMRSLLARLGIKSD # LTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSHSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g26 ### # start gene g27 Scaffold_26 AUGUSTUS gene 72194 72544 0.81 - . g27 Scaffold_26 AUGUSTUS transcript 72194 72544 0.81 - . g27.t1 Scaffold_26 AUGUSTUS stop_codon 72194 72196 . - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_26 AUGUSTUS CDS 72194 72544 0.81 - 0 transcript_id "g27.t1"; gene_id "g27"; Scaffold_26 AUGUSTUS start_codon 72542 72544 . - 0 transcript_id "g27.t1"; gene_id "g27"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFMQRIPLSEETGIRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g27 ### # start gene g28 Scaffold_26 AUGUSTUS gene 74138 75787 0.63 - . g28 Scaffold_26 AUGUSTUS transcript 74138 75787 0.63 - . g28.t1 Scaffold_26 AUGUSTUS stop_codon 74138 74140 . - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_26 AUGUSTUS CDS 74138 75787 0.63 - 0 transcript_id "g28.t1"; gene_id "g28"; Scaffold_26 AUGUSTUS start_codon 75785 75787 . - 0 transcript_id "g28.t1"; gene_id "g28"; # protein sequence = [MKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLCKSTD # HFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELS # DRLGNLEAHREDDVRVFNQDSSNGKKISTPMKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFE # APKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDI # AKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGS # IVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVMTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g28 ### # start gene g29 Scaffold_26 AUGUSTUS gene 75841 76704 0.82 - . g29 Scaffold_26 AUGUSTUS transcript 75841 76704 0.82 - . g29.t1 Scaffold_26 AUGUSTUS stop_codon 75841 75843 . - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_26 AUGUSTUS CDS 75841 76704 0.82 - 0 transcript_id "g29.t1"; gene_id "g29"; Scaffold_26 AUGUSTUS start_codon 76702 76704 . - 0 transcript_id "g29.t1"; gene_id "g29"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g29 ### # start gene g30 Scaffold_26 AUGUSTUS gene 80880 81926 0.67 + . g30 Scaffold_26 AUGUSTUS transcript 80880 81926 0.67 + . g30.t1 Scaffold_26 AUGUSTUS start_codon 80880 80882 . + 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_26 AUGUSTUS CDS 80880 81926 0.67 + 0 transcript_id "g30.t1"; gene_id "g30"; Scaffold_26 AUGUSTUS stop_codon 81924 81926 . + 0 transcript_id "g30.t1"; gene_id "g30"; # protein sequence = [MRLRDRMEKLEESVRRYRNRAHSAEGLIRQYPEDEGLYEIDLPSLSSMQDRLNESEALVRRLATFAHRLYVADPANLL # HYHNTYVGGLIEAVVALLSRGLTHPPEQMRPVVELALDYLSQGRLTHGELHLRSTSSLLYYYSNAADRVDGLYQEMFSHSRFSSDDAFLTAAQHAGYV # DAPPGSLEPPLHRRMFSFGHPIPFPQTPLSDHIPAVPSMDSIMLDWERMIANYVSEVLGYPVPSFVAPPAEEVPNPGVSVEATAPPPIPEDPPVSGTN # APIRSGTPLFLPGSPTPPSPHSPSSIPPSAPAPDVPRETIDLTGEDDDELYESREEFLVRMGEMSVVKQEPNSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g30 ### # start gene g31 Scaffold_26 AUGUSTUS gene 85966 86424 0.42 - . g31 Scaffold_26 AUGUSTUS transcript 85966 86424 0.42 - . g31.t1 Scaffold_26 AUGUSTUS stop_codon 85966 85968 . - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_26 AUGUSTUS CDS 85966 86424 0.42 - 0 transcript_id "g31.t1"; gene_id "g31"; Scaffold_26 AUGUSTUS start_codon 86422 86424 . - 0 transcript_id "g31.t1"; gene_id "g31"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVLNNSGSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g31 ### # start gene g32 Scaffold_26 AUGUSTUS gene 90290 90919 0.98 - . g32 Scaffold_26 AUGUSTUS transcript 90290 90919 0.98 - . g32.t1 Scaffold_26 AUGUSTUS stop_codon 90290 90292 . - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_26 AUGUSTUS CDS 90290 90919 0.98 - 0 transcript_id "g32.t1"; gene_id "g32"; Scaffold_26 AUGUSTUS start_codon 90917 90919 . - 0 transcript_id "g32.t1"; gene_id "g32"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g32 ### # # ----- prediction on sequence number 4 (length = 86771, name = Scaffold_27) ----- # # Predicted genes for sequence number 4 on both strands # start gene g33 Scaffold_27 AUGUSTUS gene 250 819 0.54 - . g33 Scaffold_27 AUGUSTUS transcript 250 819 0.54 - . g33.t1 Scaffold_27 AUGUSTUS stop_codon 250 252 . - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_27 AUGUSTUS CDS 250 819 0.54 - 0 transcript_id "g33.t1"; gene_id "g33"; Scaffold_27 AUGUSTUS start_codon 817 819 . - 0 transcript_id "g33.t1"; gene_id "g33"; # protein sequence = [MTRRIHSLQTFPSYIEDAEDEGDITPSIGDEEDEDEQDLPPSERPRPSIHFRPPIHEEEDEDGDDEDKDDYTPAKRHR # RPSRQEREDKEDEEDDEDEEDDEDDEDDEDEVEEEDPTPAKRNHHPSIQEREDEDDEEDEVEEEDPTAKHPRPSRQEEEEKPEHEEKDSTLATRPLLK # QEEGLKNLEEPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g33 ### # start gene g34 Scaffold_27 AUGUSTUS gene 4192 4515 0.91 + . g34 Scaffold_27 AUGUSTUS transcript 4192 4515 0.91 + . g34.t1 Scaffold_27 AUGUSTUS start_codon 4192 4194 . + 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_27 AUGUSTUS CDS 4192 4515 0.91 + 0 transcript_id "g34.t1"; gene_id "g34"; Scaffold_27 AUGUSTUS stop_codon 4513 4515 . + 0 transcript_id "g34.t1"; gene_id "g34"; # protein sequence = [MEPEGENHNEESLPGRSLPSVEQEHNGEIIVGDLPSVSDGEMVSGQEACGAASTGEARIEKQGGPVKPETDSLGDLDE # EHLPVIGNSPPLVEERDGETGQRTKTIAE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g34 ### # start gene g35 Scaffold_27 AUGUSTUS gene 9086 10009 0.98 + . g35 Scaffold_27 AUGUSTUS transcript 9086 10009 0.98 + . g35.t1 Scaffold_27 AUGUSTUS start_codon 9086 9088 . + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_27 AUGUSTUS CDS 9086 10009 0.98 + 0 transcript_id "g35.t1"; gene_id "g35"; Scaffold_27 AUGUSTUS stop_codon 10007 10009 . + 0 transcript_id "g35.t1"; gene_id "g35"; # protein sequence = [MPALANVSVGSLDAPHISTTSERNETNDPEGGEDDNIGPGRRADREEVEQMLFAIDAELALISAQSTAIKGDSTVGEE # AHKSGQTCVESNTGSAETSSGHEERGSSTERRSKEAPSESEDMGNPPRRIKRRSTDVEDHDADDEGQDLPPERRSTKGRSESEDVDDPPHRARQRSTD # VEDDADDVRGRSTDDEDESDELRKVGPKESEQGSDDAKSDEELGRTTGLGRGRDSSDCERNPKRRKITHQVRSSEERRSQDSTDIVSVGSDIIRMKKE # EQTRTERFFETLEEQGPAFEVSIPEEVGYCGSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g35 ### # start gene g36 Scaffold_27 AUGUSTUS gene 10691 11899 0.62 + . g36 Scaffold_27 AUGUSTUS transcript 10691 11899 0.62 + . g36.t1 Scaffold_27 AUGUSTUS start_codon 10691 10693 . + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_27 AUGUSTUS CDS 10691 11037 0.63 + 0 transcript_id "g36.t1"; gene_id "g36"; Scaffold_27 AUGUSTUS CDS 11383 11899 0.9 + 1 transcript_id "g36.t1"; gene_id "g36"; Scaffold_27 AUGUSTUS stop_codon 11897 11899 . + 0 transcript_id "g36.t1"; gene_id "g36"; # protein sequence = [MANPKSFGLGTDEEAILFVRNLENLRFVAFGLGGGEWGRVATANVIQRWHVEDAGKASMLQLCRGLGCLVFAQPKIGS # DREGFLRVGFEEAEDEGWDYYNVILESGDCWWVKQPMSHHLNPGKMEDLITILMVTNVVQLARVLDTRTYEGGMPSSIARAYGVGDAYVKRLLHWLEG # NVWVTHSADKSQSNFVVDFAHEFLIVQAKALILRRWMLQQRDIAGNVTQESAREVRRAIEEENFARENWFKRYWPSEEQWDELLSGNKDITVDFAWDK # SPKGFTYYIRNAA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g36 ### # start gene g37 Scaffold_27 AUGUSTUS gene 28466 30417 0.87 - . g37 Scaffold_27 AUGUSTUS transcript 28466 30417 0.87 - . g37.t1 Scaffold_27 AUGUSTUS stop_codon 28466 28468 . - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_27 AUGUSTUS CDS 28466 29232 0.95 - 2 transcript_id "g37.t1"; gene_id "g37"; Scaffold_27 AUGUSTUS CDS 29358 30417 0.87 - 0 transcript_id "g37.t1"; gene_id "g37"; Scaffold_27 AUGUSTUS start_codon 30415 30417 . - 0 transcript_id "g37.t1"; gene_id "g37"; # protein sequence = [MTAQSSSFVDYTPFLTHLVVLLSIYEKPIPAKQRQRRTPGHVSPSNPHSVPLTPHCDGQSTAPMLDANWSLEIVPQTT # STSTITVLPTNASPTGALPTSNGSIPLSSPQVTQPLPPTASIPLPSYTGPSDWRTDSILRSLSVVVGRMHQAEMQNASSKLHSKFANGTGIPSVVNGV # SDSVRSTSRLNNEHEDGTLDLDSPKVTPATSAPALNTFGRRSPSPSTIANFRTSVAATNGAAGMLSSGSLSARRAAQGLATPGRHTASSSISSTSSVI # ASSHNILSSTTSHIGRQPAAAGKINSPTAGANGVTSTAASRTSSPQTIASPFSPIILGEHGEKQLPASAQISSTPTPESGSRLFSPLIALADFDFVNL # TGNSVSSKAVSRSTSAHSSDTEGSDATYETAYDTVQPAHNVHFTGPSDTDSSWSDPSTSTVHGSSSHNEHAEGPHIVIDGLNGISPYGEAGQFEDYAQ # YAQWYSSTHYQGQFAGDKPSKKERFNGHRGSDDEYADDETEDKEEVTPPQTELEFLKSLTLSDREAHFFRLSRLRLAFTARMKNTNNTTRSGATGFKD # DLEYRMKIIVAGIAAGDVGVGSLVRWVRMFIRTCTARTVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g37 ### # start gene g38 Scaffold_27 AUGUSTUS gene 34438 35319 0.88 - . g38 Scaffold_27 AUGUSTUS transcript 34438 35319 0.88 - . g38.t1 Scaffold_27 AUGUSTUS stop_codon 34438 34440 . - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_27 AUGUSTUS CDS 34438 35319 0.88 - 0 transcript_id "g38.t1"; gene_id "g38"; Scaffold_27 AUGUSTUS start_codon 35317 35319 . - 0 transcript_id "g38.t1"; gene_id "g38"; # protein sequence = [MHTQRPPQARNAGGVFGSLIASTGNITGAAAPTPSTLAPNVDRPGFNLTRYGYKDDHFENKAAANRSPSIRGHHPGAK # SLGHVELDNDSSFDGSMLARISTAPAESGAGLAVSDSFFTSSSNAHSSKSASPSTASANAFADQYPHLMARTPVSAYIPAPTDYFSPQHGSSELTPGP # LPLFQGEKDMHPKPLLSRLEPTTPGGTPISSIAKRAKWTGVLKDFPGTTGIHLPYARSGKSTPATPGSITASERDWYDSVYSEKESREEREKREKRER # DKKERKKRKKAELFVSLVI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g38 ### # start gene g39 Scaffold_27 AUGUSTUS gene 35384 35767 0.84 - . g39 Scaffold_27 AUGUSTUS transcript 35384 35767 0.84 - . g39.t1 Scaffold_27 AUGUSTUS stop_codon 35384 35386 . - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_27 AUGUSTUS CDS 35384 35767 0.84 - 0 transcript_id "g39.t1"; gene_id "g39"; Scaffold_27 AUGUSTUS start_codon 35765 35767 . - 0 transcript_id "g39.t1"; gene_id "g39"; # protein sequence = [MAPPSGGVLGALLTLYNAQNDTASESIPPSGASTPTIQEEPTSNVREHKESRRARQNRADFDEASKSDFKSDFKSPPL # HSEYSPSRLEVIDTDEGRPLPQTQRLDDDNELNQTISSPTSPSSSWFAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g39 ### # start gene g40 Scaffold_27 AUGUSTUS gene 37047 37880 0.75 - . g40 Scaffold_27 AUGUSTUS transcript 37047 37880 0.75 - . g40.t1 Scaffold_27 AUGUSTUS stop_codon 37047 37049 . - 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_27 AUGUSTUS CDS 37047 37880 0.75 - 0 transcript_id "g40.t1"; gene_id "g40"; Scaffold_27 AUGUSTUS start_codon 37878 37880 . - 0 transcript_id "g40.t1"; gene_id "g40"; # protein sequence = [MSHIDATTKPTPSSSSSTLFQPQPIRSPTYPLATYGPYPNVYSPFSTRSGPPSPSPYGYSSHRSPQYSPDGSRTLSRS # GSRKSSRSPISRSPSHSELSRNSSYRSNLNNSAFRPVSIMSKKNNSNGNGSGSGSLNGNLNEGLKSRKAGLEVDGVEEQQRVTAGDSGSSGSSGGPSS # SMNPSPISPSAADTTAAGQGAVSISASTSTNGAKPARKGKAVQWLDHHLNSQAAQAQAQAHAQQHHNIDLNDPPISTTIGLGLIVDESLIDNKHLLER # ENS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g40 ### # start gene g41 Scaffold_27 AUGUSTUS gene 45696 46082 0.68 - . g41 Scaffold_27 AUGUSTUS transcript 45696 46082 0.68 - . g41.t1 Scaffold_27 AUGUSTUS stop_codon 45696 45698 . - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_27 AUGUSTUS CDS 45696 45970 0.75 - 2 transcript_id "g41.t1"; gene_id "g41"; Scaffold_27 AUGUSTUS CDS 46067 46082 0.69 - 0 transcript_id "g41.t1"; gene_id "g41"; Scaffold_27 AUGUSTUS start_codon 46080 46082 . - 0 transcript_id "g41.t1"; gene_id "g41"; # protein sequence = [MILNAYFNFAFDFKVELDFDFDFAFDFKVELDFLDFDFDFDFDFDFDFAFDFKVELDFDFDFDFKVELDFDFDFDFKV # ELDFDFDFDFDFKVECGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g41 ### # start gene g42 Scaffold_27 AUGUSTUS gene 50846 51995 0.29 + . g42 Scaffold_27 AUGUSTUS transcript 50846 51995 0.29 + . g42.t1 Scaffold_27 AUGUSTUS start_codon 50846 50848 . + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_27 AUGUSTUS CDS 50846 50945 0.58 + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_27 AUGUSTUS CDS 51008 51183 0.89 + 2 transcript_id "g42.t1"; gene_id "g42"; Scaffold_27 AUGUSTUS CDS 51291 51995 0.54 + 0 transcript_id "g42.t1"; gene_id "g42"; Scaffold_27 AUGUSTUS stop_codon 51993 51995 . + 0 transcript_id "g42.t1"; gene_id "g42"; # protein sequence = [MLNNELDGLTEDDDHDLLQLPPLDSPASPPPSNGPSLVDLPEGVPCVNVHWRYMLPLPPGMVQRSPVLAKSLTGHEMF # TDEPRSAIPKEWIHKSPEPASSSPSYSSVPVDYHLQRQPQREPKTHTSPFVADDDPGFNIDGFVTELTLNSPEKKKRALFKLGKHSGPPSPIEPPSPI # EPSAPLDNVAREISLNSPEPMKRPLPRLLAKLSGPPSPIDPSPPSSRSLKSSKTPPLPSVSPNALTDPLPAGSSGTSTPSSSPMPSLTPLLTSSFPPL # SPPCPPGLQELIQSPSASKKFAQSCETLFKGAYGPQVHHLGDHIRSYQVKSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g42 ### # start gene g43 Scaffold_27 AUGUSTUS gene 52433 53455 0.9 - . g43 Scaffold_27 AUGUSTUS transcript 52433 53455 0.9 - . g43.t1 Scaffold_27 AUGUSTUS stop_codon 52433 52435 . - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_27 AUGUSTUS CDS 52433 53455 0.9 - 0 transcript_id "g43.t1"; gene_id "g43"; Scaffold_27 AUGUSTUS start_codon 53453 53455 . - 0 transcript_id "g43.t1"; gene_id "g43"; # protein sequence = [MSLVARKKSMDSAKLWIKWLIYTLLCFTADLLDTLLSLVVPKSKPPLSLKPSDVDNLSDDEILNEFAKTRDELDRQNL # EKGVEYDWTVLPRGTPGTVGKAVSVLSEEDESMTDSSEANALNLLWANTMIPVPRVRRVMKLEYLFFIVEDYIEGPTLAQVWSTYSLWQKIRVAFTLR # SYIRQLRKLKAPRGAPPGPISKDGPRVCTTPLFGMLDLDQGPFASYADLASFFNEKAKLCYDYNNIPEDHPCRRQKFDDSEELVLSHQDLNPRNIIVG # LDGTIWMIDWGWAGYFPPWFEYVAMKEKSISEHRHQHWDLFIPFICGPYFEHEIWRLNMARGFSYR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g43 ### # start gene g44 Scaffold_27 AUGUSTUS gene 56232 57495 0.28 + . g44 Scaffold_27 AUGUSTUS transcript 56232 57495 0.28 + . g44.t1 Scaffold_27 AUGUSTUS start_codon 56232 56234 . + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_27 AUGUSTUS CDS 56232 56818 0.62 + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_27 AUGUSTUS CDS 56907 57138 0.6 + 1 transcript_id "g44.t1"; gene_id "g44"; Scaffold_27 AUGUSTUS CDS 57253 57495 0.46 + 0 transcript_id "g44.t1"; gene_id "g44"; Scaffold_27 AUGUSTUS stop_codon 57493 57495 . + 0 transcript_id "g44.t1"; gene_id "g44"; # protein sequence = [MTHSSSIKSNAQAPHAHEKWFDITYEAHLYLSMLFEREFPEQFRQYQRAHSAAKWYRTDPGPYIGRVIVWKLHSTDHI # DNEDGCPTATWTVGGSYTGGFLDFVDAETRFLYQPGHIVLGWTGFLFHKVTDWVCKPTATLDSQRVGVTPGRVAAVNYFPIASFNILKDKRGLGKKDT # VWGNGRKEGLYYSHLNPRMVVELDFDFDFDFDFRVELDFDFDFDFKVELDFGFHLDFDFSSTSTLTLTSTSESSSTSTSTSTSKSSSTSAFTSTSTSF # DFDFDFDFDFRVELDFDFDFDFKVELDFGFHLDFDFSSTSTLTLTSTSESSSTSTSTSTSKSSSTSAFTSTSTSVRLRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g44 ### # start gene g45 Scaffold_27 AUGUSTUS gene 59219 59812 0.57 + . g45 Scaffold_27 AUGUSTUS transcript 59219 59812 0.57 + . g45.t1 Scaffold_27 AUGUSTUS start_codon 59219 59221 . + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_27 AUGUSTUS CDS 59219 59812 0.57 + 0 transcript_id "g45.t1"; gene_id "g45"; Scaffold_27 AUGUSTUS stop_codon 59810 59812 . + 0 transcript_id "g45.t1"; gene_id "g45"; # protein sequence = [MDQQQPQNSSSSSSELFSPQQNPLLLSSSSDQSHPPSPPDEHTRFRAFRHWNSSSSSSSSELFSPQENPFLLSESSNE # LSKNLRMTQDSVRFRASRHLNSSSSSSSSELFSPQENPFLLSESSNELSKNLRMTQDSVRFRASRHLNSSSSSSSSELYSPQENPFLLSESSHETSSV # VLEDAFDLPGAKRGKATVRSW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g45 ### # start gene g46 Scaffold_27 AUGUSTUS gene 60081 63257 0.14 + . g46 Scaffold_27 AUGUSTUS transcript 60081 63257 0.14 + . g46.t1 Scaffold_27 AUGUSTUS start_codon 60081 60083 . + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_27 AUGUSTUS CDS 60081 61934 0.29 + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_27 AUGUSTUS CDS 62255 62419 0.6 + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_27 AUGUSTUS CDS 62472 63257 0.7 + 0 transcript_id "g46.t1"; gene_id "g46"; Scaffold_27 AUGUSTUS stop_codon 63255 63257 . + 0 transcript_id "g46.t1"; gene_id "g46"; # protein sequence = [MILLIFLLQAIVDDLHFHPNLVSNVLANLETLKPGVWIEYSCVEKFLINQRLELPEDQVFTHYVPQMNHTESVTPETI # AQYCEVYKFDPSSNRKPACTIINPNSTHWWGLYLDRDRDEAYVLGRSTTAGFNENATRDWQSWRGPQIWQRICQLHGWNDDLPSRVFQLDWNQYGGND # CGAHIVGVLQAIVRKGFAVSPMSIHVLPEVPCIHQTRLAMLEKLFGVCIHSLQKYRAVALRDPQALDGNEVQALLTVIEENYLDDRLPGGVHPQTAEY # YRGTFRELKRAMISCLQCKPKKISNKRKLHAESLHQPSPVPPPPPQYLTAKTFSESYPVVDGVPPAAPGSPLRCKQSLRPPPENCSTGEKPTAKGVIL # EADSPALPSKVPLLLPPLYQTAGAISKKYPELEGLFPAGHVPRLTSKATTKLPLQSKVEDPSVPRRFPRPFPAPNLSPVYRRPLLMGLDDKFDDYEGG # PTLEAIAKLPVEYDGFNDAGLIYHINNPTINPLGIWESWQDRGWRLLPGFCQAFDMQTPTPEFLRQHLIPPLGPFSPPQKFLDPELDDNVKIVSLTEL # RDMVASDPLIAVKGIQPRPWPLGARQIKVDLEVDAHQPKHLFYVVDIDSFVFYPALAAVKPEWDHQYSVQSMETWLHQNGKGQTPKGVEISPEEFQLM # TKRMRLLIKQDKEDPGELQRFGSFFFALTLKGTKDFTKTAVDRRETVGEAISKSIQKFQNELPYVDFDLMDRQHGCESYVDLGVTVTPPSDPPLVGLL # KLPHLEASFGAGGYNMGKSHRLATLDGYGALQAEAGIEHERQSHVAHSSAYSVFYQQFRKADNSVDWFGLSDVANNTPKFVADYQHLEEVLSMDSEKK # VSYGVRREFRVGVEAIYVMASEEMHVLVCSIHRATSTQGLIKITGLRFICGSNNMDIKALVVQVLVRSSICP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g46 ### # start gene g47 Scaffold_27 AUGUSTUS gene 74444 75600 0.38 - . g47 Scaffold_27 AUGUSTUS transcript 74444 75600 0.38 - . g47.t1 Scaffold_27 AUGUSTUS stop_codon 74444 74446 . - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_27 AUGUSTUS CDS 74444 75155 0.38 - 1 transcript_id "g47.t1"; gene_id "g47"; Scaffold_27 AUGUSTUS CDS 75491 75600 0.38 - 0 transcript_id "g47.t1"; gene_id "g47"; Scaffold_27 AUGUSTUS start_codon 75598 75600 . - 0 transcript_id "g47.t1"; gene_id "g47"; # protein sequence = [MSDERFLGGSGLHYEVEISRTVLTHTFEVDGIGVGGFSALPGSNAEKTTRRLNPVCDVIEITDSGSDDDKCSVIELTD # SSDNEDAPTKKDVLKVGPRKQPAPTAYTKKHFHKVRPRKQSAATVPIKKQFHKVRPRKRSALTSTDEARLNPPKGDQLIGPQAEGKTVSAMLAQVLEL # APDVQPRLARDLILRHFTVGQNQVLEAVIQSLFEPTSGRRVEKRNSTEQGQLEGGGHKRPRLGEVDYSRVDRNQKGGPDYQGLCMVRAIHLRLWCVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g47 ### # start gene g48 Scaffold_27 AUGUSTUS gene 79925 81512 0.81 + . g48 Scaffold_27 AUGUSTUS transcript 79925 81512 0.81 + . g48.t1 Scaffold_27 AUGUSTUS start_codon 79925 79927 . + 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_27 AUGUSTUS CDS 79925 81039 0.81 + 0 transcript_id "g48.t1"; gene_id "g48"; Scaffold_27 AUGUSTUS CDS 81173 81512 0.88 + 1 transcript_id "g48.t1"; gene_id "g48"; Scaffold_27 AUGUSTUS stop_codon 81510 81512 . + 0 transcript_id "g48.t1"; gene_id "g48"; # protein sequence = [MAPSTQDPSHGNNARPDHSSPSSNSTSTVGSKEKRTTATKSDEPSSSILSSFHKVFVNGVPLADYVKEDPHWNLLLDI # ATPCMECEHKRIECTVPAKYPRCEPCGSSNCSISRLARHRAFARQHGKDLAFSRKFLDEHGATKKDSYTIPLNYWRTYDSLLRKRNHPPEISAEFRIF # EQNEDLTTEETSPDPHINESSAQLLSKPSKEKKKVPKRLTEEATPKDTKKGKGWAEETTAKNTKKGKKRFSKESVPPDTNKAKRRLTEESLSKDDETG # KGRSAEEALPKDNKKGKGRAVNESIRKDHDTAKRRLVETPPIPARLRAQTKSLSPSDLLDLTPAHGQYLHCTIVLSNVPVLTPTSILVKPHTTPPLRI # TPFSLTFQQNPLTSSLPPMPRPINHQRLQTENEKLKEQTQHLESLLASSRLEISRLTSALKDTTTSLETRAQEVVELRRTIDSETQQKAEYSQVIADY # HNLDQAIKGPSSLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g48 ### # start gene g49 Scaffold_27 AUGUSTUS gene 82287 82712 0.89 + . g49 Scaffold_27 AUGUSTUS transcript 82287 82712 0.89 + . g49.t1 Scaffold_27 AUGUSTUS start_codon 82287 82289 . + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_27 AUGUSTUS CDS 82287 82712 0.89 + 0 transcript_id "g49.t1"; gene_id "g49"; Scaffold_27 AUGUSTUS stop_codon 82710 82712 . + 0 transcript_id "g49.t1"; gene_id "g49"; # protein sequence = [MFPITSTLPSLPMTLDDQLPAVPNFDQRMVLWDRYLQVYLEALLNGTPLEPVRRILDDPLHDKSHPPAVDTSLPHGGV # EPTDVASDGSYVKNLSTSCGGPVPGSPDENIATASSSSVSIVDGPIEEKTVDLSSDNGSLFTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g49 ### # # ----- prediction on sequence number 5 (length = 34043, name = Scaffold_28) ----- # # Predicted genes for sequence number 5 on both strands # start gene g50 Scaffold_28 AUGUSTUS gene 17106 17846 0.59 + . g50 Scaffold_28 AUGUSTUS transcript 17106 17846 0.59 + . g50.t1 Scaffold_28 AUGUSTUS start_codon 17106 17108 . + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_28 AUGUSTUS CDS 17106 17846 0.59 + 0 transcript_id "g50.t1"; gene_id "g50"; Scaffold_28 AUGUSTUS stop_codon 17844 17846 . + 0 transcript_id "g50.t1"; gene_id "g50"; # protein sequence = [MLQGIIEELRSLLMSASALHHQELLQASAAERTQMEARLMGSLQDDIRGITRSELKLLESNLQQKLTSLLPMEAINRL # LSSLENTFTHLYDPVPPTQGLPTSTPPPKWPSVQYEPHQSGKLPSTPPKPIPPSQQRHTPRISSTTQLPSLLTCLQDGPSALQPETVSFDSKHSMITA # GKRRAMEHEEDSRDSKRHPTTHEQPTLSPSSSHLNGTPCHLQLTVFLPCIIGGHPTLMLLYMSPFPVLDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g50 ### # start gene g51 Scaffold_28 AUGUSTUS gene 20050 20409 0.43 + . g51 Scaffold_28 AUGUSTUS transcript 20050 20409 0.43 + . g51.t1 Scaffold_28 AUGUSTUS start_codon 20050 20052 . + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_28 AUGUSTUS CDS 20050 20409 0.43 + 0 transcript_id "g51.t1"; gene_id "g51"; Scaffold_28 AUGUSTUS stop_codon 20407 20409 . + 0 transcript_id "g51.t1"; gene_id "g51"; # protein sequence = [MNPPDPLTTHFDPARLQEEATQANTIPLPSPPSSHPDFNLDITVLNVAAVKAYLKRTSHSDAKGADSATYSQLMSIPN # DRLALLFGRAFRNNELPSSWLTSIIIAVPKPGKDLTNPANY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g51 ### # start gene g52 Scaffold_28 AUGUSTUS gene 29610 30098 0.93 - . g52 Scaffold_28 AUGUSTUS transcript 29610 30098 0.93 - . g52.t1 Scaffold_28 AUGUSTUS stop_codon 29610 29612 . - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_28 AUGUSTUS CDS 29610 30098 0.93 - 0 transcript_id "g52.t1"; gene_id "g52"; Scaffold_28 AUGUSTUS start_codon 30096 30098 . - 0 transcript_id "g52.t1"; gene_id "g52"; # protein sequence = [MLDSKEWGFKEADIVLYCDACPTGMGFWFHYDDKTLGYQCMIPDDHEKPIFYFEALTVVSAILHTIKLPFVPRVFVFT # DNTNMVDMFHSLKAKQLYNPLLLTTVDHAICSNIQFRVAHIRREENGIADALSRFDYTRLMHLAPSMKIYNFTPPQLVLGAEQL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g52 ### # start gene g53 Scaffold_28 AUGUSTUS gene 30492 30857 0.69 - . g53 Scaffold_28 AUGUSTUS transcript 30492 30857 0.69 - . g53.t1 Scaffold_28 AUGUSTUS stop_codon 30492 30494 . - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_28 AUGUSTUS CDS 30492 30857 0.69 - 0 transcript_id "g53.t1"; gene_id "g53"; Scaffold_28 AUGUSTUS start_codon 30855 30857 . - 0 transcript_id "g53.t1"; gene_id "g53"; # protein sequence = [MDNLHDLGAALIHVRRVYGCSVNLVVFKSDVSAAYRRLPMDPHWQIKQVVGFGDRYNVNQCNNFGSRDGGGLYGSFMA # LILWVAIYVKFIVDLFAWVDDTFGWDFEGNLAYYAPYAEFYPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g53 ### # start gene g54 Scaffold_28 AUGUSTUS gene 31068 31943 0.69 - . g54 Scaffold_28 AUGUSTUS transcript 31068 31943 0.69 - . g54.t1 Scaffold_28 AUGUSTUS stop_codon 31068 31070 . - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_28 AUGUSTUS CDS 31068 31943 0.69 - 0 transcript_id "g54.t1"; gene_id "g54"; Scaffold_28 AUGUSTUS start_codon 31941 31943 . - 0 transcript_id "g54.t1"; gene_id "g54"; # protein sequence = [MRPLLTNARPRRLVRSSSNSDRQSLEKGLTTPETGRLSLPSTPKPSHLSFPIEQMSSKNTASISLDSLEPFLNSIMTK # SSTMTRPSVIESLNLDNMSSPILVSSRTSSCIGSKPLPPKLENQDKEKISLEGANLARGTMKVNAQTQPSPVGTNTSAESVTKMTIPVQNAQTKYWSR # RPHYARALMWDDVEKPTENMSLADSSVYMTPLPRPPRDVILDDTVLDTIRKNPHLFNITTPINVNRFQTLLNSHPNQEFVESVCTGFRQGFWPRASGN # KPGTPLVLDRTCELHDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g54 ### # # ----- prediction on sequence number 6 (length = 279175, name = Scaffold_23) ----- # # Predicted genes for sequence number 6 on both strands # start gene g55 Scaffold_23 AUGUSTUS gene 671 1923 0.99 - . g55 Scaffold_23 AUGUSTUS transcript 671 1923 0.99 - . g55.t1 Scaffold_23 AUGUSTUS stop_codon 671 673 . - 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_23 AUGUSTUS CDS 671 1076 1 - 1 transcript_id "g55.t1"; gene_id "g55"; Scaffold_23 AUGUSTUS CDS 1331 1923 0.99 - 0 transcript_id "g55.t1"; gene_id "g55"; Scaffold_23 AUGUSTUS start_codon 1921 1923 . - 0 transcript_id "g55.t1"; gene_id "g55"; # protein sequence = [MQRLPEVQAVLKSFPWGRLESDGTFSSEIARGRFDVLGGSGYGFWSHRGGPIPHQLHGDGAFQIDNVSHSAQFIQTML # RAFDHLDGSDLLKTRHLTDEEGWKLPRELIPFRDITQDARRPMLVTQFQGGVVDWDSWYRWRNLPKMSPAALLMDFPMSVYQMLVHCLEITSPNAGSE # IKPVNLDIYFLGVEVELNFLPLGNTTWFPNPHTVPDAIVACNAGLASYPEWVPIIRATLVLGIPFATTEYCEQSAEAQRNFFPMLIRGSRVFIPLDDQ # SHKIELNPFHRPGQRVFPMYSLPNLVNGFTLVVYKSKAVDHELTGDIGRGRYTLDEID] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g55 ### # start gene g56 Scaffold_23 AUGUSTUS gene 4245 5784 0.17 - . g56 Scaffold_23 AUGUSTUS transcript 4245 5784 0.17 - . g56.t1 Scaffold_23 AUGUSTUS stop_codon 4245 4247 . - 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_23 AUGUSTUS CDS 4245 4633 0.43 - 2 transcript_id "g56.t1"; gene_id "g56"; Scaffold_23 AUGUSTUS CDS 4705 5086 0.17 - 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_23 AUGUSTUS CDS 5476 5493 0.85 - 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_23 AUGUSTUS CDS 5545 5784 0.98 - 0 transcript_id "g56.t1"; gene_id "g56"; Scaffold_23 AUGUSTUS start_codon 5782 5784 . - 0 transcript_id "g56.t1"; gene_id "g56"; # protein sequence = [MASTLPSLPPVAGTDPSSSVFDAFRISIAKRVADALHPLTIEQAYAGVDFGKKGEDFTVALPRFRLPGKVDELAKRVI # DQFQADDFYGSQEELQRDAIKHLFDIYVKINKDAETDPEVKVEAAKFFRRMEDGDESALKNWREWRELSVKKYEAEYDRLNVHFDVYTGESKVGQKSI # DDAIKRLDEMGLIEDHEGAKLINLEKHKLGKAVVRKKDGTSIYLTRDIGGAVERYEKYKFDKMIYVISSQQDLHVSQFFKVLELMEFPWAKDLVHINY # GLVQGMSTRKGTVVFLNQIIKEATTVMHEQMQKNEEKYNAVEDPEKTSEELGITGIKIQDMTAKRYVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g56 ### # start gene g57 Scaffold_23 AUGUSTUS gene 7949 8807 0.77 + . g57 Scaffold_23 AUGUSTUS transcript 7949 8807 0.77 + . g57.t1 Scaffold_23 AUGUSTUS start_codon 7949 7951 . + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_23 AUGUSTUS CDS 7949 7967 0.77 + 0 transcript_id "g57.t1"; gene_id "g57"; Scaffold_23 AUGUSTUS CDS 8248 8807 1 + 2 transcript_id "g57.t1"; gene_id "g57"; Scaffold_23 AUGUSTUS stop_codon 8805 8807 . + 0 transcript_id "g57.t1"; gene_id "g57"; # protein sequence = [MFKKVNDYNQDGTETRKTFLHCPSAIEAEEAEEIGVEHLLRDIKDSTTTTLATRVSEQLSSLRGLQSRLSDVQKYLAD # VAAGTMPVNHQIVYHLQDALNLLPDLADADTTQSFATSTNDELLVVYLSSLLRAVIALHALVDNKATIGRAELEEDEKERKPGGKGEKNDTKKSEDKD # SSKGSKVDVDAKDKGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g57 ### # start gene g58 Scaffold_23 AUGUSTUS gene 11937 12530 0.69 - . g58 Scaffold_23 AUGUSTUS transcript 11937 12530 0.69 - . g58.t1 Scaffold_23 AUGUSTUS stop_codon 11937 11939 . - 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_23 AUGUSTUS CDS 11937 12530 0.69 - 0 transcript_id "g58.t1"; gene_id "g58"; Scaffold_23 AUGUSTUS start_codon 12528 12530 . - 0 transcript_id "g58.t1"; gene_id "g58"; # protein sequence = [MRSLDHAAQQANVLLLNEIGLDPGIDHVSAISMLERLKEEGKEVKSFESFCGGLPEPDLLRYPEQAENSMHGVGANLD # YPPAGPLSYKFSWSPRGVLTAALNGARYKMGGNIVEVPGIGFSGKGTGILARENMFPIIDFGECEHDGELRKLQGMLEGLPNRDSLPYAEMYGLPDGT # RTVLRGTLRYADVLHHFGDIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g58 ### # start gene g59 Scaffold_23 AUGUSTUS gene 12783 13556 0.58 - . g59 Scaffold_23 AUGUSTUS transcript 12783 13556 0.58 - . g59.t1 Scaffold_23 AUGUSTUS stop_codon 12783 12785 . - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_23 AUGUSTUS CDS 12783 13556 0.58 - 0 transcript_id "g59.t1"; gene_id "g59"; Scaffold_23 AUGUSTUS start_codon 13554 13556 . - 0 transcript_id "g59.t1"; gene_id "g59"; # protein sequence = [MPFYKMEHISSSSNGSSPASTSQNPPKNPVYVQSVDILPASLPVDASKHFSNGLKKYLWGVVRQYASGLEVKNVAFQE # TREAETRDEIKEVEAALKRATIACGGRLAGRFAEEGFLGAKVGAYRAKRDATAVDNLTGPYYGGSKRSLSSLSSSSSSSFTTSPASSMLSPPSSPLPP # LPTSPKHPKHPKRILLLGSGMVAGPAIRWIMQRIMKEKDVVLSLRGKERGELERLKGLARSIPDNVREMVTFRQVDYSRGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g59 ### # start gene g60 Scaffold_23 AUGUSTUS gene 16910 17420 0.94 - . g60 Scaffold_23 AUGUSTUS transcript 16910 17420 0.94 - . g60.t1 Scaffold_23 AUGUSTUS stop_codon 16910 16912 . - 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_23 AUGUSTUS CDS 16910 17314 0.94 - 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_23 AUGUSTUS CDS 17418 17420 0.99 - 0 transcript_id "g60.t1"; gene_id "g60"; Scaffold_23 AUGUSTUS start_codon 17418 17420 . - 0 transcript_id "g60.t1"; gene_id "g60"; # protein sequence = [MTTRGNEHPSKVLLLKYDYEPVINGPDAANPNILGEALQIIVDSLGITESHPPELKFAVAPGRGYAGDSEDLYSTGYL # ITFHMRHGFDPSIRGAYHAFIQYAKNFNEKFPRERAKILSGQLYRERYYARETYETF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g60 ### # start gene g61 Scaffold_23 AUGUSTUS gene 19178 19576 0.84 - . g61 Scaffold_23 AUGUSTUS transcript 19178 19576 0.84 - . g61.t1 Scaffold_23 AUGUSTUS stop_codon 19178 19180 . - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_23 AUGUSTUS CDS 19178 19576 0.84 - 0 transcript_id "g61.t1"; gene_id "g61"; Scaffold_23 AUGUSTUS start_codon 19574 19576 . - 0 transcript_id "g61.t1"; gene_id "g61"; # protein sequence = [MAKGYNLSAECLTSKESHAALKEYLRNDSILRTEIHEKTGQVLGLTDDIQGAIETDLDRCADLEDDIDVPFNEVVAET # LNEREDNTDIVMGLYGLVSAAPGEDIWAYDDEGNLWSETGNLPEISGNSLTTVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g61 ### # start gene g62 Scaffold_23 AUGUSTUS gene 25911 26207 0.88 + . g62 Scaffold_23 AUGUSTUS transcript 25911 26207 0.88 + . g62.t1 Scaffold_23 AUGUSTUS start_codon 25911 25913 . + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_23 AUGUSTUS CDS 25911 26207 0.88 + 0 transcript_id "g62.t1"; gene_id "g62"; Scaffold_23 AUGUSTUS stop_codon 26205 26207 . + 0 transcript_id "g62.t1"; gene_id "g62"; # protein sequence = [MSRNASNSSKEPPPGQQKLGFHPTQPVRNPMTPASPAVSTNGDDDQRTLIAKAITMKLMASDEDCTVVLPVKLVKLAA # AAKDGKTKITQGDMWEKVHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g62 ### # start gene g63 Scaffold_23 AUGUSTUS gene 38346 38812 0.54 - . g63 Scaffold_23 AUGUSTUS transcript 38346 38812 0.54 - . g63.t1 Scaffold_23 AUGUSTUS stop_codon 38346 38348 . - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_23 AUGUSTUS CDS 38346 38569 0.99 - 2 transcript_id "g63.t1"; gene_id "g63"; Scaffold_23 AUGUSTUS CDS 38686 38812 0.54 - 0 transcript_id "g63.t1"; gene_id "g63"; Scaffold_23 AUGUSTUS start_codon 38810 38812 . - 0 transcript_id "g63.t1"; gene_id "g63"; # protein sequence = [MLHLLSGFKGSIETLGTILAALGRPSDSSESKSKVKEPEVFDAKEWFVPDILDPDLDSLPAWTSSFKALVKKLQDNFG # VYNAQGEAEDSLSNLKMKETKNIQKYNIQFNTLAASTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g63 ### # start gene g64 Scaffold_23 AUGUSTUS gene 38933 39403 0.99 - . g64 Scaffold_23 AUGUSTUS transcript 38933 39403 0.99 - . g64.t1 Scaffold_23 AUGUSTUS stop_codon 38933 38935 . - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_23 AUGUSTUS CDS 38933 39403 0.99 - 0 transcript_id "g64.t1"; gene_id "g64"; Scaffold_23 AUGUSTUS start_codon 39401 39403 . - 0 transcript_id "g64.t1"; gene_id "g64"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSIPAIGQPRCRNRGFGPATVPTTLTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRHGQPPVVAPARGQSTTRIDSPILQAIARRTGKQPQRCAASESPRDPPPHFDLDAGDHDDQDPPVDPDDPGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g64 ### # start gene g65 Scaffold_23 AUGUSTUS gene 40787 41161 0.9 - . g65 Scaffold_23 AUGUSTUS transcript 40787 41161 0.9 - . g65.t1 Scaffold_23 AUGUSTUS stop_codon 40787 40789 . - 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_23 AUGUSTUS CDS 40787 41161 0.9 - 0 transcript_id "g65.t1"; gene_id "g65"; Scaffold_23 AUGUSTUS start_codon 41159 41161 . - 0 transcript_id "g65.t1"; gene_id "g65"; # protein sequence = [MSATSMERPSSSKLESKKQKSTLSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNVRTPEGRQPVVQ # EPPPVEPVMGPPQRRYTSMGYAQPGSSPMGGFTYSPTWGTRGPPLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g65 ### # start gene g66 Scaffold_23 AUGUSTUS gene 42697 43204 0.51 + . g66 Scaffold_23 AUGUSTUS transcript 42697 43204 0.51 + . g66.t1 Scaffold_23 AUGUSTUS start_codon 42697 42699 . + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_23 AUGUSTUS CDS 42697 42812 0.51 + 0 transcript_id "g66.t1"; gene_id "g66"; Scaffold_23 AUGUSTUS CDS 42865 43204 0.57 + 1 transcript_id "g66.t1"; gene_id "g66"; Scaffold_23 AUGUSTUS stop_codon 43202 43204 . + 0 transcript_id "g66.t1"; gene_id "g66"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTILEWPVPRKVKDIHDIIVPMTRLTRKGAPWIWDNNCQEAFENLKTAFTSAPIL # AQEPNRPIIVETNASDYTIAAILSIQTVDGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFTVAPLSGRFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g66 ### # start gene g67 Scaffold_23 AUGUSTUS gene 43304 43615 0.5 + . g67 Scaffold_23 AUGUSTUS transcript 43304 43615 0.5 + . g67.t1 Scaffold_23 AUGUSTUS start_codon 43304 43306 . + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_23 AUGUSTUS CDS 43304 43615 0.5 + 0 transcript_id "g67.t1"; gene_id "g67"; Scaffold_23 AUGUSTUS stop_codon 43613 43615 . + 0 transcript_id "g67.t1"; gene_id "g67"; # protein sequence = [MVIRFQLGKLSKKPDSITRRWNIYPKEGDIGYMQVNPHNFRPIFTNKQLTTSLRATFLEGPMLQASIVMDIEALHQAI # ILALPKDPSSVVGLELAKDPSNVGA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g67 ### # start gene g68 Scaffold_23 AUGUSTUS gene 46160 47728 0.13 + . g68 Scaffold_23 AUGUSTUS transcript 46160 47728 0.13 + . g68.t1 Scaffold_23 AUGUSTUS start_codon 46160 46162 . + 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_23 AUGUSTUS CDS 46160 46167 0.89 + 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_23 AUGUSTUS CDS 46336 46470 0.19 + 1 transcript_id "g68.t1"; gene_id "g68"; Scaffold_23 AUGUSTUS CDS 46819 46825 0.62 + 1 transcript_id "g68.t1"; gene_id "g68"; Scaffold_23 AUGUSTUS CDS 46923 47295 0.63 + 0 transcript_id "g68.t1"; gene_id "g68"; Scaffold_23 AUGUSTUS CDS 47400 47728 0.69 + 2 transcript_id "g68.t1"; gene_id "g68"; Scaffold_23 AUGUSTUS stop_codon 47726 47728 . + 0 transcript_id "g68.t1"; gene_id "g68"; # protein sequence = [MKGRGHINLPFAADVPKTDRNYLQALKPKVEDEFRVSLMCRVALTLLVSTKTYTGASGWTYSHEGGFNVVSATEDAWR # NFVSVHKQFKPFKTSGWPLWELMHEIVPTQARGVHVFNAASQDTAQETGDSLSEPELDPRSRSATPLQDVENRSPSEDSAISESHFPRLLMNHRILSD # TPTPWSSKRVRLTGPETIHSLGQSVHGISDTLCDIFGTTSKSTALSPSKKLAIAWQRIKEDVQGFYISDDQATDLKILFARDNAAADAYGAEEDSVDR # AKIAAKLLY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g68 ### # start gene g69 Scaffold_23 AUGUSTUS gene 49810 50710 0.62 + . g69 Scaffold_23 AUGUSTUS transcript 49810 50710 0.62 + . g69.t1 Scaffold_23 AUGUSTUS start_codon 49810 49812 . + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_23 AUGUSTUS CDS 49810 50429 0.62 + 0 transcript_id "g69.t1"; gene_id "g69"; Scaffold_23 AUGUSTUS CDS 50518 50710 0.93 + 1 transcript_id "g69.t1"; gene_id "g69"; Scaffold_23 AUGUSTUS stop_codon 50708 50710 . + 0 transcript_id "g69.t1"; gene_id "g69"; # protein sequence = [MPQDDPNVPRYRKIEQMVKDLGWDHAKSYFANIEDDKDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVC # MFNQDSSNGKKISTPMKEQDWSKRTLRSNAVAPEESDKAKQNQINDNMRRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDWSLKKPSVM # IEDDDESDDKDTIKLIPSSRPTNQINSKHRLHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELALYHLLLERLLCARYAIEESVQGLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g69 ### # start gene g70 Scaffold_23 AUGUSTUS gene 52298 52576 0.38 + . g70 Scaffold_23 AUGUSTUS transcript 52298 52576 0.38 + . g70.t1 Scaffold_23 AUGUSTUS start_codon 52298 52300 . + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_23 AUGUSTUS CDS 52298 52576 0.38 + 0 transcript_id "g70.t1"; gene_id "g70"; Scaffold_23 AUGUSTUS stop_codon 52574 52576 . + 0 transcript_id "g70.t1"; gene_id "g70"; # protein sequence = [MTRQMVNKAIGIEKSINLNTEEEFTKYKPVDKKVISIKAMLPDEFRIERHIHGDPLKELPELSKHPKPFAPTGRYMEE # RKEIIDKNHPEGFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g70 ### # start gene g71 Scaffold_23 AUGUSTUS gene 53162 53853 0.46 + . g71 Scaffold_23 AUGUSTUS transcript 53162 53853 0.46 + . g71.t1 Scaffold_23 AUGUSTUS start_codon 53162 53164 . + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_23 AUGUSTUS CDS 53162 53169 0.47 + 0 transcript_id "g71.t1"; gene_id "g71"; Scaffold_23 AUGUSTUS CDS 53478 53853 0.46 + 1 transcript_id "g71.t1"; gene_id "g71"; Scaffold_23 AUGUSTUS stop_codon 53851 53853 . + 0 transcript_id "g71.t1"; gene_id "g71"; # protein sequence = [MKGRVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILR # DEIPHVTIPYIDDVPVKDHQLDMNYQKEVTKLFQKILELDDLFGNISKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g71 ### # start gene g72 Scaffold_23 AUGUSTUS gene 54468 55953 0.18 + . g72 Scaffold_23 AUGUSTUS transcript 54468 55953 0.18 + . g72.t1 Scaffold_23 AUGUSTUS start_codon 54468 54470 . + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_23 AUGUSTUS CDS 54468 54897 0.34 + 0 transcript_id "g72.t1"; gene_id "g72"; Scaffold_23 AUGUSTUS CDS 55496 55953 0.6 + 2 transcript_id "g72.t1"; gene_id "g72"; Scaffold_23 AUGUSTUS stop_codon 55951 55953 . + 0 transcript_id "g72.t1"; gene_id "g72"; # protein sequence = [MLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGET # EEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDAHVKSSVGIXEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWL # EEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDISKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTR # DELIGYRAQALSKHNSFIERV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g72 ### # start gene g73 Scaffold_23 AUGUSTUS gene 59595 61880 0.49 + . g73 Scaffold_23 AUGUSTUS transcript 59595 61880 0.49 + . g73.t1 Scaffold_23 AUGUSTUS start_codon 59595 59597 . + 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_23 AUGUSTUS CDS 59595 61880 0.49 + 0 transcript_id "g73.t1"; gene_id "g73"; Scaffold_23 AUGUSTUS stop_codon 61878 61880 . + 0 transcript_id "g73.t1"; gene_id "g73"; # protein sequence = [MLAYETRLDKASGEIWLTVSDELREDIRDVQGDPKAMLDTLEAKYNKKAPGSHFKAYNAFLNTSIRLDIPSLEILPAL # LTDISAAMSTVRRLRPDNYGLDEMEAELATMVALRALQVSDNPDHRLLASSFMMNPNLSWTDIESAIDRDFQSKSEPGVKQEEDTVLAMAAGLGPCFL # CDGPHYVKDCPDLSKAKRNLASSPSMNRRGRGRGRGTANSATSSPKPESSLPTANLAATAEFAGKASAFASADNRSQWFRSEASANWNTDTGASSHMT # PHRSWFISYSKHRVPVRLADNSVIYSEGIGSVEFQPDGGGTSVIFHDTLHVPDIACNLLSLYHLTSRKGYEIHVHNRTVKFMLDKKTVFTATINHSNI # GYLNGTMILPATANRTSTLPLNHELWHRRFAHLNHDGVMLTFENKLVEGMKLDSKKLPDPICESCIMGKQHRKNIPQGPGTRRTKRLHLVHSDLKGPL # PPMREGYRYWMTFVDDSSRFRVIAYLRTKGEASKAIKVFRAYAQAITGEEWLILRCDGGGEYISNELKLWAADVGLQIQFTEPDEPHQNGVAECANRD # MIEAVDTLLQESGLPKSFWRLVLNFYLHSFNRTPTSALPNTTTPYTEWHLHRPDVSYFRIFGCLAYVLIPKKKRKALDPHSRKCIFVGYPYGTKAWLF # WDPELKKFYTSSHAAFDEHYLSGNSPTKLATTPHAPPYVSDDGEYSDDTTPLTHSNDPQPHPPPPDNPPDFPEPSPQLPPSPPPDPSTTQSREQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g73 ### # start gene g74 Scaffold_23 AUGUSTUS gene 62591 63781 0.34 + . g74 Scaffold_23 AUGUSTUS transcript 62591 63781 0.34 + . g74.t1 Scaffold_23 AUGUSTUS start_codon 62591 62593 . + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_23 AUGUSTUS CDS 62591 63781 0.34 + 0 transcript_id "g74.t1"; gene_id "g74"; Scaffold_23 AUGUSTUS stop_codon 63779 63781 . + 0 transcript_id "g74.t1"; gene_id "g74"; # protein sequence = [MKQPEGFKDQNPDWVLRLRKSLYGLKQAGRVWIETLNSALLDMEFKRITCENSVWVYGRGDDRIFIPVYVDDLTIAVK # SRLQIDRIISQLKQRFKLHELGPISWLLGVEITQDLNRGTVTLSQKQYCLDILECFGMSNCDSVVSPLDPGVHLSKEHCPTSYEEELEMRPIPYINAV # GALAYLAIATHPDIAFTVSVLARFSVNPGIIYWKAVKHVFRYLKGTLNYKITYTRPMTPTTSVSNIFQAYSDADHGGNLDNGRSTSSSVLLMAGGAVS # WASRLQRIVTLSTTEAEFVAAVSTGQEILWFRNFLTELGYLFTSASTLFIDNQSAISVAKDPEHHGRMKHLDLRYYWLRDEVHKGRICVVYLPTNLMP # ADILTKAMGRQKVADMVCLLGLTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g74 ### # start gene g75 Scaffold_23 AUGUSTUS gene 78756 79710 0.56 - . g75 Scaffold_23 AUGUSTUS transcript 78756 79710 0.56 - . g75.t1 Scaffold_23 AUGUSTUS stop_codon 78756 78758 . - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_23 AUGUSTUS CDS 78756 79096 0.75 - 2 transcript_id "g75.t1"; gene_id "g75"; Scaffold_23 AUGUSTUS CDS 79149 79710 0.59 - 0 transcript_id "g75.t1"; gene_id "g75"; Scaffold_23 AUGUSTUS start_codon 79708 79710 . - 0 transcript_id "g75.t1"; gene_id "g75"; # protein sequence = [MTRYHVVQHERSIFSPPDPAAAPPALTHLPVLHIPSESEASSDASDLDDDEDVSSVVDMGTALDNHGDREDEEILDRV # GQSLSPVESNFDLNELGIHAQWMRMEKIILTNWTPSDDLETDGEDSVRGDDDIPFPLEDENPLDDDLEEDNFWDFGEFDWKQFQEYGGGGRLPASEQV # RAGYFNEFSKIENKLSAYDLAICRAFSYKLQSHTTDANFRKLPYAFPTTTPLPSLDKIRSRIAFYQALNLKFTTAVSIPASATQDHMSPVNGVLSVMN # HDTILVGSLEKHLSIFQLSLDSRPLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g75 ### # start gene g76 Scaffold_23 AUGUSTUS gene 86188 86778 0.49 - . g76 Scaffold_23 AUGUSTUS transcript 86188 86778 0.49 - . g76.t1 Scaffold_23 AUGUSTUS stop_codon 86188 86190 . - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_23 AUGUSTUS CDS 86188 86778 0.49 - 0 transcript_id "g76.t1"; gene_id "g76"; Scaffold_23 AUGUSTUS start_codon 86776 86778 . - 0 transcript_id "g76.t1"; gene_id "g76"; # protein sequence = [MSCHITAWLNIIAAANAKSPNKLVGINDLLKSHYEIYGRSYFSRYDYEEVPSEGANAMVAAINDALKNKSLDNTTHVS # ASTGGKFTVSGIYNFEYKDPIDHSISSNQGQVITFSDGSRVVFRLSGTGSQGATVRMYVERYVAPEAGAAALNGDTAEGLKGLIEVALEISQLKKFLG # REKPTVITVRRMLSIIYGFC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g76 ### # start gene g77 Scaffold_23 AUGUSTUS gene 87385 88573 0.57 - . g77 Scaffold_23 AUGUSTUS transcript 87385 88573 0.57 - . g77.t1 Scaffold_23 AUGUSTUS stop_codon 87385 87387 . - 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_23 AUGUSTUS CDS 87385 88002 0.99 - 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_23 AUGUSTUS CDS 88493 88573 0.58 - 0 transcript_id "g77.t1"; gene_id "g77"; Scaffold_23 AUGUSTUS start_codon 88571 88573 . - 0 transcript_id "g77.t1"; gene_id "g77"; # protein sequence = [MLRSHITFQIFGIPLARLGSASPRPRRHYTENFVQSIFDSIEPKGVTLVIGGDGRYFSPETVQTILKIGSANGVAKFI # IGKDSILSTPAASNVIRKYKAYGGILLTASHNPGGPDNDFGIKYNVSNGGPAPENVTNKIYEKSKTIASYKVIEAPAVSLAEFTDGYSFLIEYDNQVD # LSKIGEASYGPSKVSIIDSVADYLTLLEEIFDFPLIKTSSPPMPTNTEFSLMVCTA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g77 ### # start gene g78 Scaffold_23 AUGUSTUS gene 95697 96065 0.4 + . g78 Scaffold_23 AUGUSTUS transcript 95697 96065 0.4 + . g78.t1 Scaffold_23 AUGUSTUS start_codon 95697 95699 . + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_23 AUGUSTUS CDS 95697 96065 0.4 + 0 transcript_id "g78.t1"; gene_id "g78"; Scaffold_23 AUGUSTUS stop_codon 96063 96065 . + 0 transcript_id "g78.t1"; gene_id "g78"; # protein sequence = [MDWNTDAIKMWFFSRDDIPSDITEKSPNPSSWGEPAALFSNSACDIGSHFSEHTLTINTDVCGGWTESAFSSSGCSGT # CADTVADPSNFDSEFLYSILFTAKYQTGVTDARWKINYIATYQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g78 ### # start gene g79 Scaffold_23 AUGUSTUS gene 103716 104207 0.36 - . g79 Scaffold_23 AUGUSTUS transcript 103716 104207 0.36 - . g79.t1 Scaffold_23 AUGUSTUS stop_codon 103716 103718 . - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_23 AUGUSTUS CDS 103716 104207 0.36 - 0 transcript_id "g79.t1"; gene_id "g79"; Scaffold_23 AUGUSTUS start_codon 104205 104207 . - 0 transcript_id "g79.t1"; gene_id "g79"; # protein sequence = [MIEGVHESTENQITMHTNAGCTLATGQAITGTVSGTTCESSDSNNNGCATMDTTPSGWGTAFNAAGGGVFAKLWDDTG # VKIWHFSRGNIPADITSKNPDPSTWGNPVSFLPSGDSCNVAEHFKDHSLIINITLCGQWAGATFSCGGTCQSAVMDPSNFVGQCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g79 ### # start gene g80 Scaffold_23 AUGUSTUS gene 107404 108459 0.61 + . g80 Scaffold_23 AUGUSTUS transcript 107404 108459 0.61 + . g80.t1 Scaffold_23 AUGUSTUS start_codon 107404 107406 . + 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_23 AUGUSTUS CDS 107404 108459 0.61 + 0 transcript_id "g80.t1"; gene_id "g80"; Scaffold_23 AUGUSTUS stop_codon 108457 108459 . + 0 transcript_id "g80.t1"; gene_id "g80"; # protein sequence = [MSYSNTGPISVTTDVNANRPYGDDTSGYGSLPGGSPRNRYGSTDDDFRRDGRGGSKVYRGGRGRWNEGRGKRDGRDHF # RDRDRGAKRSRSRSPPSRYGARREIKPYSPPRRPLPAVRESFDTGDSQPSAGNSEKDEFGRDARSQAPESLKDAAELQIGIHDVAQTTPAAPSPMQPP # VTMARIAPPTSISTPSASKTVPHNPSLEQFNVATFDFTNPESWEALGKMWLVSYGTMPTTEQLMQFVMFAGASADPSQMMSQDSWDQSGWDGTENPYM # DTQNVSMGGMNGGMAYGGNHLQGQSTANGNWKAGGDPRVAHQSKSNAEEPSTEKRGGGMRKVGDKWIFVREADSPAL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g80 ### # start gene g81 Scaffold_23 AUGUSTUS gene 110013 111057 0.19 + . g81 Scaffold_23 AUGUSTUS transcript 110013 111057 0.19 + . g81.t1 Scaffold_23 AUGUSTUS start_codon 110013 110015 . + 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_23 AUGUSTUS CDS 110013 110159 0.19 + 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_23 AUGUSTUS CDS 110242 111057 0.73 + 0 transcript_id "g81.t1"; gene_id "g81"; Scaffold_23 AUGUSTUS stop_codon 111055 111057 . + 0 transcript_id "g81.t1"; gene_id "g81"; # protein sequence = [MRNLALEPLKELQHKRQIKFHRVIWLKGFTCPNDILETIKISFANDAAMLTNNSVSKRWRTRDIEGDQFRQSKSSSKP # DAVPPRDKVGASRYAQHFPFQVFCCEAGTHVVDPAQSYYKGISYRAGTDFHNLSTPEDPPVRTPDSPCLDSSQAWFCRDLWVRTARDAMDEVDRVNGG # APIRGNRKRDVNLIDVAERDPLMDEARAAAAEEGKQKREAAAAAEDPDANVGSDYDAMSDEEGGEVVPPLEDIEPGKLSIPNSVFRPARILVNPRCPT # TYAGVSHTQLALDLFGNGENKEEVRGKYVLEDWEGAPESFVCQEQR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g81 ### # start gene g82 Scaffold_23 AUGUSTUS gene 111401 111953 0.4 + . g82 Scaffold_23 AUGUSTUS transcript 111401 111953 0.4 + . g82.t1 Scaffold_23 AUGUSTUS start_codon 111401 111403 . + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_23 AUGUSTUS CDS 111401 111412 0.4 + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_23 AUGUSTUS CDS 111525 111953 0.59 + 0 transcript_id "g82.t1"; gene_id "g82"; Scaffold_23 AUGUSTUS stop_codon 111951 111953 . + 0 transcript_id "g82.t1"; gene_id "g82"; # protein sequence = [MVTSIFQGPTVSKGSKPSEDDDADDSMVIDEEEDAPQAKKGDFSGLPPLNDISAMFNDIVSRASELKDVATHLQGRKF # RVATMCSGTESPLLALDMIVESISAQYGVKLDVEHVFSCEIEPFKQAYIERNFHPPLLFRDVCELGSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g82 ### # start gene g83 Scaffold_23 AUGUSTUS gene 112968 116477 0.15 + . g83 Scaffold_23 AUGUSTUS transcript 112968 116477 0.15 + . g83.t1 Scaffold_23 AUGUSTUS start_codon 112968 112970 . + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_23 AUGUSTUS CDS 112968 114096 0.37 + 0 transcript_id "g83.t1"; gene_id "g83"; Scaffold_23 AUGUSTUS CDS 115762 116477 0.87 + 2 transcript_id "g83.t1"; gene_id "g83"; Scaffold_23 AUGUSTUS stop_codon 116475 116477 . + 0 transcript_id "g83.t1"; gene_id "g83"; # protein sequence = [MIGLEALSMQGLPVDRMLLTRETEDQLADLAGNAMSTTVVGACIIGSMIVGLRLFKKGDEKAVYGGGDAFEEFEDVEM # KDIESSAKPPPELPVDERIVGEKSLIFEPLNLTATQSQSLAHLLGIASRTVRLCSCEGRTDITSRPLSRCVDCGASSCKRCGGRPEHNTEPIDIIANP # RLPPSTFEMELKSALPMCLSLLNVTTKLLDELNEKTLGDLNGKLWKEWCTAVLVASSSDLRYVELKRQEVWSAIFRSPHGSLELHLDPQQPEWRFFAK # PKDNEPANAQIRQILDNPVGRLICQGSLLSGQWAFALPKSTEVEITMKGSGSLVPAWESRLGLQGEAFREKKVWSEIQVSVPKADKPKFDRDISGTYE # LLDRSEDEATQVSQLQSKRLKGKSYRNAADALEKGETTEQQEVSSTKGEPKRTRTVLDSVEIPVYRANSKLASKSSGAETSSDADHDEDGDVLTKRSR # RAAARKPIVLSDDDSSDDDSKKIAPKKKATSKSAKNSRARKHVNRRQAMSDDGDDSFVEDSSNEGGSDEADSSEVPSEDDIPSPKSKAKKIQVKKKAA # PPPSSASEDDMDVDEDPQSSAKGKRKAKGDGIAQRRSSVSIPTHGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g83 ### # start gene g84 Scaffold_23 AUGUSTUS gene 117282 117980 0.95 + . g84 Scaffold_23 AUGUSTUS transcript 117282 117980 0.95 + . g84.t1 Scaffold_23 AUGUSTUS start_codon 117282 117284 . + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_23 AUGUSTUS CDS 117282 117980 0.95 + 0 transcript_id "g84.t1"; gene_id "g84"; Scaffold_23 AUGUSTUS stop_codon 117978 117980 . + 0 transcript_id "g84.t1"; gene_id "g84"; # protein sequence = [MKACDVIVQERQKQLNDCKENLLSAIKDGVKREKDLNKKLNNAGGESMFLEWLRICRTDGVEDLEATNIIRSLIEKAD # APTMKAKPRKDDVTLSESVKAQVWDHREKTHEIRRLTKELVGRVRSLRYFTVVRDLQKQRKQPPVLSCPVCGRKALEVEDASVLSSCGHIGCNDCVRS # CAEKEECVYSASGGCKSAARVINVVKAETLGVDDVERDGTGKHFGMKLEQVINLIK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g84 ### # start gene g85 Scaffold_23 AUGUSTUS gene 120258 120881 0.77 - . g85 Scaffold_23 AUGUSTUS transcript 120258 120881 0.77 - . g85.t1 Scaffold_23 AUGUSTUS stop_codon 120258 120260 . - 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_23 AUGUSTUS CDS 120258 120881 0.77 - 0 transcript_id "g85.t1"; gene_id "g85"; Scaffold_23 AUGUSTUS start_codon 120879 120881 . - 0 transcript_id "g85.t1"; gene_id "g85"; # protein sequence = [MSTIKEVVSKCDALVTIDYLSPLPVILAVDSSYIACGIILSQDNKDGRRRPSRFWSIAWNEREARYSQAKIELYGLFR # AFHAMKVYIIGVQKLVVEMDASYVKGMINNPDMHPNAAVNRWIAAIQLFDFDLKHIPGKEFVGPDGISKTTKTVDEGDELEGTAEEWVDEILSAGVWI # AGAWDKEDKFGGIVSIEALERLRRSAWQHKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g85 ### # start gene g86 Scaffold_23 AUGUSTUS gene 123967 124536 0.4 - . g86 Scaffold_23 AUGUSTUS transcript 123967 124536 0.4 - . g86.t1 Scaffold_23 AUGUSTUS stop_codon 123967 123969 . - 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_23 AUGUSTUS CDS 123967 124536 0.4 - 0 transcript_id "g86.t1"; gene_id "g86"; Scaffold_23 AUGUSTUS start_codon 124534 124536 . - 0 transcript_id "g86.t1"; gene_id "g86"; # protein sequence = [MSTPPPRAATKGPAYMPAPGSTRAPDKFKGNSSQLRDFLEEFEGHAAAQELTDDEKVRSILKYVDGMTRSYWKTLDSY # EERDWEKMKTELFDAYPGARKGHRYTVKGLLKLAESNALNRIEEEADLIEYYRQFRIMSRLLKIDKKVTTDEINRYFWYGIHKLDRKEILGRIELKDS # AFDRTTVPDMERS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g86 ### # start gene g87 Scaffold_23 AUGUSTUS gene 129976 130731 0.79 + . g87 Scaffold_23 AUGUSTUS transcript 129976 130731 0.79 + . g87.t1 Scaffold_23 AUGUSTUS start_codon 129976 129978 . + 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_23 AUGUSTUS CDS 129976 130731 0.79 + 0 transcript_id "g87.t1"; gene_id "g87"; Scaffold_23 AUGUSTUS stop_codon 130729 130731 . + 0 transcript_id "g87.t1"; gene_id "g87"; # protein sequence = [MSLYNVSKVASISVVREFELPETWSNTIVKFLPNSSPRSDISQSSDALFYAAPETRVFAISSTPAAISHSGYYPMNWL # FLKESYFRFPSRKDGFRVSWRQWGRYCLIKEIDVPPSAIRGPCVVGTKVFYVENALAHSSRSPTPSSRSTRLRVIDFSPFAEPDEFPRGWTFVGPRAS # LFPIESRRSIPSSSVDGLPVEGLDATEDNVILFLVKGFTFLLSDCNQPEGFVGIATRSSIRQRADFWYTHSRQWD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g87 ### # start gene g88 Scaffold_23 AUGUSTUS gene 130883 131725 0.76 - . g88 Scaffold_23 AUGUSTUS transcript 130883 131725 0.76 - . g88.t1 Scaffold_23 AUGUSTUS stop_codon 130883 130885 . - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_23 AUGUSTUS CDS 130883 131725 0.76 - 0 transcript_id "g88.t1"; gene_id "g88"; Scaffold_23 AUGUSTUS start_codon 131723 131725 . - 0 transcript_id "g88.t1"; gene_id "g88"; # protein sequence = [MSGLDPEEILNSSLETLYDYQPITLASTGSVFTYNLKKSKDSAINVTLYTPDTDASNWSLHASSIWASSQYLVDYIDD # LHLESHIAAISQEKVRLLELGAGAGLPGIVIAKSHPDSVLVTVSDYPDENIIQTLLENIEINRVSSNCCAKAYAWGTDSGELLLAQPSNQIPRLFDVV # IAADTLWNSDLHTVFIDSLKRTLRKASGSRVHIVAGLHTGRYTLQSFLDAASQSGFDIESVEERDRSGSRRREWDISRAEQEDEKERRKWLLWIVLKW # SVFSFA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g88 ### # start gene g89 Scaffold_23 AUGUSTUS gene 139658 141183 0.29 - . g89 Scaffold_23 AUGUSTUS transcript 139658 141183 0.29 - . g89.t1 Scaffold_23 AUGUSTUS stop_codon 139658 139660 . - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_23 AUGUSTUS CDS 139658 140395 0.52 - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_23 AUGUSTUS CDS 140467 141183 0.3 - 0 transcript_id "g89.t1"; gene_id "g89"; Scaffold_23 AUGUSTUS start_codon 141181 141183 . - 0 transcript_id "g89.t1"; gene_id "g89"; # protein sequence = [MMARDDQVLPYQAYLPPTELIYALQDVPLSKIRLDAEYTTNFTPVISENPEEAASPPPSFEDSTGPYALAIQIGSQIA # GFWGLTDDWDFKFSFKSDPPPTPPSGPSISSSAGYSLQDAIVAASNSNAYNAGPQTSYGSSDISGNRYMTVEELNRTKATTLGAPKAVGHTFTQKNFH # GLWWGAERIWTGDLLRLKIGRNAIARDGAPHILAPSPAGPSALLHSAQNGDNLDPKELGARSRCRAAGTLYELADIDWVDPSEDAAKKPSSTPLGTDS # AIFGEDSNGMSKALPQPSPLKPTALPNPNPAIPIAETAPQMLSEILPHSSVPENKVNGVYKPPIPVSHYDLPQPPTGFKFRPILDPGYEAVFSLTLLS # GRYYPGILGHPLLMEAIHQALTPEGKIDPQTSHLWALEGLEPGFSNSVDPIRYKKDRLRMVVDGEVNARAQLTEHLSSNSEQADGDVLMENGNAEQSM # EVDPVSNDQMQVDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g89 ### # start gene g90 Scaffold_23 AUGUSTUS gene 142415 142744 0.77 + . g90 Scaffold_23 AUGUSTUS transcript 142415 142744 0.77 + . g90.t1 Scaffold_23 AUGUSTUS start_codon 142415 142417 . + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_23 AUGUSTUS CDS 142415 142744 0.77 + 0 transcript_id "g90.t1"; gene_id "g90"; Scaffold_23 AUGUSTUS stop_codon 142742 142744 . + 0 transcript_id "g90.t1"; gene_id "g90"; # protein sequence = [MENSSRSELSDNDNDNDHSDLYYLLRQTYYIEPEVPDPFLIDSHASDEEPEAHAKRKQELSVATPTQSFSQQDLIKNG # PPSPTQSEEETHQRYISLDLCCLLCFCSYQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g90 ### # start gene g91 Scaffold_23 AUGUSTUS gene 145267 146317 0.34 + . g91 Scaffold_23 AUGUSTUS transcript 145267 146317 0.34 + . g91.t1 Scaffold_23 AUGUSTUS start_codon 145267 145269 . + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_23 AUGUSTUS CDS 145267 145412 0.67 + 0 transcript_id "g91.t1"; gene_id "g91"; Scaffold_23 AUGUSTUS CDS 145495 145527 0.47 + 1 transcript_id "g91.t1"; gene_id "g91"; Scaffold_23 AUGUSTUS CDS 145645 146317 0.73 + 1 transcript_id "g91.t1"; gene_id "g91"; Scaffold_23 AUGUSTUS stop_codon 146315 146317 . + 0 transcript_id "g91.t1"; gene_id "g91"; # protein sequence = [MPSLSLSPSQGSLSSSTSGSNYAPPSPESVNCASSSKLSLDQQDEGVYRKLPGRRARKSTREFSVHSILPLLFEPSTN # PRNHLEIQELRHKSQSNGDAASTTSIIDQSLMSLDEKLESVSKGIKSINDSLDPYLQATPTIPHNGSEAEANETAAIIRKHNTLVSEWEAVQDESEVL # REELKEDKWLTVFRTVTDQADGMMSSLEKGVNRCQVRSFYDCGEDANVVADRNLYGKFTGEVLRIRWVTRRFRLHGPKRLHQHLKHSLRCWILSKQRR # SMISCHLSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g91 ### # start gene g92 Scaffold_23 AUGUSTUS gene 146495 148063 0.6 + . g92 Scaffold_23 AUGUSTUS transcript 146495 148063 0.6 + . g92.t1 Scaffold_23 AUGUSTUS start_codon 146495 146497 . + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_23 AUGUSTUS CDS 146495 148063 0.6 + 0 transcript_id "g92.t1"; gene_id "g92"; Scaffold_23 AUGUSTUS stop_codon 148061 148063 . + 0 transcript_id "g92.t1"; gene_id "g92"; # protein sequence = [MDSVRQILTHGDAGSEHGSSGTASTQNGYLATPQSGRAPSSSSTISRSISPFKKFARRLTGSARSPVSPVTPLSINKN # NGARAPSSEPVPLRRQKTSLFTSLRGPTTPITPDRPSHKYSQSLTPDSSPRNARVDSKNNGGKTLNKSPWNSSTKVEPEATIKGTPPKRAPSAAGLYS # DVSYSSSSVNFGDGTYRRSLSRVSMASSRPWSPVTSSVSTNQSSNAFYRPHPPPPPIPLSFRPPSRAQTPSRARTPGLTSTTPRPRPKTPSHIPGPSD # KLRYIAGKSDAGWDEDESVSGRAFSPTQSVTSTPGDGGAHPPRPPSRSMIPVPALHLSSPSRPGSSMSIRARSESPSFTFKAHAMRSQTPESTLKARS # QQVPVYQGTFGRSSARPSLPPSSFRDGSSSRAPSRSTSRAGASTPSGTSGLPTYEYVPGNNKDPLDVEVAFIVNSIAHGLLIERVDPPIKRVPGENEE # VKAQYAFSNALSRKVVTCKLTTLTRSGKSGTMTTKKVMCRVGGGEYSIPQYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g92 ### # start gene g93 Scaffold_23 AUGUSTUS gene 152858 154267 1 + . g93 Scaffold_23 AUGUSTUS transcript 152858 154267 1 + . g93.t1 Scaffold_23 AUGUSTUS start_codon 152858 152860 . + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_23 AUGUSTUS CDS 152858 154267 1 + 0 transcript_id "g93.t1"; gene_id "g93"; Scaffold_23 AUGUSTUS stop_codon 154265 154267 . + 0 transcript_id "g93.t1"; gene_id "g93"; # protein sequence = [MTKLIKPHPLHTPSRTNAHANESKESKEVQEPKDSKAVAFPTTSDASPFSTPSKFSKFHRSSRHSTSSTSSSDNQDDN # DGLRLRKPSLLKTVKRVSTKQLRSISSTLTNSAHRITLHGHGHGHHIDHSSESSESSQLSEPSHLTQSFDSSHLAPSPHSSQSAEHPELAEANSYSSS # KDTRRRRVSLPSFRLLRPSSYSRSRTGSNVGSVPSSTVTSLPVPPVPANLDIGAGRSHSSPSISTERNIESTVLPPVLASPSVTPTMMTATPTSPTPM # AVSVPAALSADGEGRDTKDFRATSLVTGDDSFHHADAQEARPHPPGLLVSVELVPTSPITSNEKAKAQTPSMASRGVTEDDTAASLPPLPSSSRSIVS # VSSFFSYTLPPSASPNHYSWTDDIDEKKGSEDESEDEDEDSDDDSEEHIKTEKDLNRVGSHRVSEGPFISSVFILVPVFSVRRPIGFYLTWWLGRNV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g93 ### # start gene g94 Scaffold_23 AUGUSTUS gene 155401 155679 0.56 + . g94 Scaffold_23 AUGUSTUS transcript 155401 155679 0.56 + . g94.t1 Scaffold_23 AUGUSTUS start_codon 155401 155403 . + 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_23 AUGUSTUS CDS 155401 155679 0.56 + 0 transcript_id "g94.t1"; gene_id "g94"; Scaffold_23 AUGUSTUS stop_codon 155677 155679 . + 0 transcript_id "g94.t1"; gene_id "g94"; # protein sequence = [MNRSYPNTTNGMPISTAMNQVLQVRRQDKRVELNVLLEDAMNSMTVSGSTCELTLKEVHPWDLFYTSRIFEKAIRLLK # CLAQVLLSIMKEGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g94 ### # start gene g95 Scaffold_23 AUGUSTUS gene 157870 158616 0.44 + . g95 Scaffold_23 AUGUSTUS transcript 157870 158616 0.44 + . g95.t1 Scaffold_23 AUGUSTUS start_codon 157870 157872 . + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_23 AUGUSTUS CDS 157870 158616 0.44 + 0 transcript_id "g95.t1"; gene_id "g95"; Scaffold_23 AUGUSTUS stop_codon 158614 158616 . + 0 transcript_id "g95.t1"; gene_id "g95"; # protein sequence = [MDDGHHSDDDGSISYDFLNALPSDFVPSIDDIRIANKFIDNLRDASLQSELEPLDEDIIEQLRCPLAKEVKLTNPDHR # LSVDIFLSITTAAEKTYNSIRSAILRRYPESEVLTYYKVKALVRQLSGVTPVYRDMCINSCIGFTGPFAELDICPYCGEFRYEPDEESTSSQKKAKAS # KPRKQFCTIPIGPQLQALWRSPKGARSMDYRKTCTEHILKELDENEGIKISPYEDFFDGSEYLKKVLNWQCE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g95 ### # start gene g96 Scaffold_23 AUGUSTUS gene 159110 160081 0.47 + . g96 Scaffold_23 AUGUSTUS transcript 159110 160081 0.47 + . g96.t1 Scaffold_23 AUGUSTUS start_codon 159110 159112 . + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_23 AUGUSTUS CDS 159110 160081 0.47 + 0 transcript_id "g96.t1"; gene_id "g96"; Scaffold_23 AUGUSTUS stop_codon 160079 160081 . + 0 transcript_id "g96.t1"; gene_id "g96"; # protein sequence = [MDSNEASARYLKNLLRIVQSSNQSQYEKNRLATGIVKPSIFSGLPPTHTTALPGLFAADIMHLFSLNSPDLMIPLWRG # KFDCEKTDNRASWDWAVLQGNTWKEHGKAVASCTPYMPGSFDRPPRNPAEKINSGYKAWEFLLYFYGLGPCLFFGVLPDKYWEHYCKSVRVVQLLTQN # SCNSNELNESNILFTKFSDEFESLYVQRRTDRIHFVRPSIHTPSHIPFETIHVGPGAIYSQWTMERTIGNLGEEIKQHANPYANISQRGVRRCQVNAL # VAAIPDLIPAEAPVHGSRELIMVTFFSQQQTLLQEKSRLWKRKLSDSIT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g96 ### # start gene g97 Scaffold_23 AUGUSTUS gene 160707 161902 0.41 + . g97 Scaffold_23 AUGUSTUS transcript 160707 161902 0.41 + . g97.t1 Scaffold_23 AUGUSTUS start_codon 160707 160709 . + 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_23 AUGUSTUS CDS 160707 161134 0.45 + 0 transcript_id "g97.t1"; gene_id "g97"; Scaffold_23 AUGUSTUS CDS 161191 161902 0.44 + 1 transcript_id "g97.t1"; gene_id "g97"; Scaffold_23 AUGUSTUS stop_codon 161900 161902 . + 0 transcript_id "g97.t1"; gene_id "g97"; # protein sequence = [MGIPQDVCTWCVSPNDVATEIDDQMTSPSYFSFTVLFSAMSLHSSGFEDHHDQNFFMTPSTHRTTNLSGTITSSNAFI # PTRSAFSFEDVQDNSPVDWNMPRPSPGLQNTNTLGLNQYTNQLQQKIQFLTHRNTVLTTENNFLRTINERLVNSIPASSMPQGAGVGVLPTYTEADFP # EIRYWHEVSYKQARKKKNQETIAGKVVRKRVNPEFDTSQAAEKQDDASEDDEDGENENSEDIKPVRGSARAAKGINVRMTWIERRDGTIVDGHYATAV # RKVGYALLFDFDLQGIAPTQWQHASLEVKTRWDTEMIRQFPELGYCANNWKSQAVASYIFSGWNKRHGSDSKAKKVVKVEENNIKIEKFVDTSTSLER # GQPKWIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g97 ### # start gene g98 Scaffold_23 AUGUSTUS gene 162392 162661 0.62 - . g98 Scaffold_23 AUGUSTUS transcript 162392 162661 0.62 - . g98.t1 Scaffold_23 AUGUSTUS stop_codon 162392 162394 . - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_23 AUGUSTUS CDS 162392 162661 0.62 - 0 transcript_id "g98.t1"; gene_id "g98"; Scaffold_23 AUGUSTUS start_codon 162659 162661 . - 0 transcript_id "g98.t1"; gene_id "g98"; # protein sequence = [MLELAMGSKGLMSIDGNRTVDEVRVAEVVEVAGEVPVMKGVGDTEDVDGPAKADTRASVETGVEGIVESPRVKATLSD # PKCSAPLLMSV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g98 ### # start gene g99 Scaffold_23 AUGUSTUS gene 164819 166144 1 + . g99 Scaffold_23 AUGUSTUS transcript 164819 166144 1 + . g99.t1 Scaffold_23 AUGUSTUS start_codon 164819 164821 . + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_23 AUGUSTUS CDS 164819 166144 1 + 0 transcript_id "g99.t1"; gene_id "g99"; Scaffold_23 AUGUSTUS stop_codon 166142 166144 . + 0 transcript_id "g99.t1"; gene_id "g99"; # protein sequence = [MPRSKLFQTHGQKPHDNSNKPETIEFPSGSPVSSSSTSQSSTYFPPPSTSFERKQELPTIYLDSDHDSAPAILIHGTN # SQSPVPKESSHLSLIKSIAKKASMKRLRSVSRPSTSFHHQNHHDNHNRDTSDSSLSSSTSHASTLSTSSNTSAFSKDSPPSNPPSYHRTRLLSLPSFH # RRSRTSHSTSEQTLDPGTSNFASGAYDSYDGNSVPSSQRSFEVLSRPRRAQSQNMEVIEQITLKRDPDAEIKPTTNPTHSIVCCRCGSEVHNAATVEV # SKEFLGPIDSDAKLDLATKDVQSGKPLASEDENLRDIPSSSSPSFPNLPGPLDLVQATNEDVEADGALERTAESVTDVDIPTPETQETTDKTTTEASQ # TNVTVVSPRNSKTIHPGPNSSDEVIPPPFLVGPFILDELAMPILSGTRPSRSSFVEYSGVHFGETCGMR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g99 ### # start gene g100 Scaffold_23 AUGUSTUS gene 167383 167985 0.41 - . g100 Scaffold_23 AUGUSTUS transcript 167383 167985 0.41 - . g100.t1 Scaffold_23 AUGUSTUS stop_codon 167383 167385 . - 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_23 AUGUSTUS CDS 167383 167985 0.41 - 0 transcript_id "g100.t1"; gene_id "g100"; Scaffold_23 AUGUSTUS start_codon 167983 167985 . - 0 transcript_id "g100.t1"; gene_id "g100"; # protein sequence = [MKMHSYMTVNGYLQWVSEQSQAILDQLREATNSEGGWDHAVRVAKEHRAEIRCCICYRFFAFIWDLSLGTPPIPDGVQ # ASYVDPDTAKALRKRLASMSDANGVVDADTKNVVDSLNDPNTYKKTDEHIPSATAPHPLIDHPNENISNLAKDYSELQGELVSTGPLYTVWPNNITFK # NFAVYMLIPTLVYTSLNILEPTGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g100 ### # start gene g101 Scaffold_23 AUGUSTUS gene 170396 171214 1 - . g101 Scaffold_23 AUGUSTUS transcript 170396 171214 1 - . g101.t1 Scaffold_23 AUGUSTUS stop_codon 170396 170398 . - 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_23 AUGUSTUS CDS 170396 171214 1 - 0 transcript_id "g101.t1"; gene_id "g101"; Scaffold_23 AUGUSTUS start_codon 171212 171214 . - 0 transcript_id "g101.t1"; gene_id "g101"; # protein sequence = [MNNPPLQNESEELRKFREEWRAEVRRRNGVGSVTRSESTEASDWPDTASLNVFSTSSGPASSGYATSVATVPPTPSAS # FHVSTAPPLSQVSSLAVSIYREAVIHEQRGELEEALYLYRSAFRRDANVDILFEREEMLGAIMAQQIAPVSSANAETFDSSTLTPKVILAGNGFTMDD # LSKKLENTLAMQSTKAVVSPAEHGVTASRSLNSILNNFPRDLVFEPEDEEDSVPFNLLPDEMIVYILKILDASSLERFASVNRKARVVSLDVSIWR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g101 ### # start gene g102 Scaffold_23 AUGUSTUS gene 175963 176319 0.41 + . g102 Scaffold_23 AUGUSTUS transcript 175963 176319 0.41 + . g102.t1 Scaffold_23 AUGUSTUS start_codon 175963 175965 . + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_23 AUGUSTUS CDS 175963 176319 0.41 + 0 transcript_id "g102.t1"; gene_id "g102"; Scaffold_23 AUGUSTUS stop_codon 176317 176319 . + 0 transcript_id "g102.t1"; gene_id "g102"; # protein sequence = [MQAIFTLPLYWSLMSFHYRNPLKRKTPPVDDSSAENNGATAVVLDDGDSGSADGDANERDDIRNKPRGTSSPPPFQER # PGEYETGRIDCPSCHKQVAFRDEETGEFSLKRWQQHWESW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g102 ### # start gene g103 Scaffold_23 AUGUSTUS gene 177187 177585 0.98 + . g103 Scaffold_23 AUGUSTUS transcript 177187 177585 0.98 + . g103.t1 Scaffold_23 AUGUSTUS start_codon 177187 177189 . + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_23 AUGUSTUS CDS 177187 177585 0.98 + 0 transcript_id "g103.t1"; gene_id "g103"; Scaffold_23 AUGUSTUS stop_codon 177583 177585 . + 0 transcript_id "g103.t1"; gene_id "g103"; # protein sequence = [MSGDRDVRTRNHRPDDSRVKVEFRERENQQPVNTDADADGDLDADADGDPESDLDGSNHIRVVDLSRPPPGQIHISET # HDNNEEHSTSIVLSHQAGSVAPPLDTSAPSTEGGSQSEPIMYSPAAGISPRPCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g103 ### # start gene g104 Scaffold_23 AUGUSTUS gene 178028 178648 0.47 + . g104 Scaffold_23 AUGUSTUS transcript 178028 178648 0.47 + . g104.t1 Scaffold_23 AUGUSTUS start_codon 178028 178030 . + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_23 AUGUSTUS CDS 178028 178648 0.47 + 0 transcript_id "g104.t1"; gene_id "g104"; Scaffold_23 AUGUSTUS stop_codon 178646 178648 . + 0 transcript_id "g104.t1"; gene_id "g104"; # protein sequence = [MYPQGGRLVRGPHPHNGGEEDELAYFSGSDQGRSDEDDIPFNYRGLSASASPDSEGRSVSVGSRARITKDQALSMRRR # MPIMCIQGHNCEEAENTEPDTDSNVVDSNARPNGETRAESSGDKIEKEVGAEGEMNGSGEVRIHLSAAYILLSLLISSEGKQARPIYESNSKSAFDTR # SSSLDFNETSSYRASRHVHSPYNILILVPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g104 ### # start gene g105 Scaffold_23 AUGUSTUS gene 181343 182571 0.55 + . g105 Scaffold_23 AUGUSTUS transcript 181343 182571 0.55 + . g105.t1 Scaffold_23 AUGUSTUS start_codon 181343 181345 . + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_23 AUGUSTUS CDS 181343 181396 0.55 + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_23 AUGUSTUS CDS 181963 182571 0.55 + 0 transcript_id "g105.t1"; gene_id "g105"; Scaffold_23 AUGUSTUS stop_codon 182569 182571 . + 0 transcript_id "g105.t1"; gene_id "g105"; # protein sequence = [MSLKRDCEEVEVKKAYRKEQQANQVPRSTFIQLLPLIILFGFSMLSALPNLFATPPVPDPNFSFASTSRYHLERHTPT # RDVIYHINPAEFMHHPVLGPELVRDGVDLKAEYQKVKKEKESKKKEQTEERKEKPKDDEEKEKTKVKRGPHMTKFEDGVERAYISEVWTQCRRGQDRK # ERLLDAERGIFGIGTDWDKVRKIQKEPIEACVELEWLGVGRGQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g105 ### # start gene g106 Scaffold_23 AUGUSTUS gene 186214 187523 0.87 + . g106 Scaffold_23 AUGUSTUS transcript 186214 187523 0.87 + . g106.t1 Scaffold_23 AUGUSTUS start_codon 186214 186216 . + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_23 AUGUSTUS CDS 186214 186721 0.87 + 0 transcript_id "g106.t1"; gene_id "g106"; Scaffold_23 AUGUSTUS CDS 186778 187523 1 + 2 transcript_id "g106.t1"; gene_id "g106"; Scaffold_23 AUGUSTUS stop_codon 187521 187523 . + 0 transcript_id "g106.t1"; gene_id "g106"; # protein sequence = [MLKRRFVPCVFDEVENVEDYQPGGFHPMRIGDKFDNGRYRILHKLGNGGSSTIWLARDEHSSESGVGKLVTIKALRAD # ASKINSPELVVPTLMPSSESFDFYRKVEDNFVVNGPNGTHMFIVYAFAGPSVRAISKSPENRRLRADLARKIAAQASSALQRIHHAEFIHGDFTTSNF # LFRLTDEVHKWSDDEVYFQLESPETDAVQMLNGQPIGPQVPSEVTEAIDPFIFFENDLLQESIVVVDFGQSYAASEPPKDYKPRTMINYMSPEARFEG # RVGPESDVWTLGCAIFEIRAGFPLFDPFFPSDAVILTKIVGTLGRLPDPWWNVFKNRHLFEEDGRPKTNGIAVTPSIRELLQSIGTRDEILDSDGGSM # FEQTETRIDGTEVDLLVDLLEKMLRYRPEDRIGVDEVVNHSWFKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g106 ### # start gene g107 Scaffold_23 AUGUSTUS gene 187997 189649 0.91 - . g107 Scaffold_23 AUGUSTUS transcript 187997 189649 0.91 - . g107.t1 Scaffold_23 AUGUSTUS stop_codon 187997 187999 . - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_23 AUGUSTUS CDS 187997 189649 0.91 - 0 transcript_id "g107.t1"; gene_id "g107"; Scaffold_23 AUGUSTUS start_codon 189647 189649 . - 0 transcript_id "g107.t1"; gene_id "g107"; # protein sequence = [MPIFQQDNTVGSTLELVNPLDSLPNELMAKIFGVGIELDRRNELPRALITYCSVSSRWREICQHSSELWTDVRIPLRH # TRPKGIIARTTTQLERSNPRPFNLTLTIPPIMPTVDLFDEPQDEFELIRDILSVLSPHLPRMRRLSFITELPYYAREVTFTCSRLAAFEAPQLSHIHL # QFGVLGISEFLVPMDRIIPMLFKSVPRLKHQRVYGVDIQYPLHGLTSLHLSHLLPDETNFRYLSINSPALEELCLISLYPMAHAAKPVQSKISFPALR # SLRVSFARRAFASGTCILALMSPPNLTSLEIRGFAFPDSLNSFPDSSLLTQLHTLRLEQVIFTSPNSFDVPLHDASFYLGLTAVRHLQLINTPPQSLF # PEPEAKVKPLLRARSGDFRERLDVSRRESTLHPPVLANEMDSSVLSKHKGELFQLLFSPEDTPKSKSSIVYTHWPNLTTITLDTIRAKDVLWLCELVA # VRPEVETVHLSRSAKRHLASSLTMWKGEKKDRFSSWDIDMERKNLVRRRPDVEKGDMDPVGWLEQRVKVYELESDTNGPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g107 ### # start gene g108 Scaffold_23 AUGUSTUS gene 190468 191450 0.39 + . g108 Scaffold_23 AUGUSTUS transcript 190468 191450 0.39 + . g108.t1 Scaffold_23 AUGUSTUS start_codon 190468 190470 . + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_23 AUGUSTUS CDS 190468 190711 0.4 + 0 transcript_id "g108.t1"; gene_id "g108"; Scaffold_23 AUGUSTUS CDS 190810 191450 0.98 + 2 transcript_id "g108.t1"; gene_id "g108"; Scaffold_23 AUGUSTUS stop_codon 191448 191450 . + 0 transcript_id "g108.t1"; gene_id "g108"; # protein sequence = [MALLQQNKAKAATATDEDESLEQAYTQSASEPIVSSTKKRTREEIIRELKEQRAQRGESNLVEDPTLNKNKFKPIGFK # PIGAKSMATVEPTSTTSTVPKSPRLLELEELQPPEEFDIFAGVGDYEGFNDDDDDESEGEGEEKEKTEEVISRSLRPGQWFVTDEQTEKSPGFADESP # LGPTPGPSVSHPPPIEEAQASDEEQLTRLVPLSSSAVPSIKELLAIDEAAEAADKKHKRKNKKRGGDGAGSKKLDAEAKANRDYQRSVVVPSKLEIFS # NKQYRLNRTRTSAVMNKVSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g108 ### # start gene g109 Scaffold_23 AUGUSTUS gene 191772 192485 0.51 - . g109 Scaffold_23 AUGUSTUS transcript 191772 192485 0.51 - . g109.t1 Scaffold_23 AUGUSTUS stop_codon 191772 191774 . - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_23 AUGUSTUS CDS 191772 192485 0.51 - 0 transcript_id "g109.t1"; gene_id "g109"; Scaffold_23 AUGUSTUS start_codon 192483 192485 . - 0 transcript_id "g109.t1"; gene_id "g109"; # protein sequence = [MKRSSSPSLDITYHQSTAMIKSQSIPESPHRAKKRRLLETYTSESPFLNFPHPTPSEAVAVFNILSKAHPQYASTRMI # PKLTSNSAATCGNVPNVIDSLIGTILSQNTSGKNSSRAKSSLDVAFGRNNFAAIASSPREAVVEAIRHGGLANKKAATIQNLLKSVEERHGEFSLQHL # AETGKDGKQLSDEDIMKELTCYDGVGPKTASCVLMFCLGRDSFAVDTHIFRLSKGAGLGPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g109 ### # start gene g110 Scaffold_23 AUGUSTUS gene 196049 196573 0.57 + . g110 Scaffold_23 AUGUSTUS transcript 196049 196573 0.57 + . g110.t1 Scaffold_23 AUGUSTUS start_codon 196049 196051 . + 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_23 AUGUSTUS CDS 196049 196573 0.57 + 0 transcript_id "g110.t1"; gene_id "g110"; Scaffold_23 AUGUSTUS stop_codon 196571 196573 . + 0 transcript_id "g110.t1"; gene_id "g110"; # protein sequence = [MKTFTSFDALIDSFTSSLPSFSQTYISSPDFVTVWATHLICRAATIKLHNVFTASNAFSRKKVLECAERCVMLGRGMD # LTSVEVNPIFGLLWMITGEAIINEISRLDDLNRQTMSLPNWVLEEATILGRVEMVALLEELFLTMELFGNRSGSKIIGMNSFHSPSATCSSYSLYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g110 ### # start gene g111 Scaffold_23 AUGUSTUS gene 196730 197191 0.68 - . g111 Scaffold_23 AUGUSTUS transcript 196730 197191 0.68 - . g111.t1 Scaffold_23 AUGUSTUS stop_codon 196730 196732 . - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_23 AUGUSTUS CDS 196730 197191 0.68 - 0 transcript_id "g111.t1"; gene_id "g111"; Scaffold_23 AUGUSTUS start_codon 197189 197191 . - 0 transcript_id "g111.t1"; gene_id "g111"; # protein sequence = [MKTASLMAKGARSAVVLGGCADGEVYKEVAYAYGRNIGIAFQLVDDVLDYEAAEDTLGKPGGADLQLGLATGPALYAW # EEHPEMGPLIERKFGEAGDVELARRLVRKSAGVERTRALAVGYATQAREVLQVLPESEARAALEALTERVIKRRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g111 ### # start gene g112 Scaffold_23 AUGUSTUS gene 199160 201161 0.39 - . g112 Scaffold_23 AUGUSTUS transcript 199160 201161 0.39 - . g112.t1 Scaffold_23 AUGUSTUS stop_codon 199160 199162 . - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_23 AUGUSTUS CDS 199160 199495 0.65 - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_23 AUGUSTUS CDS 199539 201161 0.49 - 0 transcript_id "g112.t1"; gene_id "g112"; Scaffold_23 AUGUSTUS start_codon 201159 201161 . - 0 transcript_id "g112.t1"; gene_id "g112"; # protein sequence = [MSVVEEGFKLSFFPSPPNDEKLESRIDNLSRTLHFLHAHLFTYLPAAKCSSFLQSLCKPVISSVLNNLLISNLPYSFN # RLPPFLELVKDAVSFEQTCIIELLGNDSADRPIKAWADGVCGHYERQRRVHILENTRAKILEPEDFSDAFHVEVEVVQAAAEPEVVPIQEEGVAEDAW # GLEEDDASASAKVDDSGWGFEDDTGSAKTGEDGWGFEDEVNTDDMDKIDDGWGFDTAEEATVPTGDESLPDIKPATNGHEPEPEAEDAWGLDDDATAD # DAPPASEDETNWDDPWGEKTSAPPSTSVESPRPPPAPSIKSPPKVATRLEKLANKGKKGLNGHSPMNSPSMAMAFSPNVSSPSFSPAIASPSFNAKVT # QSPSPSQPSLPSLPSAASKLAEKRPPDLSISAPKESYLVSTSMKDIIALVQETLREGREVGDSKSLSPAHESSSAPGSTLYQTAVSILDLYRALYPVV # FSGILQSLEGPMRFSNNTLYLSTEIDIIVKELHGSNVQTVKERFCECGRTFKLLSESWYGDAIVSFFRKRIQRQLVDKILAESTQGFTSTGDQDRYDE # CESAMNRSLQEIRRVSQKWKGLLTKSKYYTALGSVTDAALSRVVQDVLALGDIPELESHQLSELCRILLALEGLFSEDPEKVRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g112 ### # start gene g113 Scaffold_23 AUGUSTUS gene 203437 204412 0.55 + . g113 Scaffold_23 AUGUSTUS transcript 203437 204412 0.55 + . g113.t1 Scaffold_23 AUGUSTUS start_codon 203437 203439 . + 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_23 AUGUSTUS CDS 203437 203655 0.65 + 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_23 AUGUSTUS CDS 203737 203862 0.72 + 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_23 AUGUSTUS CDS 203951 204412 0.87 + 0 transcript_id "g113.t1"; gene_id "g113"; Scaffold_23 AUGUSTUS stop_codon 204410 204412 . + 0 transcript_id "g113.t1"; gene_id "g113"; # protein sequence = [MVKGAARSGAGSSSTAASSTPAAQPLPTMQTGQNVHDPLTALNSHLGFGAMAGLNPFADMGLNPNDPNMVYIRMSNMM # SNPAIMEQIIASNPQLQAMGPQVREAFQSEHFRSLLFLKPGITPNDAPYVINDARRHGRRYGGGGMGGGMFGSAPSFPAPGTPGGASATGATSGSTPV # TGTTPGSPGVGTGAANPLGMFGNPAMMQQMQQMFGGGGGGLGGGLGSFGGMGGFGAPAAPTDSRPPEERFQVQLQVDNLSLKRQTSCLIDSK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g113 ### # start gene g114 Scaffold_23 AUGUSTUS gene 218799 219662 0.85 - . g114 Scaffold_23 AUGUSTUS transcript 218799 219662 0.85 - . g114.t1 Scaffold_23 AUGUSTUS stop_codon 218799 218801 . - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_23 AUGUSTUS CDS 218799 219662 0.85 - 0 transcript_id "g114.t1"; gene_id "g114"; Scaffold_23 AUGUSTUS start_codon 219660 219662 . - 0 transcript_id "g114.t1"; gene_id "g114"; # protein sequence = [MDGFDDLLAPSRSMLEDNPFNEDSNPFGSRRSGSPDPWASPFDHSHDAWTEDHHTQQSTEVEDYEPETPVSSSNISTE # IPTEPVDSAGPGDPLDSATANVPSSDEEDNKPLGFKRARNVSLKASGFKESVDIASEDTKEEEGRKDEGSAWKEEQAQDKGKGKEIEEVLEKAESLKG # FSETATIRPSMIEEPELQRHPTPPTVTSSTSSLSGPSSPTAVWGPLSGQTSGWGEHEPYSQPEFDDGMSASAPIVSRNRDEDDSDDDKPLAQSLSMSP # VSSTKPISSTISH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g114 ### # start gene g115 Scaffold_23 AUGUSTUS gene 225884 226795 0.95 - . g115 Scaffold_23 AUGUSTUS transcript 225884 226795 0.95 - . g115.t1 Scaffold_23 AUGUSTUS stop_codon 225884 225886 . - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_23 AUGUSTUS CDS 225884 226795 0.95 - 0 transcript_id "g115.t1"; gene_id "g115"; Scaffold_23 AUGUSTUS start_codon 226793 226795 . - 0 transcript_id "g115.t1"; gene_id "g115"; # protein sequence = [MKKTRLLNEAVEARRKVQELEDEMGQLALGDTATIDKLRDDTATANRRIQELIDEKATLERESVDAVTTAGQKVRDLE # QERQRLVDGTTAAHQEIQKLVNDKATLDRELVDAAAATRRKIQDLDKEKASLVDETAAANEEIQRLVNHKATLERRLVDEAAAASRKIQDLNNEKARL # VDEGASANKRIQGLVDEKATRDQESALALAAANQKIQGLDDEKKKLVDQAAAAVQESASALAAANQKIEVLDDEKKGLLDNAAAAVQKFRDLDEERTK # LAQCFERQKLELQSFKVSVLALFLSSSKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g115 ### # start gene g116 Scaffold_23 AUGUSTUS gene 227413 228496 0.43 - . g116 Scaffold_23 AUGUSTUS transcript 227413 228496 0.43 - . g116.t1 Scaffold_23 AUGUSTUS stop_codon 227413 227415 . - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_23 AUGUSTUS CDS 227413 227748 0.89 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_23 AUGUSTUS CDS 227803 227844 0.89 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_23 AUGUSTUS CDS 228152 228178 1 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_23 AUGUSTUS CDS 228224 228496 0.83 - 0 transcript_id "g116.t1"; gene_id "g116"; Scaffold_23 AUGUSTUS start_codon 228494 228496 . - 0 transcript_id "g116.t1"; gene_id "g116"; # protein sequence = [MPNSITNYKTQAHELQNSGAWAKVEELDVTHKKVESMSRLLPAFTDVETKLLQKNIGLIERIFDQDTELHDLRTRLSA # GKAELDKMQASSQKNLHPEALETERQTLQDSLDSMNGTTEKLSKLQSDYLQLGDDLTFVTQQKTKLGDKLSRASEEIKRLEDNNSKLALEASDAQTKL # QRAETEKNSIEEDNQQISNDFDMLKEDHDALKADHDALKVNFRHCVLFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g116 ### # start gene g117 Scaffold_23 AUGUSTUS gene 233452 233658 0.85 + . g117 Scaffold_23 AUGUSTUS transcript 233452 233658 0.85 + . g117.t1 Scaffold_23 AUGUSTUS start_codon 233452 233454 . + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_23 AUGUSTUS CDS 233452 233658 0.85 + 0 transcript_id "g117.t1"; gene_id "g117"; Scaffold_23 AUGUSTUS stop_codon 233656 233658 . + 0 transcript_id "g117.t1"; gene_id "g117"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g117 ### # start gene g118 Scaffold_23 AUGUSTUS gene 233758 234615 1 + . g118 Scaffold_23 AUGUSTUS transcript 233758 234615 1 + . g118.t1 Scaffold_23 AUGUSTUS start_codon 233758 233760 . + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_23 AUGUSTUS CDS 233758 234615 1 + 0 transcript_id "g118.t1"; gene_id "g118"; Scaffold_23 AUGUSTUS stop_codon 234613 234615 . + 0 transcript_id "g118.t1"; gene_id "g118"; # protein sequence = [MFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLE # TVVKDVSVTSMSDRRKEDPFKIDEEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLG # IKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRMELSG # HVSCASRQIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g118 ### # start gene g119 Scaffold_23 AUGUSTUS gene 234710 237053 0.61 + . g119 Scaffold_23 AUGUSTUS transcript 234710 237053 0.61 + . g119.t1 Scaffold_23 AUGUSTUS start_codon 234710 234712 . + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_23 AUGUSTUS CDS 234710 234945 0.73 + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_23 AUGUSTUS CDS 235092 235356 0.62 + 1 transcript_id "g119.t1"; gene_id "g119"; Scaffold_23 AUGUSTUS CDS 235401 237053 0.9 + 0 transcript_id "g119.t1"; gene_id "g119"; Scaffold_23 AUGUSTUS stop_codon 237051 237053 . + 0 transcript_id "g119.t1"; gene_id "g119"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPMIMFNLGRITNQIDSHGY # TPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQD # QTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDR # LIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTY # PRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDFKGKFSFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKS # QDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILKILVWGRIAINLNPQKPHRI # NVITKIPLKRSEMIIGINLKTLKELGREWFDMKYSKEELNHSKDLNRVLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g119 ### # start gene g120 Scaffold_23 AUGUSTUS gene 237946 239376 0.56 + . g120 Scaffold_23 AUGUSTUS transcript 237946 239376 0.56 + . g120.t1 Scaffold_23 AUGUSTUS start_codon 237946 237948 . + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_23 AUGUSTUS CDS 237946 239376 0.56 + 0 transcript_id "g120.t1"; gene_id "g120"; Scaffold_23 AUGUSTUS stop_codon 239374 239376 . + 0 transcript_id "g120.t1"; gene_id "g120"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNV # PFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVY # GCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPY # QFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGRV # LVEPIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g120 ### # start gene g121 Scaffold_23 AUGUSTUS gene 239749 240783 0.3 + . g121 Scaffold_23 AUGUSTUS transcript 239749 240783 0.3 + . g121.t1 Scaffold_23 AUGUSTUS start_codon 239749 239751 . + 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_23 AUGUSTUS CDS 239749 239812 0.67 + 0 transcript_id "g121.t1"; gene_id "g121"; Scaffold_23 AUGUSTUS CDS 239947 240267 0.42 + 2 transcript_id "g121.t1"; gene_id "g121"; Scaffold_23 AUGUSTUS CDS 240341 240783 0.57 + 2 transcript_id "g121.t1"; gene_id "g121"; Scaffold_23 AUGUSTUS stop_codon 240781 240783 . + 0 transcript_id "g121.t1"; gene_id "g121"; # protein sequence = [MSISSNGCKYIIHGRDSLCLRAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWA # DRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYQLRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMV # VIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEGED # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g121 ### # start gene g122 Scaffold_23 AUGUSTUS gene 241043 242496 0.2 - . g122 Scaffold_23 AUGUSTUS transcript 241043 242496 0.2 - . g122.t1 Scaffold_23 AUGUSTUS stop_codon 241043 241045 . - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_23 AUGUSTUS CDS 241043 241259 0.79 - 1 transcript_id "g122.t1"; gene_id "g122"; Scaffold_23 AUGUSTUS CDS 241319 241469 1 - 2 transcript_id "g122.t1"; gene_id "g122"; Scaffold_23 AUGUSTUS CDS 241551 241686 0.86 - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_23 AUGUSTUS CDS 242329 242496 0.35 - 0 transcript_id "g122.t1"; gene_id "g122"; Scaffold_23 AUGUSTUS start_codon 242494 242496 . - 0 transcript_id "g122.t1"; gene_id "g122"; # protein sequence = [MPIHHKKDLDIARVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLNRRSTPYPTTGSNKGSNKEEKS # AVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANCILKSRQDSGSDSSASDASFATAQS # IPTTGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g122 ### # start gene g123 Scaffold_23 AUGUSTUS gene 243558 243902 0.86 - . g123 Scaffold_23 AUGUSTUS transcript 243558 243902 0.86 - . g123.t1 Scaffold_23 AUGUSTUS stop_codon 243558 243560 . - 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_23 AUGUSTUS CDS 243558 243902 0.86 - 0 transcript_id "g123.t1"; gene_id "g123"; Scaffold_23 AUGUSTUS start_codon 243900 243902 . - 0 transcript_id "g123.t1"; gene_id "g123"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g123 ### # start gene g124 Scaffold_23 AUGUSTUS gene 248379 250908 0.32 - . g124 Scaffold_23 AUGUSTUS transcript 248379 250908 0.32 - . g124.t1 Scaffold_23 AUGUSTUS stop_codon 248379 248381 . - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_23 AUGUSTUS CDS 248379 249889 0.72 - 2 transcript_id "g124.t1"; gene_id "g124"; Scaffold_23 AUGUSTUS CDS 250893 250908 0.35 - 0 transcript_id "g124.t1"; gene_id "g124"; Scaffold_23 AUGUSTUS start_codon 250906 250908 . - 0 transcript_id "g124.t1"; gene_id "g124"; # protein sequence = [MTNDRRKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSI # SRGRFTSLPRNLKKSNLDPKRKRKEINPIDFEEDRIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKAS # AKLPRKYKTASVFDITDPSQMISWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDELKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIQLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g124 ### # start gene g125 Scaffold_23 AUGUSTUS gene 251845 252525 1 + . g125 Scaffold_23 AUGUSTUS transcript 251845 252525 1 + . g125.t1 Scaffold_23 AUGUSTUS start_codon 251845 251847 . + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_23 AUGUSTUS CDS 251845 252525 1 + 0 transcript_id "g125.t1"; gene_id "g125"; Scaffold_23 AUGUSTUS stop_codon 252523 252525 . + 0 transcript_id "g125.t1"; gene_id "g125"; # protein sequence = [MSDPSQPAQPAQSAPTPPTANNLMTQLIKQVANLATAMEECSSARSSMNKPKVFKGKDSAEARRFMAQFQNWASEQPD # LTKSQAKLIKSTLRFFTESAGDWATPHLLHFNAENPPFGGIWEEFLKEFVQHFESVDPGMEAHSEIKNLKQGKGQTVVEFTQKFKDIGDQTGMSDIDL # REHFFTALLLEIQQNLIIVNIAQGLAPTLKEAIKQAISVDVYMHNPTMTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g125 ### # start gene g126 Scaffold_23 AUGUSTUS gene 260163 260541 0.41 + . g126 Scaffold_23 AUGUSTUS transcript 260163 260541 0.41 + . g126.t1 Scaffold_23 AUGUSTUS start_codon 260163 260165 . + 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_23 AUGUSTUS CDS 260163 260176 0.41 + 0 transcript_id "g126.t1"; gene_id "g126"; Scaffold_23 AUGUSTUS CDS 260283 260541 0.85 + 1 transcript_id "g126.t1"; gene_id "g126"; Scaffold_23 AUGUSTUS stop_codon 260539 260541 . + 0 transcript_id "g126.t1"; gene_id "g126"; # protein sequence = [MLEKGIHSGASSATITSDGHLVDIFQSPDPAVKDSEDLDTQDSPPITVVEKDSGVEDIASLPEGSPIQTELDLPQIES # LTELTPSPEKGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g126 ### # start gene g127 Scaffold_23 AUGUSTUS gene 262256 263003 0.28 + . g127 Scaffold_23 AUGUSTUS transcript 262256 263003 0.28 + . g127.t1 Scaffold_23 AUGUSTUS start_codon 262256 262258 . + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_23 AUGUSTUS CDS 262256 262282 0.29 + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_23 AUGUSTUS CDS 262389 262524 0.43 + 0 transcript_id "g127.t1"; gene_id "g127"; Scaffold_23 AUGUSTUS CDS 262606 263003 1 + 2 transcript_id "g127.t1"; gene_id "g127"; Scaffold_23 AUGUSTUS stop_codon 263001 263003 . + 0 transcript_id "g127.t1"; gene_id "g127"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSNEP # LLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g127 ### # start gene g128 Scaffold_23 AUGUSTUS gene 263293 266143 0.25 - . g128 Scaffold_23 AUGUSTUS transcript 263293 266143 0.25 - . g128.t1 Scaffold_23 AUGUSTUS stop_codon 263293 263295 . - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_23 AUGUSTUS CDS 263293 263876 0.33 - 2 transcript_id "g128.t1"; gene_id "g128"; Scaffold_23 AUGUSTUS CDS 264538 264848 0.45 - 1 transcript_id "g128.t1"; gene_id "g128"; Scaffold_23 AUGUSTUS CDS 265029 266143 0.82 - 0 transcript_id "g128.t1"; gene_id "g128"; Scaffold_23 AUGUSTUS start_codon 266141 266143 . - 0 transcript_id "g128.t1"; gene_id "g128"; # protein sequence = [MTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRF # VWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSN # VPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHV # YGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEP # RNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHML # NSAHDLESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGP # MVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPHLRLSDTDSDEELSEG # EDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g128 ### # start gene g129 Scaffold_23 AUGUSTUS gene 266917 269083 0.47 - . g129 Scaffold_23 AUGUSTUS transcript 266917 269083 0.47 - . g129.t1 Scaffold_23 AUGUSTUS stop_codon 266917 266919 . - 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_23 AUGUSTUS CDS 266917 267244 0.99 - 1 transcript_id "g129.t1"; gene_id "g129"; Scaffold_23 AUGUSTUS CDS 267301 267577 0.47 - 2 transcript_id "g129.t1"; gene_id "g129"; Scaffold_23 AUGUSTUS CDS 267652 269083 0.98 - 0 transcript_id "g129.t1"; gene_id "g129"; Scaffold_23 AUGUSTUS start_codon 269081 269083 . - 0 transcript_id "g129.t1"; gene_id "g129"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIP # FKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLK # GNFHSSMNGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLKMEGSSL # NPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVT # EPPTKNLKNVLN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g129 ### # start gene g130 Scaffold_23 AUGUSTUS gene 269113 269733 0.55 - . g130 Scaffold_23 AUGUSTUS transcript 269113 269733 0.55 - . g130.t1 Scaffold_23 AUGUSTUS stop_codon 269113 269115 . - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_23 AUGUSTUS CDS 269113 269733 0.55 - 0 transcript_id "g130.t1"; gene_id "g130"; Scaffold_23 AUGUSTUS start_codon 269731 269733 . - 0 transcript_id "g130.t1"; gene_id "g130"; # protein sequence = [MEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPRSSNGTQWACFLC # KSTDHFMNECPHLLEFTKRGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRI # EELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g130 ### # start gene g131 Scaffold_23 AUGUSTUS gene 269774 270637 0.78 - . g131 Scaffold_23 AUGUSTUS transcript 269774 270637 0.78 - . g131.t1 Scaffold_23 AUGUSTUS stop_codon 269774 269776 . - 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_23 AUGUSTUS CDS 269774 270637 0.78 - 0 transcript_id "g131.t1"; gene_id "g131"; Scaffold_23 AUGUSTUS start_codon 270635 270637 . - 0 transcript_id "g131.t1"; gene_id "g131"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g131 ### # # ----- prediction on sequence number 7 (length = 236933, name = Scaffold_24) ----- # # Predicted genes for sequence number 7 on both strands # start gene g132 Scaffold_24 AUGUSTUS gene 13693 14046 0.56 + . g132 Scaffold_24 AUGUSTUS transcript 13693 14046 0.56 + . g132.t1 Scaffold_24 AUGUSTUS start_codon 13693 13695 . + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_24 AUGUSTUS CDS 13693 14046 0.56 + 0 transcript_id "g132.t1"; gene_id "g132"; Scaffold_24 AUGUSTUS stop_codon 14044 14046 . + 0 transcript_id "g132.t1"; gene_id "g132"; # protein sequence = [MALDIVKLYISFLSQFFNLSDMAVTSSPGIPSSNDVTSTLLPSNSNSLSTAHYLLKIFGEIQDCVNELNAMEISGDVS # ASLKGLLDSTKWRFEDVLIAAWLRGNSFSPGTIALAYCQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g132 ### # start gene g133 Scaffold_24 AUGUSTUS gene 14159 14596 0.29 - . g133 Scaffold_24 AUGUSTUS transcript 14159 14596 0.29 - . g133.t1 Scaffold_24 AUGUSTUS stop_codon 14159 14161 . - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_24 AUGUSTUS CDS 14159 14596 0.29 - 0 transcript_id "g133.t1"; gene_id "g133"; Scaffold_24 AUGUSTUS start_codon 14594 14596 . - 0 transcript_id "g133.t1"; gene_id "g133"; # protein sequence = [MGTCLSSVIVTPNAFSNCVIILGKIDLDIWLRFESTSNKRLSYDMQHSENMNNRVLLEEPTLLLRSRSSNAFVAFDVD # AIATGSTPLTFAPPSLSSSTSFTRPSKKVYSTSMNALIIFDTNAAGIGFCLFPLLIRDEESTPPAIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g133 ### # start gene g134 Scaffold_24 AUGUSTUS gene 15607 15999 0.41 - . g134 Scaffold_24 AUGUSTUS transcript 15607 15999 0.41 - . g134.t1 Scaffold_24 AUGUSTUS stop_codon 15607 15609 . - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_24 AUGUSTUS CDS 15607 15999 0.41 - 0 transcript_id "g134.t1"; gene_id "g134"; Scaffold_24 AUGUSTUS start_codon 15997 15999 . - 0 transcript_id "g134.t1"; gene_id "g134"; # protein sequence = [MPSIEVGTVGGGTVLAPQQAILEMLGFKGAHPTHPGQNAQALARLIAAAVMAGELSLMSALAAGHLVRAHLVHNRSQL # NTPAASTPVTPGGPLGTETGGVLGIKARELGMSALTPSASTGSLPPYSLEKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g134 ### # start gene g135 Scaffold_24 AUGUSTUS gene 16082 16894 0.57 - . g135 Scaffold_24 AUGUSTUS transcript 16082 16894 0.57 - . g135.t1 Scaffold_24 AUGUSTUS stop_codon 16082 16084 . - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_24 AUGUSTUS CDS 16082 16894 0.57 - 0 transcript_id "g135.t1"; gene_id "g135"; Scaffold_24 AUGUSTUS start_codon 16892 16894 . - 0 transcript_id "g135.t1"; gene_id "g135"; # protein sequence = [MRHYDYSRVMGACCENVVGFIPLPLGIAGPLKIDGHLFPIPMATAEGTLVASTSRGCKALNAGGGVTTVLTQDAMTRG # PAIDFPSIVQAAKCRAWIDSEEGYSIVKEAFESTSRFAKLRSLKCAMAGRTLFVRFATATGDAMGMNMISKGTEKALEVMQQHFPDMITLALSGNYCT # DKKPAAINWIEGRGKSVVAEAVIPGKVVKSVLKTTVEALCNLNTKKNLIGSAMAGSIGGFNAHAANILTAIFLATGQDPAQNVESSNCMTLMEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g135 ### # start gene g136 Scaffold_24 AUGUSTUS gene 16969 19441 0.27 - . g136 Scaffold_24 AUGUSTUS transcript 16969 19441 0.27 - . g136.t1 Scaffold_24 AUGUSTUS stop_codon 16969 16971 . - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_24 AUGUSTUS CDS 16969 17799 0.98 - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_24 AUGUSTUS CDS 18875 19227 0.91 - 2 transcript_id "g136.t1"; gene_id "g136"; Scaffold_24 AUGUSTUS CDS 19316 19338 0.43 - 1 transcript_id "g136.t1"; gene_id "g136"; Scaffold_24 AUGUSTUS CDS 19434 19441 0.44 - 0 transcript_id "g136.t1"; gene_id "g136"; Scaffold_24 AUGUSTUS start_codon 19439 19441 . - 0 transcript_id "g136.t1"; gene_id "g136"; # protein sequence = [MGQFRSSVNGDLTESVLNFTKEIPTSISGFAYDKACFRPVSSEALELEAPCFTNELVKSRSIHQTLAFTPGEDFTVAF # DRLIKSSPFHGGVEFEVEAKQAEAIGDMKSSKWVAYAATALVVRFWDLAKHVLNSLAATEHIEAEVNEGTETNNHGLLVKVNPSIHVRVIPLDSAIHD # SASSSSDSGTSRSTSEIVENFMSSWSRLVGDPVLSKWIVMVLAVSISLNGYLLKGIAAGLGGKGSVAKLGGVRFGGDATAEPSSSYAHSEPVVVQQPV # SPIALMPPPIIAPAPAPRRPATFTLDEVDRRLQARRLTQSSSSQDASSSSSDNEENDVIVRSLEECIEIFEKGPRPVSVALSLLNDEEVILLAQNGKV # AAYALEKVLGNTEYERAVRIRRALICKSIYSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g136 ### # start gene g137 Scaffold_24 AUGUSTUS gene 26744 27370 0.97 - . g137 Scaffold_24 AUGUSTUS transcript 26744 27370 0.97 - . g137.t1 Scaffold_24 AUGUSTUS stop_codon 26744 26746 . - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_24 AUGUSTUS CDS 26744 27370 0.97 - 0 transcript_id "g137.t1"; gene_id "g137"; Scaffold_24 AUGUSTUS start_codon 27368 27370 . - 0 transcript_id "g137.t1"; gene_id "g137"; # protein sequence = [MVVLPTTSYSKRFTRYTQNWNKVSFVISCSQQKKLYKIKNLSDEEATLLEPAACAIHGLDKLNPQVGIEVLLLGAGPT # GLILAQLLKLNGASRVVIAANKGIKMDIAKDLEAGDEYIELDRQQPEAQWKKLKEDNPYGFDVVVEATGVEKLANESINYVRRGGTLMIYGVYENKAL # VHWPPSKIFGDEIKVHGSLRFHTDASLTKFLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g137 ### # start gene g138 Scaffold_24 AUGUSTUS gene 30871 31278 0.64 - . g138 Scaffold_24 AUGUSTUS transcript 30871 31278 0.64 - . g138.t1 Scaffold_24 AUGUSTUS stop_codon 30871 30873 . - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_24 AUGUSTUS CDS 30871 31278 0.64 - 0 transcript_id "g138.t1"; gene_id "g138"; Scaffold_24 AUGUSTUS start_codon 31276 31278 . - 0 transcript_id "g138.t1"; gene_id "g138"; # protein sequence = [MRILGSSHVTSESGTGLVHCAPAHGEEDYKLFRSYDLISSGTQSPSTAMSNTLICHVHDGLFSEKVVDVVGPAAHMLV # GKPVLEEGSRGVVELLKQAGRLLAVKRYTHKYPYDWKTDKPIIVTCVVLPLTFGLVD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g138 ### # start gene g139 Scaffold_24 AUGUSTUS gene 37939 38916 0.87 - . g139 Scaffold_24 AUGUSTUS transcript 37939 38916 0.87 - . g139.t1 Scaffold_24 AUGUSTUS stop_codon 37939 37941 . - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_24 AUGUSTUS CDS 37939 38916 0.87 - 0 transcript_id "g139.t1"; gene_id "g139"; Scaffold_24 AUGUSTUS start_codon 38914 38916 . - 0 transcript_id "g139.t1"; gene_id "g139"; # protein sequence = [MQRKDIPPLTIASRGQQFSLFGGFASQSREIVLISDTQDITQGMESSSSVTPSDSSTPDLSLNFRPHSTDSVLSLPPS # PRSENAFRPTFTSHKTSPPGYLTITNTPLSPVTPSSPSFSMPMTPPPSPLKSSSRPSSRESTKSLPVPTHTVTPPNFPRVLHRNSSPTVHTAVWPTTS # TFEEAPQFSRHNLGSDVVMPISAKGRQGKSIFSAKPTPVVHRPAIPTSSSSTNLLAPPPFRRHVHSRRRSNSTSAALDQKAQVDEPAIHSASQLTQQS # GSIPSNTPHASLGSLRAHTKSVLSKSKRFVHSRAQAISHVDSILGSTAPRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g139 ### # start gene g140 Scaffold_24 AUGUSTUS gene 53134 54539 0.06 - . g140 Scaffold_24 AUGUSTUS transcript 53134 54539 0.06 - . g140.t1 Scaffold_24 AUGUSTUS stop_codon 53134 53136 . - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_24 AUGUSTUS CDS 53134 53426 0.63 - 2 transcript_id "g140.t1"; gene_id "g140"; Scaffold_24 AUGUSTUS CDS 53539 53900 0.23 - 1 transcript_id "g140.t1"; gene_id "g140"; Scaffold_24 AUGUSTUS CDS 54037 54539 0.22 - 0 transcript_id "g140.t1"; gene_id "g140"; Scaffold_24 AUGUSTUS start_codon 54537 54539 . - 0 transcript_id "g140.t1"; gene_id "g140"; # protein sequence = [MIRQKMDKLAETRIRSSTKQVPGVKVNKMLAEKIQRDEERERKREERKKRKVQKNIAEAGEEDAMNVDEEEEEDVISG # RKDAPTSVLTDPRFAKVFEDPEFEVDVSSREYALLNPSSVVQRKGFGERGKTAVEEEEEESDKMSSDGLGKSDSEDDSGNSSDSSDAGGSTSNVKLVP # MRPQSGANGTQLATGKEATFGQRRSHSSYPGGGKSASRANKVNIAEDGGMEMSWVPSANSQDARELSGQGKAGKQQDRRKGVEKFGAGLEKGGEDPLE # LSESDRKGRVHRRQGTLSYHQPKHSTSESLAENDTFRFDMIQEEKKKGDQRSLDVIFIGSKTHPPPGAGENQSGRDDGDNGRTSERRYEVGSRARSEL # GGYGSAARDSDQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g140 ### # start gene g141 Scaffold_24 AUGUSTUS gene 58131 58987 0.53 - . g141 Scaffold_24 AUGUSTUS transcript 58131 58987 0.53 - . g141.t1 Scaffold_24 AUGUSTUS stop_codon 58131 58133 . - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_24 AUGUSTUS CDS 58131 58726 1 - 2 transcript_id "g141.t1"; gene_id "g141"; Scaffold_24 AUGUSTUS CDS 58828 58987 0.53 - 0 transcript_id "g141.t1"; gene_id "g141"; Scaffold_24 AUGUSTUS start_codon 58985 58987 . - 0 transcript_id "g141.t1"; gene_id "g141"; # protein sequence = [MFQPHLDNGSIERWEDEEYGRVFRKIWEGKWEEYDAWDMDHRADAVMDLYGGPGLLSIDDNGPRRGTIQFLPDIKLST # AYILLRPYFNDQNKLDMNSTYFYGADPGQGQVVKDIWHPHLQLNKTIISCPKAEPGDYVFWHCDLVHKVEEEHNGTNDSSVVYIPVVPLCTYNIGNLI # DQRKAFLEGVPPPDMPPESESEGLEKEHEDRGTPDDVLTVEGRRLMGLEPFVENEPGITSGQKTIREAANEALGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g141 ### # start gene g142 Scaffold_24 AUGUSTUS gene 60415 60984 0.8 - . g142 Scaffold_24 AUGUSTUS transcript 60415 60984 0.8 - . g142.t1 Scaffold_24 AUGUSTUS stop_codon 60415 60417 . - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_24 AUGUSTUS CDS 60415 60984 0.8 - 0 transcript_id "g142.t1"; gene_id "g142"; Scaffold_24 AUGUSTUS start_codon 60982 60984 . - 0 transcript_id "g142.t1"; gene_id "g142"; # protein sequence = [METIRVTDYSSDTDDTGESAVSDTESSFAEHHRLPNGLKSQSIIKGKGKGKRSMNSANTRSLFNPFVSDTSQSESDEY # PPSKNPRLHVSIPKADSAYDGPFFASSSSSPSPPPPIASPSPSFLSVDTAERYSTSFFDWEDRSVGGDELDGYASSAHSSQWDLLDPPVLVSPTYSFA # EIPDSTSETSETN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g142 ### # start gene g143 Scaffold_24 AUGUSTUS gene 62401 63234 0.8 + . g143 Scaffold_24 AUGUSTUS transcript 62401 63234 0.8 + . g143.t1 Scaffold_24 AUGUSTUS start_codon 62401 62403 . + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_24 AUGUSTUS CDS 62401 63234 0.8 + 0 transcript_id "g143.t1"; gene_id "g143"; Scaffold_24 AUGUSTUS stop_codon 63232 63234 . + 0 transcript_id "g143.t1"; gene_id "g143"; # protein sequence = [MSFSAPSPPVSTSSGFSSKGSPQPDLELDPSDPLNLLLRNSQSTDSSMDDPSAGASPPDWSQLSELWSSSLDAGNLAG # EYIAKAFPDVMDYTIPLSSELDFTSQMAIDPHALHFDTQKLGLDSFPLLNDLTPSQNYPFTFQSETSTSPQGRRLSVISSSSSSGASLSPVIEPSPAP # SHLNAPQELSSSSLDAAAEELAQRVRQAAGILLAVPMNAHSQQNNRKQLYLPQINRAHSTNHRNRSRLFYVYWSAGNAEQWLHPATCFTPISEIVRLV # YFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g143 ### # start gene g144 Scaffold_24 AUGUSTUS gene 66006 67183 0.39 + . g144 Scaffold_24 AUGUSTUS transcript 66006 67183 0.39 + . g144.t1 Scaffold_24 AUGUSTUS start_codon 66006 66008 . + 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_24 AUGUSTUS CDS 66006 66637 0.62 + 0 transcript_id "g144.t1"; gene_id "g144"; Scaffold_24 AUGUSTUS CDS 66733 67183 0.52 + 1 transcript_id "g144.t1"; gene_id "g144"; Scaffold_24 AUGUSTUS stop_codon 67181 67183 . + 0 transcript_id "g144.t1"; gene_id "g144"; # protein sequence = [MYPIFSAFLLSLSSLSGTLAYQWPKSFLSSINPLIGSAGPEPNLSGGMIPSVAPPFGSTRWVAQNQESYVSATPFNYT # ESYMNNGTIHGFMGTRQPAIWMGESAWAAVVPGISSGSDGDILTGFEERAMPKIAGTEKFGVGLYSVELVIPESGGSTVEVLMSASSRVGHLQFTFKQ # GSESQFQPYIFLPTTRPSTIFHNPTPLRPLTQMAPHFTGWYCATFDTSFNDTGYGITVGSGDSTMRTERAESGSGEELGAYARFQFPSSNGTENKSMT # VNVRIATSLISVDQAKYNLNADSENEIGSFNIQDTQSVTENAWAEKVGRFQVETDGSSDSEEKLAVFMTGVFHAMQVSIIRTNLLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g144 ### # start gene g145 Scaffold_24 AUGUSTUS gene 67655 68405 0.22 + . g145 Scaffold_24 AUGUSTUS transcript 67655 68405 0.22 + . g145.t1 Scaffold_24 AUGUSTUS start_codon 67655 67657 . + 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_24 AUGUSTUS CDS 67655 67849 0.35 + 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_24 AUGUSTUS CDS 67921 68041 0.59 + 0 transcript_id "g145.t1"; gene_id "g145"; Scaffold_24 AUGUSTUS CDS 68104 68405 0.75 + 2 transcript_id "g145.t1"; gene_id "g145"; Scaffold_24 AUGUSTUS stop_codon 68403 68405 . + 0 transcript_id "g145.t1"; gene_id "g145"; # protein sequence = [MVGTHADSLLAEAVLKGFGAGSAEENGIQTTFTTDELTTMWKAAWKDASVPPVGDSNVVYSDREEDVDYEVRAGLSTF # FEQYSAGHGWVANDIHSESVSRTLDYAFALLSTLIPREIVQGNTPNLDEIAAGFYNSSSANTNYNVTSLLNDRSLANPWTVWNDTASAPALVTGGEDV # KGFVQARQQNGDWAGINQISPYHFEQLVY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g145 ### # start gene g146 Scaffold_24 AUGUSTUS gene 68900 69440 0.51 + . g146 Scaffold_24 AUGUSTUS transcript 68900 69440 0.51 + . g146.t1 Scaffold_24 AUGUSTUS start_codon 68900 68902 . + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_24 AUGUSTUS CDS 68900 68910 0.91 + 0 transcript_id "g146.t1"; gene_id "g146"; Scaffold_24 AUGUSTUS CDS 69050 69440 0.51 + 1 transcript_id "g146.t1"; gene_id "g146"; Scaffold_24 AUGUSTUS stop_codon 69438 69440 . + 0 transcript_id "g146.t1"; gene_id "g146"; # protein sequence = [MSACPFFSSLNVSMPVPPFIPPSHPSITSNSFYNSTTNSYDLRILAPGAESKPYVKSLKVNGRVIGDKEEPLISHEEI # RFGGLIEFEMSDKAERWGGGRGAWAEITSDARRSSGVVFNDQSRSSIVSVEHVEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g146 ### # start gene g147 Scaffold_24 AUGUSTUS gene 69550 70230 0.37 + . g147 Scaffold_24 AUGUSTUS transcript 69550 70230 0.37 + . g147.t1 Scaffold_24 AUGUSTUS start_codon 69550 69552 . + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_24 AUGUSTUS CDS 69550 70230 0.37 + 0 transcript_id "g147.t1"; gene_id "g147"; Scaffold_24 AUGUSTUS stop_codon 70228 70230 . + 0 transcript_id "g147.t1"; gene_id "g147"; # protein sequence = [MNKTSEFDPYADHSELRKVRSRLNAAQSAESITPISTRSRDVDTLKINATMSTNAGTSKLARPTPFTPKRPVGAGTSM # ERLTRATVTPAPHLLASTHKKYKAPISSDVRSRTHLRTNSSKPTTLAPVPGSRPSSPTKSDSGRPRTPGTPRRGTTPDPSMARTSEMDVTNVDPEEVL # VDYQNVEPADVSLGEMDEAWLKTMQADHGKEDKVMVLSGLYFDVSLYFNN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g147 ### # start gene g148 Scaffold_24 AUGUSTUS gene 71447 72928 0.53 + . g148 Scaffold_24 AUGUSTUS transcript 71447 72928 0.53 + . g148.t1 Scaffold_24 AUGUSTUS start_codon 71447 71449 . + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_24 AUGUSTUS CDS 71447 72928 0.53 + 0 transcript_id "g148.t1"; gene_id "g148"; Scaffold_24 AUGUSTUS stop_codon 72926 72928 . + 0 transcript_id "g148.t1"; gene_id "g148"; # protein sequence = [MLRRRKLSTPMLSSRGIGRRIDDLKRRLEEKENMLDDGKEEEKEKVTMKRRRMSAQEKADESQAMQDLQSRIQQLTKL # ILTSQTVTDEAAGGPPGESRPVSPIKVDFDMSPYQVCSNFLYIQIQRSLTKPFSQLQQELLTARLQLSSQETQILSLEAALEAARAVESSVPSDAGDK # DKTIQDQAKTIEEQAKKIRELENARFTPEPSPSRVDLDREQKDWSSRLDEEKKKREEKERWAEELVRQLEKEKWIRTKLEDERRALAAFVSKFDSLGM # GSTFPPSNASTPISSPVGRRRSSFAAGSVIGLGGIGAGRRRSSAFGFGGSSSLRQPLFPSSSESSGLSSLSSSTSTSTFVSSSSRSSLTSATSATSLS # SVAASAPKPGLPIEEEGDISIQITGVGSFGDPNLSSSALSPLRLPEGHIYAGVPSLLEQMPEEAWVLGDVSFDDESISMAGTEEKVPSVAGGMKSHVK # GSGTVRFSTSVDIMGGKENVGPF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g148 ### # start gene g149 Scaffold_24 AUGUSTUS gene 75061 75881 0.66 - . g149 Scaffold_24 AUGUSTUS transcript 75061 75881 0.66 - . g149.t1 Scaffold_24 AUGUSTUS stop_codon 75061 75063 . - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_24 AUGUSTUS CDS 75061 75549 0.99 - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_24 AUGUSTUS CDS 75615 75881 0.67 - 0 transcript_id "g149.t1"; gene_id "g149"; Scaffold_24 AUGUSTUS start_codon 75879 75881 . - 0 transcript_id "g149.t1"; gene_id "g149"; # protein sequence = [MVRLSSYAALLSGFASSMAAGIPTRRAMAVHDERELPVHFANAGTPSPDTLMNLKLALTASDMAGLEQTFWDVSTPGN # ALYGQHLSFEETKVFAAPTTDTVTAVTAWLNENGINNITTTGAFDDWLAFTVPISTANSLFEADFQNFTEIGGPTQLIRTLSYSLPVDLQQHINLLHP # STDFVRNIKGPIFRASVLGSSLNNTARALTAPSSCNSVVTPTCLQDLYGIPTTPATQASSKLAVSGFIDQWPQVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g149 ### # start gene g150 Scaffold_24 AUGUSTUS gene 76974 77675 0.42 - . g150 Scaffold_24 AUGUSTUS transcript 76974 77675 0.42 - . g150.t1 Scaffold_24 AUGUSTUS stop_codon 76974 76976 . - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_24 AUGUSTUS CDS 76974 77675 0.42 - 0 transcript_id "g150.t1"; gene_id "g150"; Scaffold_24 AUGUSTUS start_codon 77673 77675 . - 0 transcript_id "g150.t1"; gene_id "g150"; # protein sequence = [MPPIGFENASNLPSSAFISPTSSLHQVFEQTLESSMQSTLIDYPSGFFFSLGIGPEDDTMFMHDPFKFDYAQDKIPLG # QDNLQMVNEDSAISTNSTTVHNSTAPDDSASLSLNRATSANFNIHNSTAPDDSASFSLPSERGMSRAIRIQSSLDILRTGRISPVEFLTELLDVTNPR # SAQFRGKLYSKTNKRVDDLLDKIVEDPMGEALIEDWFRRYGLRKVSLSRSYVLRGLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g150 ### # start gene g151 Scaffold_24 AUGUSTUS gene 78629 80892 0.3 + . g151 Scaffold_24 AUGUSTUS transcript 78629 80892 0.3 + . g151.t1 Scaffold_24 AUGUSTUS start_codon 78629 78631 . + 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_24 AUGUSTUS CDS 78629 79525 0.76 + 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_24 AUGUSTUS CDS 79639 80892 0.3 + 0 transcript_id "g151.t1"; gene_id "g151"; Scaffold_24 AUGUSTUS stop_codon 80890 80892 . + 0 transcript_id "g151.t1"; gene_id "g151"; # protein sequence = [MAEVIEQLRAVLPPEMFEVITPIFTGLAHRLTESENRVAELQQGHISMEQLSASFREALSHNPSPPVQPVPPPQVHPA # TAQAPLRTELPIFRGRPEDNARAFTSIAKDLLQATHISLDDWGIIISGCFRDAALTWYLVKKQENGDKPLTWDKLEKDLLAQFDNPSRTDDIRTKLVK # CNYKNNISDFITQFQKLEMQLPPTEMTFGDRKFNFFRSIPYDLCFHIANSQPASMAEVYEAARIWERHHRISGRTSDPRRNHPSHTSNSSNHPSSATL # TPARSHVSSNDPTPMDLDTFSLRPMSRPDPTNPPINVFYGRITSLRPGIYRTARKTHPYQLPLLIRRTAEKSATPAKASLQEVDSFLQPCKPESKPLI # SKPAQNEVFTFSFDDDQNIGLPVYLAMLYGPRLPNKPWKHEAILRAFGISDTGAHWNYITRKSAELVRAKIFDLVEPRTIAGAGHTVTKSFCRFWIWI # GPIKEEICAYILEADSGFRHDFLLGRSFLASHNVVFNWDDNSMTIVAPNTGVAVRIKPKQISGLKKRELYHTESRSAGYTPLPAEEFTYTEDEDVASI # EAVIDEQESMQALSIKSPISSTPALTNSNLDLHNTIEEKQEERKSEVKSRTTFGKKLKDFALNKFPGLFRKKVGYPPAQKWVHEIDTGPAQPVQVRGR # PHSPHENEEIKKFLNNAEADGVIEPSGSPWSAPILLIPKKDGMLRPCVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g151 ### # start gene g152 Scaffold_24 AUGUSTUS gene 82237 83247 0.35 + . g152 Scaffold_24 AUGUSTUS transcript 82237 83247 0.35 + . g152.t1 Scaffold_24 AUGUSTUS start_codon 82237 82239 . + 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_24 AUGUSTUS CDS 82237 83247 0.35 + 0 transcript_id "g152.t1"; gene_id "g152"; Scaffold_24 AUGUSTUS stop_codon 83245 83247 . + 0 transcript_id "g152.t1"; gene_id "g152"; # protein sequence = [MTPTEQKYSAQEREMLAVVHALKKWRAYTEGSPVLVRTDHESLKYFLTQKHLGRRLARFHDDVAHFDVKILYRPGTSQ # IAADALSRREGHADVPDKDYEPLYSFPLDMDPNDRSAIFNTLEKYRKDLLAGKVSGDTERYSVHGQKLFKDISTNNNEDSQIVLVPTSVTEALMVVKS # LHIDLGHLGMNSVLEALRSRVWIPYGSEMVEHIVCTCNECQFTKRDITPSQPLFPLPRTSAGDVYAFDFIGPLPKTKRGNQYILTAMELGTNYTFAKP # LVQRSADAVIHLFRSIIAMFGKSKAVLTDNGEEFMSYAFQNLLQRMTIKHLHTTPYHPQTNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g152 ### # start gene g153 Scaffold_24 AUGUSTUS gene 86774 87124 1 + . g153 Scaffold_24 AUGUSTUS transcript 86774 87124 1 + . g153.t1 Scaffold_24 AUGUSTUS start_codon 86774 86776 . + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_24 AUGUSTUS CDS 86774 87124 1 + 0 transcript_id "g153.t1"; gene_id "g153"; Scaffold_24 AUGUSTUS stop_codon 87122 87124 . + 0 transcript_id "g153.t1"; gene_id "g153"; # protein sequence = [MRILTTNGDNNRFLATNSSKPGGSVAATSDSDTNDGSRCGEDSALDGANLDVNHTPEGTDTSTDENNRRRPMNRGQDR # LRQIAGETNSTRQPESQCSQSTNPSENPSQMGTEHNNL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g153 ### # start gene g154 Scaffold_24 AUGUSTUS gene 87673 89652 0.55 + . g154 Scaffold_24 AUGUSTUS transcript 87673 89652 0.55 + . g154.t1 Scaffold_24 AUGUSTUS start_codon 87673 87675 . + 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_24 AUGUSTUS CDS 87673 89652 0.55 + 0 transcript_id "g154.t1"; gene_id "g154"; Scaffold_24 AUGUSTUS stop_codon 89650 89652 . + 0 transcript_id "g154.t1"; gene_id "g154"; # protein sequence = [MMLGDFNMVEEQIDRLPMNKDHAQADAFETVKTDLQLIDGWRQQYPNRKAYTFMQKRAGGIQNHARLDRIYIKPTMED # NAFEWRIQSPGLHTDHSIVSLRITCETAPDIGKGRWCWPKHIMYDKYLTLYIEKEGLILQAKLDEIEDQPNRAYETQILWSDYQDRIAKEARKRAKII # IPRIDKQIKDTETNLRLIEDDQTLTDDERSLSVTLLSEKLAELENKRHQSKRQNVKARNIVHGETISRYWSAMNKSKSPRETIQRLRIHEMRTANGHT # NQPNPVNEENQPTGNQDNNDALEPNQPIYERNSKRMANMMSAYHGKIQIYETPIDNDQRHTVTEAVLNRIKTRISDQHRQKMTDLLTDDDVDEALKLS # ANYKAPGLNGIPYEVWKIIHARHINNIAHQKPSFNIIKTLRRVYNDIEMNGLSPNSQFSESWMCPLYKKNDRAEMANYRPISLLNSDYKIMTKALTIK # LAKAAPEIIHPAQAGFVPGRHIYDQIWLSKLIIEMAENTEQDGVIVALDQEKAYDKIKHDYLWLALEAFGIPQQFINTVKSLYSNALTTVIVNGMKSI # NPFQVTRGVRQGDPLSCLLFNIAIEPLAESLQQSNLRGIEIPRKLERLIATFFADDTTVYLSSKDDFGDLTKILDEWSLRQEQNLTSAKQK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g154 ### # start gene g155 Scaffold_24 AUGUSTUS gene 90645 92084 0.82 + . g155 Scaffold_24 AUGUSTUS transcript 90645 92084 0.82 + . g155.t1 Scaffold_24 AUGUSTUS start_codon 90645 90647 . + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_24 AUGUSTUS CDS 90645 92084 0.82 + 0 transcript_id "g155.t1"; gene_id "g155"; Scaffold_24 AUGUSTUS stop_codon 92082 92084 . + 0 transcript_id "g155.t1"; gene_id "g155"; # protein sequence = [MTLPEDTEPTDLPVTDDESQIFDWRTTTKGTLSDAFRIFTSDERSNEIPTQNAWNQNETRNQVEVYTDGSCINNGDDN # ATAGAGIFSKDDPTLTCAIRIPSTLKQTNQTGEIIGLKQAAEKAHLKDEVTFCSDSKTALDGLTTLREKWENIGYIGIENAREFQVTTARLRARKALS # IMKKVKAHVGIEGNEEADKLANEGRTKPNEDRIDLMIPRHLCLTGAKLKCLNQSLVYQAIKQRKMEKPKHREKLNRRSTQQNIGMAKIGAIRLSGKTP # SDKRIWRAMRHRDFSRQFRYFSWMTAHNGYMVGKFWDCTQEPWKGVCAFCKVEESMEHILTECRGPGMEEIWSLCEDLWRGKRTEWLRPSFGEILSCG # LVELKDNDGNPKKGDSRLYRIIVSESAHLIWKLRNARVINGKGFPSAQEILNKWNNCINSRLQIDCLLANSRFGSKRLSQTIVEKTWYEVLQDKESLP # DVWTKSTGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g155 ### # start gene g156 Scaffold_24 AUGUSTUS gene 95767 96060 1 - . g156 Scaffold_24 AUGUSTUS transcript 95767 96060 1 - . g156.t1 Scaffold_24 AUGUSTUS stop_codon 95767 95769 . - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_24 AUGUSTUS CDS 95767 96060 1 - 0 transcript_id "g156.t1"; gene_id "g156"; Scaffold_24 AUGUSTUS start_codon 96058 96060 . - 0 transcript_id "g156.t1"; gene_id "g156"; # protein sequence = [MTWDRAKEAVEGARRSVEGGVLGGVEKMQQVTGLKVGEVWKLGEEKQGKVVEAVKALEENAKEAEVRVLEAAKVVEKK # TEEAVSDAETKKEETKRLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g156 ### # start gene g157 Scaffold_24 AUGUSTUS gene 99483 100438 0.34 - . g157 Scaffold_24 AUGUSTUS transcript 99483 100438 0.34 - . g157.t1 Scaffold_24 AUGUSTUS stop_codon 99483 99485 . - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_24 AUGUSTUS CDS 99483 100283 0.41 - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_24 AUGUSTUS CDS 100430 100438 0.37 - 0 transcript_id "g157.t1"; gene_id "g157"; Scaffold_24 AUGUSTUS start_codon 100436 100438 . - 0 transcript_id "g157.t1"; gene_id "g157"; # protein sequence = [MALLRCCTLLHLNYDYSNPSPLKVYTDGSCINGNTSSAHAGLGIYYGPNHPLNLAARVPGPQRNNRAELYAILATIQR # SQPMRPLHIFTDSTYAIQSLTYNAGENAQCERDCKNGDLLKVIAQWVASRPASIHFTHVRAHSGNAHNDAADRLAKHGTSLPLPPPSSDLDFSTLAAP # PPFLPPTPTNIPKVSPLFRTRDSLYRCTTQLDNHRLQTPPYLIAVDHSAVTFKTLLSNAFAMLQKQGVLPSGNITNLSVALVAPPLRLPLTGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g157 ### # start gene g158 Scaffold_24 AUGUSTUS gene 103148 105094 0.98 - . g158 Scaffold_24 AUGUSTUS transcript 103148 105094 0.98 - . g158.t1 Scaffold_24 AUGUSTUS stop_codon 103148 103150 . - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_24 AUGUSTUS CDS 103148 105094 0.98 - 0 transcript_id "g158.t1"; gene_id "g158"; Scaffold_24 AUGUSTUS start_codon 105092 105094 . - 0 transcript_id "g158.t1"; gene_id "g158"; # protein sequence = [MESLGPARWSSIRPWIPPLSLSVREITSVSVTFVLSAATSDQNSETELSLADLGLSAEDMHEDEDVADDEDTSTSELD # AKKPLSMVSSALNGGLSVEVDRSSWRRVFIRIDDKADEAVIIVYGLLPGRQYEIVLELVQGGHTNSIRQQVTTEGVYFYAAIRSTVLQLPFPENETKD # ASHASDSDSTSKSTAASSSSDINVLNTSAQPSPPSDSNGSSPQPSSSPGYGFAPLTLEDRLNQLQHTLSVLNSEQASLTATIKSSRRDAQKADANLRS # EIDVLKRASDRYLSSEQRSKQKVLALQEVVKRTQIITKEMEATIKEVNAEIPGLKEEKQKREAEHRKVKEAANKVRREKDAQAEQERKRIESMKNELN # TLTKQLEKLEVKKEKLEGGVIKELEEQLENVEQEMEMLEREEELSNGSFSQPMTSQSIGPTWTPGLSGRHPEDEVPKTPDPGTIGRPSPNSLSKSSLI # QRPQGLVHLPNPLSISNAHWTPISSPRHSQPHSPNHINQRTSSLPQPNPQGNPHHLHHVHHHSQQHQHHHSHANSHFPAARPPQPSPTIILMNPNRQS # LKNTPGGSIGTPASSAVHAVDPSEAISNSLSPSPAMGFTASGVSTPSTTGSTLSSRAPPFEPGRSLIMRSTSQSRTRVGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g158 ### # start gene g159 Scaffold_24 AUGUSTUS gene 108168 108787 0.84 - . g159 Scaffold_24 AUGUSTUS transcript 108168 108787 0.84 - . g159.t1 Scaffold_24 AUGUSTUS stop_codon 108168 108170 . - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_24 AUGUSTUS CDS 108168 108553 0.87 - 2 transcript_id "g159.t1"; gene_id "g159"; Scaffold_24 AUGUSTUS CDS 108631 108787 0.93 - 0 transcript_id "g159.t1"; gene_id "g159"; Scaffold_24 AUGUSTUS start_codon 108785 108787 . - 0 transcript_id "g159.t1"; gene_id "g159"; # protein sequence = [MPVLRDLKDGAMPPYVIPRKGGDVSVFQSQASEISFLIYYRSSSEEPITLTTEITERILARGLKLCPDLAPPEIRAER # EPTVDDLRPLILDVGVGFRPYRNGGVRVGVEWMDSSPLKDKGKKVPVVFNYGSGSNIRFAKLADVCILCIFVCRHGGNGYQAAWGSAIMALEYLEGAL # KNQE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g159 ### # start gene g160 Scaffold_24 AUGUSTUS gene 110106 110834 0.97 - . g160 Scaffold_24 AUGUSTUS transcript 110106 110834 0.97 - . g160.t1 Scaffold_24 AUGUSTUS stop_codon 110106 110108 . - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_24 AUGUSTUS CDS 110106 110834 0.97 - 0 transcript_id "g160.t1"; gene_id "g160"; Scaffold_24 AUGUSTUS start_codon 110832 110834 . - 0 transcript_id "g160.t1"; gene_id "g160"; # protein sequence = [MPHHHGEGPGGPDGPGGFGGGPGGPGGFEGHNGSDRGFGGGHHHGGFGGPGGFGGGPQGGFGGGPGGGGFPGDQNGGF # FGGPGGHHNHHGQGGFGHGNPGFGGFGGGSGGPGGQGGPGYGSGYGMPPHHSSHNSLLGKLVNKLEGGGNYQHHNGVSGLIPHVPNLFGNNHSHHQPP # PGYGGPGPNRDMAFGQGPPQQGRSGFMSPPPPQFGGGGGFMPQGPSQGPGGPGGPGGPQTDGPPRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g160 ### # start gene g161 Scaffold_24 AUGUSTUS gene 112957 114605 0.62 - . g161 Scaffold_24 AUGUSTUS transcript 112957 114605 0.62 - . g161.t1 Scaffold_24 AUGUSTUS stop_codon 112957 112959 . - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_24 AUGUSTUS CDS 112957 114255 0.66 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_24 AUGUSTUS CDS 114603 114605 0.84 - 0 transcript_id "g161.t1"; gene_id "g161"; Scaffold_24 AUGUSTUS start_codon 114603 114605 . - 0 transcript_id "g161.t1"; gene_id "g161"; # protein sequence = [MKPTAKPKVAFPFKTKKADSQNQASPVVNSAALLSGAASTTSSSAAKGVYVRPDEEKWRASGGGGNDKRRNGDNNRGG # SRWRDSPSRENGRGYNSRSNSRSRSTSRSPSRHRLPDRRSPRRSSRRRSLEYDRYADDRGRDDTRYYEERDRSRSRHYEPGYRRSDDRDWTRRDERRD # HYRPQYDSYRPDYSRTKSRTPPPPPRAEFSPPSTSSAFPIDRARTPPFPPPPFPPSPHSSNAPTLSTEPEPFPGDIPPQPKSPPPPAPPPDTRLNNTA # IGLPERPAMYMPLHPHSNAQSQLHSNLHAPRPNAPADFHSPPSLRHIAHTDMDSHQDRNWGSSVDPHRDPTKKSMPEPPPRIQLSLKRKSVSRRTREE # EKKAFGRVFEGCGVKADYEADELGGELSGMYFHIPVIDLAPELFLRHTERYTRQSRKPPTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g161 ### # start gene g162 Scaffold_24 AUGUSTUS gene 116357 120005 0.2 + . g162 Scaffold_24 AUGUSTUS transcript 116357 120005 0.2 + . g162.t1 Scaffold_24 AUGUSTUS start_codon 116357 116359 . + 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_24 AUGUSTUS CDS 116357 116932 0.24 + 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_24 AUGUSTUS CDS 118638 120005 0.89 + 0 transcript_id "g162.t1"; gene_id "g162"; Scaffold_24 AUGUSTUS stop_codon 120003 120005 . + 0 transcript_id "g162.t1"; gene_id "g162"; # protein sequence = [MLHPDMDKEKEHYIEFRKSMKKFKSTIDNTFAVVGYSTPYSFGRLNNEIVVLLSSLGITNEVLLAKQQAYFTWIEQAT # FDLVQGFEFLVSLGPKYLAEAEHLFLDGFTPELLSLIRKAQNSEIASFNKNDDAKKERVRMLVHKSRRLYGVCDPHRVLREGQVHVRVSTSRNGTSTI # FGTDVIVVRNPCLHPGIFSVTTEEFIKRFSHIDTTYLPDTLPEADLSSLPEALRAVFTEPEDLVRRYLSMADITSQNLDQCAEFAWMHHADHQLFWIF # DSILNRQPVDQYIVLKWLDTHPLLVFCILKKFLSDETDSLPEPWAKLGPTIVQHIIRAAHAVPVASLYALERLKAIVAAIEFHNYLELLELVTLAIRA # PQQVTETLLVLHECREVVRTESSAKEYVHKQALAVTIDRAQEAADVCPCDEDGKIKRQRSAPTVVPLLPAEEDDLHIIAHIRVDSPTTIRLHSHVRFR # AASKPEKGDMESSILDGLVTLSESGEIRVRLVHRPPPEFARMQWYLYDVGSVGKRFDMYMFVLSVVPILATFRAMMDAIRRIALEGSECCRFSRMITD # ASPTVVEAAEELAGSSLEVEIVRETTVLSTEAEVTEDDGLNESQREAVQKTRKAQVSLIWGPPGNKGTTLSSEYKTKQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g162 ### # start gene g163 Scaffold_24 AUGUSTUS gene 127012 128064 0.86 + . g163 Scaffold_24 AUGUSTUS transcript 127012 128064 0.86 + . g163.t1 Scaffold_24 AUGUSTUS start_codon 127012 127014 . + 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_24 AUGUSTUS CDS 127012 128064 0.86 + 0 transcript_id "g163.t1"; gene_id "g163"; Scaffold_24 AUGUSTUS stop_codon 128062 128064 . + 0 transcript_id "g163.t1"; gene_id "g163"; # protein sequence = [MSSDESTKLAVLPTDYPRISSQIVEAEERYQIEGASAQDILRALVAVVHRYTGDTHVVLGTPSSVLRIDLSPEDYLDS # IQVVETESLSTGDLNVFVSGNSIRTVYNTILFTPIRIQLLHLHLALIIQNRTTPIGRVSLRTEKEEGILPNPRAPLNWCEWPGPITSVFSSNAAKNPE # KAAIITQTRTYAYGSLLNAANSLSNHLLEHGVQRGDVVMIYAHRSADLVLAVLGTLGAGATFSVIDPAYPPERQIVYLSVARPRAVIILQGAQDLNPV # DETVRGYWEKNLGGVKVCIEGVSLGEDGTVHADGSILNVNAADPGVVLGPDSIATLSFTSGSTGVPKGVRGRHYSM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g163 ### # start gene g164 Scaffold_24 AUGUSTUS gene 129642 131588 1 + . g164 Scaffold_24 AUGUSTUS transcript 129642 131588 1 + . g164.t1 Scaffold_24 AUGUSTUS start_codon 129642 129644 . + 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_24 AUGUSTUS CDS 129642 131588 1 + 0 transcript_id "g164.t1"; gene_id "g164"; Scaffold_24 AUGUSTUS stop_codon 131586 131588 . + 0 transcript_id "g164.t1"; gene_id "g164"; # protein sequence = [MPLNPNGKIDKPALPFPDTAAAVASLSAVSASALAVANGPDNLHADITPTQKTILNLFASLLPGFTPDFTGEALPSIP # LNESFFDLGGHSILATRLVFEMRRAFPVLKDRISLGVVYSKHAGEIASVRGLASIVDVLRGEDLGLPIDTKAGPNAKEGNGILDTDGDEEGEEDNHYA # QDLDELISSHLAYSYPSYSTSSARSLHVFLTGATGFLGAFILQQLLETQSSSSSSFASHVTCLVRASSPSSAIARLRDSCASRGVWSDSWISSNRLTV # LPGDLALPHFGVTYSQWESLEHEVDVIMHNGALVHWVYPYERLKAPNVMGTLTALELAGTQGKPKSMVFVSSTSVLDTPSYVRIGSSVVSQNLGCGVL # ETDDLETARRGLKTGYGQSKWVAEKLLFEAGKRGLSGYIIRPGYVVGESKGGVTNTDDFVWRMVKGCVQLGSVPDMSNGVNMVPVDRVAMCCVSAVTA # SPIPSDDASSEKGGPGGNISVMHVTARPLPTFNDLFTALKIYGWAVEKTEYVQWRLQLEAHVMNKSRNTNGEVEEEDNALFPLLHFVLDDLPTSTKAP # MLDDRNTVAVVERGRISEYDPRTQSTRSFWAGILHGLFVPGFCLLHRAVKVAKIYRNSRVVLLRPQEEVESKLPLPHLFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g164 ### # start gene g165 Scaffold_24 AUGUSTUS gene 163135 163716 0.43 - . g165 Scaffold_24 AUGUSTUS transcript 163135 163716 0.43 - . g165.t1 Scaffold_24 AUGUSTUS stop_codon 163135 163137 . - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_24 AUGUSTUS CDS 163135 163716 0.43 - 0 transcript_id "g165.t1"; gene_id "g165"; Scaffold_24 AUGUSTUS start_codon 163714 163716 . - 0 transcript_id "g165.t1"; gene_id "g165"; # protein sequence = [MSETVIREVRQTSTYNAPPDACKNSRSLKTSGFSLGIHSGLSVSGLKRTDPSSSPFARFGIFPVGGRSTAVKMRNGNL # WVLASTPLDTETKAKLEELGPVKSVSSSFASLCFCNFLGLSLARMLFITCSSVNCGLLFPWRFIDEETGDFKKAYPEAKIIAPKAAIERVQDKTLKFD # GGELHPHRLLNYMMHFI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g165 ### # start gene g166 Scaffold_24 AUGUSTUS gene 164214 165563 0.5 - . g166 Scaffold_24 AUGUSTUS transcript 164214 165563 0.5 - . g166.t1 Scaffold_24 AUGUSTUS stop_codon 164214 164216 . - 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_24 AUGUSTUS CDS 164214 164721 1 - 1 transcript_id "g166.t1"; gene_id "g166"; Scaffold_24 AUGUSTUS CDS 164777 164890 0.91 - 1 transcript_id "g166.t1"; gene_id "g166"; Scaffold_24 AUGUSTUS CDS 165019 165563 0.55 - 0 transcript_id "g166.t1"; gene_id "g166"; Scaffold_24 AUGUSTUS start_codon 165561 165563 . - 0 transcript_id "g166.t1"; gene_id "g166"; # protein sequence = [MSSVPSAGAGPSSYSNKRASFLPDSDAKLGKPVSPLVRESSFPAPDEQPFDTHPDWHSHGDVNMAPSDAFDSGSMRKK # DEVSRPMYKTLGGNRQREMVLVKEINDYVSVGGSLGLSLPVPATLTRITAELDGTHIFEGLNPEDGGEYSTRADIHCSEHFQVLPRCISSRASKHFGW # IICRHRRFSPRLMPTLNLGLPCSILDGSKNCLLVITQAGVLHLWNVSKGIAFFPPVSVAPLISSPNDTIVSALVRPNGTPIVNCSNGTVYSYDAALFT # WVKISDRWWSEGSDVWQGRQRSQSQVANRGIVAFVEGSLSGPPSEASAETPRPEWWNTALTLGHLETRLHAARLLDSPVEYKQYLTLYAKKIADEGFR # AKAEELIKDLSGPIYW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g166 ### # start gene g167 Scaffold_24 AUGUSTUS gene 171097 171510 0.74 + . g167 Scaffold_24 AUGUSTUS transcript 171097 171510 0.74 + . g167.t1 Scaffold_24 AUGUSTUS start_codon 171097 171099 . + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_24 AUGUSTUS CDS 171097 171510 0.74 + 0 transcript_id "g167.t1"; gene_id "g167"; Scaffold_24 AUGUSTUS stop_codon 171508 171510 . + 0 transcript_id "g167.t1"; gene_id "g167"; # protein sequence = [MGSQLILPDFTLSPCVMLSTLGISVQFRSRSNALNLGVPPTECFIPLIKILQTISAKQLKEVNIWLRPNGHMTQEEYE # QLDWDGLASVIEQPLFKSLFRFRFFASPKHVEIVRRVIKKRIWEQHPLLAPVVRIRAWG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g167 ### # start gene g168 Scaffold_24 AUGUSTUS gene 171637 171987 1 - . g168 Scaffold_24 AUGUSTUS transcript 171637 171987 1 - . g168.t1 Scaffold_24 AUGUSTUS stop_codon 171637 171639 . - 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_24 AUGUSTUS CDS 171637 171987 1 - 0 transcript_id "g168.t1"; gene_id "g168"; Scaffold_24 AUGUSTUS start_codon 171985 171987 . - 0 transcript_id "g168.t1"; gene_id "g168"; # protein sequence = [MVQHLQNPCGTSSRENPRYSKRINYDALKDLFVDSNVHSSDPGPDFGPASVGEASMDFDDVGLYTLDDKDDKDDADLI # VIEEDGILGVSSAHPREEHDGDGEAEVGGWEDVYEQEV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g168 ### # start gene g169 Scaffold_24 AUGUSTUS gene 172210 173181 0.57 - . g169 Scaffold_24 AUGUSTUS transcript 172210 173181 0.57 - . g169.t1 Scaffold_24 AUGUSTUS stop_codon 172210 172212 . - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_24 AUGUSTUS CDS 172210 173181 0.57 - 0 transcript_id "g169.t1"; gene_id "g169"; Scaffold_24 AUGUSTUS start_codon 173179 173181 . - 0 transcript_id "g169.t1"; gene_id "g169"; # protein sequence = [MTRGRRPAGICGAALLLAARMNNFRRSVEEIVQVVKIADSTLKKRLDEFKNTPSGALTLADFRTVWLEDEMDPPAYTK # GKEKEEAERLAAEQGVLEIEPTSKNKRQKKDKEKKKKRKRKRKRGDGDDEEATDEDVDAEGDSDGEPIAPMPPNLRQPIDLALMNEGILAGVQNLEEP # PLFLPELTMDQTPDPIIDPALLSQPVPSSSLSNFPSSLDSHWPPQSSSSIDPTLMAPPMDPFEVAVSSALAEEVSAFLDNNQGSLLSNALDDAEQQRL # AQINSNVDDQLLGLDEDELNRFLLTDEEVKIKERVWVELNKDYLEALAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g169 ### # start gene g170 Scaffold_24 AUGUSTUS gene 175787 176107 0.95 - . g170 Scaffold_24 AUGUSTUS transcript 175787 176107 0.95 - . g170.t1 Scaffold_24 AUGUSTUS stop_codon 175787 175789 . - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_24 AUGUSTUS CDS 175787 176107 0.95 - 0 transcript_id "g170.t1"; gene_id "g170"; Scaffold_24 AUGUSTUS start_codon 176105 176107 . - 0 transcript_id "g170.t1"; gene_id "g170"; # protein sequence = [MTIALVVGASRGLGLELAKILHDRNFQVFATSRSPAAHIRKELGPDFPQDINIIPNIDLTQRNAGERIVSYLKGDLGL # GVGLGETRKLDLVIMNAGVFKADVSPYW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g170 ### # start gene g171 Scaffold_24 AUGUSTUS gene 176730 177614 0.62 - . g171 Scaffold_24 AUGUSTUS transcript 176730 177614 0.62 - . g171.t1 Scaffold_24 AUGUSTUS stop_codon 176730 176732 . - 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_24 AUGUSTUS CDS 176730 177614 0.62 - 0 transcript_id "g171.t1"; gene_id "g171"; Scaffold_24 AUGUSTUS start_codon 177612 177614 . - 0 transcript_id "g171.t1"; gene_id "g171"; # protein sequence = [MATSFQYPTTSLSKELTQLIPIEIYEYIISFLDHSPTSKSCSLTCRSWLQASWKRLFAGTILMVHRENIDDLLEIVER # DVHFVTIIRFVRGLYLEQGGSLRLPTWSDSEERDKYKEAFQFDKYLPLLVGFKSVRMLKLGWIRGDTGPPTALSLQNNFGVGVTALELNSVILSSPLQ # FFEILHALPQLTSLMLVGLKFNSGRPSEDAREAPGMTLVDTPKPPRLQELYCNVTEDIADFIFSWFAFHGPIPIETVAVGLFNGSTNSKVSRFLFESG # STIDTVKIWDAYSQDGAFRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g171 ### # start gene g172 Scaffold_24 AUGUSTUS gene 179199 179779 0.78 - . g172 Scaffold_24 AUGUSTUS transcript 179199 179779 0.78 - . g172.t1 Scaffold_24 AUGUSTUS stop_codon 179199 179201 . - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_24 AUGUSTUS CDS 179199 179542 0.9 - 2 transcript_id "g172.t1"; gene_id "g172"; Scaffold_24 AUGUSTUS CDS 179617 179779 0.82 - 0 transcript_id "g172.t1"; gene_id "g172"; Scaffold_24 AUGUSTUS start_codon 179777 179779 . - 0 transcript_id "g172.t1"; gene_id "g172"; # protein sequence = [MYQSLRKSSIISVSVGSLSETLNGENDPALGIMNYDIWGSWSPTVGPNAPLNDSCLPHLFVDMQQTEVFYKKISLGLA # AYGHSFDVSNSNALNSSKALQLYPAFNAGDQPHGDSQDAQAGTDECGNSTPVGGIFNFWGLVDGGFLTTAGTAASGIDYTFDNCSQTVRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g172 ### # start gene g173 Scaffold_24 AUGUSTUS gene 185036 185449 1 - . g173 Scaffold_24 AUGUSTUS transcript 185036 185449 1 - . g173.t1 Scaffold_24 AUGUSTUS stop_codon 185036 185038 . - 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_24 AUGUSTUS CDS 185036 185449 1 - 0 transcript_id "g173.t1"; gene_id "g173"; Scaffold_24 AUGUSTUS start_codon 185447 185449 . - 0 transcript_id "g173.t1"; gene_id "g173"; # protein sequence = [MISLQIQHIKPENIPRPPYSTSPATGNASSAPPTNTASTSNKGKAPATTKSKSPIAPQPKQNGKQMGGRRLPVSPEPL # PPLASRVSPYSPALPTGVLIDTVKAGMNATENNTGTSGTLGAPSPFGASGVLRKVNERL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g173 ### # start gene g174 Scaffold_24 AUGUSTUS gene 185861 186130 1 - . g174 Scaffold_24 AUGUSTUS transcript 185861 186130 1 - . g174.t1 Scaffold_24 AUGUSTUS stop_codon 185861 185863 . - 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_24 AUGUSTUS CDS 185861 186130 1 - 0 transcript_id "g174.t1"; gene_id "g174"; Scaffold_24 AUGUSTUS start_codon 186128 186130 . - 0 transcript_id "g174.t1"; gene_id "g174"; # protein sequence = [MSRKAVLVEDEFDDDTDLPLPARPLPHTGAKGPVLQEIASDIDSEDDFDLDTSQLAGPASPPSSQPKLRPEGASQLPK # NTITDITPYKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g174 ### # start gene g175 Scaffold_24 AUGUSTUS gene 189469 190137 0.87 - . g175 Scaffold_24 AUGUSTUS transcript 189469 190137 0.87 - . g175.t1 Scaffold_24 AUGUSTUS stop_codon 189469 189471 . - 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_24 AUGUSTUS CDS 189469 190137 0.87 - 0 transcript_id "g175.t1"; gene_id "g175"; Scaffold_24 AUGUSTUS start_codon 190135 190137 . - 0 transcript_id "g175.t1"; gene_id "g175"; # protein sequence = [MRTRITFYLFIILDILAANAGDIGPGVTSGYDLGVPQARGFPEHSIFSLRGRAPGKDSEGGVVSPEDFPKPPTSRISL # SDFPNPPPGKGTIIPKIPKLVLIEPSDTESSPASRPQSTDLPPPPGAPPTRPLPPLPLKLNEVSKGFSLPQSAPPNKKLPELPSHPLANLNEVSPGFP # PPQSAPPNTKLPALPSHPAPPTRPPPAPPADAHPPRSRPRVRCDPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g175 ### # start gene g176 Scaffold_24 AUGUSTUS gene 193077 193712 0.76 + . g176 Scaffold_24 AUGUSTUS transcript 193077 193712 0.76 + . g176.t1 Scaffold_24 AUGUSTUS start_codon 193077 193079 . + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_24 AUGUSTUS CDS 193077 193712 0.76 + 0 transcript_id "g176.t1"; gene_id "g176"; Scaffold_24 AUGUSTUS stop_codon 193710 193712 . + 0 transcript_id "g176.t1"; gene_id "g176"; # protein sequence = [MFLTKFRMGDTSFYGPGLTVDTTSKITVVTQFITSDNTTTGDLTAIRRIYVQNGQVIQNSMSNIAGVTPTNEITTDFC # DQQKTAFGDTNTFSEKGGLTGMGAAFSRGMVLVLSIWDDDAAEMLWLDSTYPVGKTGPGAARGTCATTSGQPDQVETQSPNAQVVFSNIKFGAIGSTF # SSTGTGTGTGTGTGTGTGTTTSSAPAATQTKYGQW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g176 ### # start gene g177 Scaffold_24 AUGUSTUS gene 197526 199136 0.81 - . g177 Scaffold_24 AUGUSTUS transcript 197526 199136 0.81 - . g177.t1 Scaffold_24 AUGUSTUS stop_codon 197526 197528 . - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_24 AUGUSTUS CDS 197526 199136 0.81 - 0 transcript_id "g177.t1"; gene_id "g177"; Scaffold_24 AUGUSTUS start_codon 199134 199136 . - 0 transcript_id "g177.t1"; gene_id "g177"; # protein sequence = [MAQAQNAAFAAMTENSTCTSEYQDCLSIHSSRLTECILAGQDACVNGAFAQCTGSTFSLTPCSSGLSCFALPLLNSNG # TSISCDTEADVEARIQAAGVEGGIFGNSTTTTSTAGAVSTTSSASNANSTDTGDASDCGDDDEPDITSNSMTATSMDCGDETTTFPTASVTVVTAVAS # ASSPALGTGEVVTATAPILSSAGSVTTTVTSSSNATTSASNSDSTTTVIDIPAGTDGAFPTASVSAAIASIASALSASAASASAATASGSATASPSVA # QNLFTLNPSSVSVSSTIVPTSSSVPVRRAIRGRQILSTASADLTTSVSTSSFSDVAVATSSPSSTGINTDSVIGTAAIASISSGTIAASAIGSPGVAS # SSSASSIAAAITSSTTITSSSSSTTDALATPGATVTVTTTMFLIVPGQTGTATAMLSIPTTASGSSAATTSASVLSDSAISTASSTASSSVPLATDAA # SSSSSAVPSSLVASTDVSSATDSAITSFTVLSAPSATAASSSTSAGFQFTGSGFGRRSWTRATGAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g177 ### # start gene g178 Scaffold_24 AUGUSTUS gene 200135 200986 0.98 - . g178 Scaffold_24 AUGUSTUS transcript 200135 200986 0.98 - . g178.t1 Scaffold_24 AUGUSTUS stop_codon 200135 200137 . - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_24 AUGUSTUS CDS 200135 200986 0.98 - 0 transcript_id "g178.t1"; gene_id "g178"; Scaffold_24 AUGUSTUS start_codon 200984 200986 . - 0 transcript_id "g178.t1"; gene_id "g178"; # protein sequence = [MQANIRAAAEVGSKGLLRNPNMAYFQYAQSLLADPAVVLRSAKKGLKCKQTSPFIRFQLLQRAVENAGQLGLQTLEQA # SSAEDPKWEEGVAFFMSAWTDSNTFLAEAPPDNRHMRNVLYWNILLAIIIRGPELNPNLEEIKVRLVQRCQDYDGLMFCSVLPQKLSESDDFTRAFSQ # PIPNTQLRLAQAAIVEQYSAAVSEWEEVILRLNNSSEKQPEVLPDSEKVQNDLNNFLNDLQLDDESPAKRVAAHPKVNLNSVLLYQCSWCKNPSAMLK # KCSGCSQTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g178 ### # start gene g179 Scaffold_24 AUGUSTUS gene 221142 221624 0.56 + . g179 Scaffold_24 AUGUSTUS transcript 221142 221624 0.56 + . g179.t1 Scaffold_24 AUGUSTUS start_codon 221142 221144 . + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_24 AUGUSTUS CDS 221142 221624 0.56 + 0 transcript_id "g179.t1"; gene_id "g179"; Scaffold_24 AUGUSTUS stop_codon 221622 221624 . + 0 transcript_id "g179.t1"; gene_id "g179"; # protein sequence = [MQLDGLGALFDQARQSFLRSFLDLQQAGQDPIVVLEALKAAEPQRESISVEDWTLLATLFQWSSPFNLNGLKFDNRTP # AEWIDLLRSIHSGATSATVTVDRHLVDTSQPPEAAVEVSEALDPQGSLPNTVVEKASGVEDLASLSEGSPIQTELDLPRLKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g179 ### # start gene g180 Scaffold_24 AUGUSTUS gene 223432 224179 0.45 + . g180 Scaffold_24 AUGUSTUS transcript 223432 224179 0.45 + . g180.t1 Scaffold_24 AUGUSTUS start_codon 223432 223434 . + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_24 AUGUSTUS CDS 223432 223458 0.47 + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_24 AUGUSTUS CDS 223565 223700 0.57 + 0 transcript_id "g180.t1"; gene_id "g180"; Scaffold_24 AUGUSTUS CDS 223782 224179 0.97 + 2 transcript_id "g180.t1"; gene_id "g180"; Scaffold_24 AUGUSTUS stop_codon 224177 224179 . + 0 transcript_id "g180.t1"; gene_id "g180"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDSSASDASFATAQSIPTTGSEDTVVTPTEMLFQSLRPSNEP # LLHSLVVLLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g180 ### # start gene g181 Scaffold_24 AUGUSTUS gene 224761 225576 0.54 - . g181 Scaffold_24 AUGUSTUS transcript 224761 225576 0.54 - . g181.t1 Scaffold_24 AUGUSTUS stop_codon 224761 224763 . - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_24 AUGUSTUS CDS 224761 225576 0.54 - 0 transcript_id "g181.t1"; gene_id "g181"; Scaffold_24 AUGUSTUS start_codon 225574 225576 . - 0 transcript_id "g181.t1"; gene_id "g181"; # protein sequence = [MKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEE # VVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLPFDI # VESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRILELKRVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g181 ### # start gene g182 Scaffold_24 AUGUSTUS gene 225817 226827 0.99 - . g182 Scaffold_24 AUGUSTUS transcript 225817 226827 0.99 - . g182.t1 Scaffold_24 AUGUSTUS stop_codon 225817 225819 . - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_24 AUGUSTUS CDS 225817 226827 0.99 - 0 transcript_id "g182.t1"; gene_id "g182"; Scaffold_24 AUGUSTUS start_codon 226825 226827 . - 0 transcript_id "g182.t1"; gene_id "g182"; # protein sequence = [MFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKK # KFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSR # ITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVF # SRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESWVKCQKMNGLNLLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g182 ### # start gene g183 Scaffold_24 AUGUSTUS gene 226874 227878 0.96 - . g183 Scaffold_24 AUGUSTUS transcript 226874 227878 0.96 - . g183.t1 Scaffold_24 AUGUSTUS stop_codon 226874 226876 . - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_24 AUGUSTUS CDS 226874 227878 0.96 - 0 transcript_id "g183.t1"; gene_id "g183"; Scaffold_24 AUGUSTUS start_codon 227876 227878 . - 0 transcript_id "g183.t1"; gene_id "g183"; # protein sequence = [MVDPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWEQERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPV # KVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGT # LDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVW # EHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIAQVVLEWPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g183 ### # start gene g184 Scaffold_24 AUGUSTUS gene 228118 230259 0.75 - . g184 Scaffold_24 AUGUSTUS transcript 228118 230259 0.75 - . g184.t1 Scaffold_24 AUGUSTUS stop_codon 228118 228120 . - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_24 AUGUSTUS CDS 228118 228749 0.92 - 2 transcript_id "g184.t1"; gene_id "g184"; Scaffold_24 AUGUSTUS CDS 228846 230259 0.77 - 0 transcript_id "g184.t1"; gene_id "g184"; Scaffold_24 AUGUSTUS start_codon 230257 230259 . - 0 transcript_id "g184.t1"; gene_id "g184"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESF # LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTL # GLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKS # TAKHRIRWIQRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPK # PIRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESGNERKE # RPRTRRTRRRMFRQM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g184 ### # start gene g185 Scaffold_24 AUGUSTUS gene 231321 231749 0.8 - . g185 Scaffold_24 AUGUSTUS transcript 231321 231749 0.8 - . g185.t1 Scaffold_24 AUGUSTUS stop_codon 231321 231323 . - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_24 AUGUSTUS CDS 231321 231749 0.8 - 0 transcript_id "g185.t1"; gene_id "g185"; Scaffold_24 AUGUSTUS start_codon 231747 231749 . - 0 transcript_id "g185.t1"; gene_id "g185"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDINPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTR # QALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQMRDLQTPLRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g185 ### # # ----- prediction on sequence number 8 (length = 344103, name = Scaffold_22) ----- # # Predicted genes for sequence number 8 on both strands # start gene g186 Scaffold_22 AUGUSTUS gene 2795 3160 1 + . g186 Scaffold_22 AUGUSTUS transcript 2795 3160 1 + . g186.t1 Scaffold_22 AUGUSTUS start_codon 2795 2797 . + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_22 AUGUSTUS CDS 2795 3160 1 + 0 transcript_id "g186.t1"; gene_id "g186"; Scaffold_22 AUGUSTUS stop_codon 3158 3160 . + 0 transcript_id "g186.t1"; gene_id "g186"; # protein sequence = [MGPVKEEAIGIETIVTASKPATSSSGSTTTKYATPPTTASWVQGTTWNDEDTNSPQLKGFSSLLSDQPGELDELDIGL # VRPDEQWNYETTTDDHMDIPFPVPLSGSKFDGKRKGKGKDLGW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g186 ### # start gene g187 Scaffold_22 AUGUSTUS gene 4304 5500 0.41 + . g187 Scaffold_22 AUGUSTUS transcript 4304 5500 0.41 + . g187.t1 Scaffold_22 AUGUSTUS start_codon 4304 4306 . + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_22 AUGUSTUS CDS 4304 5500 0.41 + 0 transcript_id "g187.t1"; gene_id "g187"; Scaffold_22 AUGUSTUS stop_codon 5498 5500 . + 0 transcript_id "g187.t1"; gene_id "g187"; # protein sequence = [MTVNGLPDNYEGHCKILLNDRSDLVSTRNILILYALLRHGNPPELAAETAVHLMYSAALRSSDSSELFHCIKTVYGDV # MSVYQSPMFVSFISRLSPNDVRKKSFPIRGAGSLSIAQSAVKIFGEPLAMLRATHTLNDSRKAMHDVMLSPHRVDYRDRYLSGLQPSHRLSFLRFRES # GVLLHFADHVGSETFQDPNRYVSFLASSSSSLRLPFFRLLFTASGKWVTMDNANPLSSWDVNEVLKTGQAYGLDHADIYGCLFFHVKAQFTEFARRVE # KFHIDIHVSQLDAHVASGLLQKGELNPDLFGINPAFDRIETSNIADYAGIPSVLQDWSAVLNRENKHAVVLVYLMNWVMKRPGASFGMMGEGMGLNLK # GSTNVKVLLERTSSMLVRLNSYEFLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g187 ### # start gene g188 Scaffold_22 AUGUSTUS gene 7389 8241 0.86 - . g188 Scaffold_22 AUGUSTUS transcript 7389 8241 0.86 - . g188.t1 Scaffold_22 AUGUSTUS stop_codon 7389 7391 . - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_22 AUGUSTUS CDS 7389 7592 0.93 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_22 AUGUSTUS CDS 7651 8241 0.86 - 0 transcript_id "g188.t1"; gene_id "g188"; Scaffold_22 AUGUSTUS start_codon 8239 8241 . - 0 transcript_id "g188.t1"; gene_id "g188"; # protein sequence = [MDMLRHPTHSQRIKSIALIAEGVPERHSREILYEAQQKGVLIIGPATVGGIKPGCFRIGNSGGMMDNIIASKLYRAGS # VGYVSKSGGMSNELNNILSFTTNGVYEGIAIGGDRYPGSTFIDHLLRYEKDPECKLMVLLGEVGGVEEYRVIEAVKQGKITKPIVAWAIGTCAGMFKT # EVQFGHAGSLAGSDVETAEAKNRAMAAAGFIVPPTFEDLPDTISKLYQSLVQKGTIVPQVERDPPVIPMDYKWATELGMFFDVPGPIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g188 ### # start gene g189 Scaffold_22 AUGUSTUS gene 8844 9464 0.6 - . g189 Scaffold_22 AUGUSTUS transcript 8844 9464 0.6 - . g189.t1 Scaffold_22 AUGUSTUS stop_codon 8844 8846 . - 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_22 AUGUSTUS CDS 8844 9464 0.6 - 0 transcript_id "g189.t1"; gene_id "g189"; Scaffold_22 AUGUSTUS start_codon 9462 9464 . - 0 transcript_id "g189.t1"; gene_id "g189"; # protein sequence = [MAAKLDQTAESIVGQKWAIARDLAIYEGIASSGSGKVTADRGPPMAFPAPFGRSLTKEEAYIQKLDASTGASLKLTVL # NAEGRVWTMVAGGGASVVYSDAIAAAGFANELANYGEYSGAPTEGQTYEYAKTVIDLMTRGAVNEQGKILIIGGGIANFTNVAATFKGIIRALKEYKS # PLIRAKVSIYVRRGGPNYQEGLKVCTTYNC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g189 ### # start gene g190 Scaffold_22 AUGUSTUS gene 18983 19687 0.89 - . g190 Scaffold_22 AUGUSTUS transcript 18983 19687 0.89 - . g190.t1 Scaffold_22 AUGUSTUS stop_codon 18983 18985 . - 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_22 AUGUSTUS CDS 18983 19687 0.89 - 0 transcript_id "g190.t1"; gene_id "g190"; Scaffold_22 AUGUSTUS start_codon 19685 19687 . - 0 transcript_id "g190.t1"; gene_id "g190"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTYRSYYPC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g190 ### # start gene g191 Scaffold_22 AUGUSTUS gene 21859 22452 0.54 - . g191 Scaffold_22 AUGUSTUS transcript 21859 22452 0.54 - . g191.t1 Scaffold_22 AUGUSTUS stop_codon 21859 21861 . - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_22 AUGUSTUS CDS 21859 22452 0.54 - 0 transcript_id "g191.t1"; gene_id "g191"; Scaffold_22 AUGUSTUS start_codon 22450 22452 . - 0 transcript_id "g191.t1"; gene_id "g191"; # protein sequence = [MAKLSSVPQSSTFISQALVPFHSVSSMEKLVLQGFAESMSTLSAVIQRLILLAEVELSNLERLEDHLSLIHEIVSRED # SSISSAKAELLGEIWTWLGGNQRELRGHNAHLELLHGISSYRKQALAHVVSALQILRALSDDMEDMRERMVMPELVGSQIPLEVQVSSIQHGLQRLRD # SKALAQEREDGALRKVAIMEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g191 ### # start gene g192 Scaffold_22 AUGUSTUS gene 26086 27027 0.86 + . g192 Scaffold_22 AUGUSTUS transcript 26086 27027 0.86 + . g192.t1 Scaffold_22 AUGUSTUS start_codon 26086 26088 . + 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_22 AUGUSTUS CDS 26086 26110 0.89 + 0 transcript_id "g192.t1"; gene_id "g192"; Scaffold_22 AUGUSTUS CDS 26216 27027 0.95 + 2 transcript_id "g192.t1"; gene_id "g192"; Scaffold_22 AUGUSTUS stop_codon 27025 27027 . + 0 transcript_id "g192.t1"; gene_id "g192"; # protein sequence = [MSLQSMDQICEKPRLILFYVLSDHENQSGTLTSRTVARGPEMFRHHKESTSNATPTVIVSLPESQSSDGPTVATGRMP # PSMAGSDTGTPSVNSSAFGHGTHTAPSSGPPSLSNQSSQLKPTPSVNTTTLDGDHTMKRFKALDGTVRRQYPASTGGTGESASNNIEAGSKKRKAPDN # GPDSGTGIRENSQPQLAHPATYSHLNMSTPSNNLPSRSSPLPPIAYPQRDISTPPATNLLYPNAVAHAGPSSNFYHPPAAGSYSHQNPSAPSTPSDES # RHFK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g192 ### # start gene g193 Scaffold_22 AUGUSTUS gene 29154 30203 0.38 + . g193 Scaffold_22 AUGUSTUS transcript 29154 30203 0.38 + . g193.t1 Scaffold_22 AUGUSTUS start_codon 29154 29156 . + 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_22 AUGUSTUS CDS 29154 30203 0.38 + 0 transcript_id "g193.t1"; gene_id "g193"; Scaffold_22 AUGUSTUS stop_codon 30201 30203 . + 0 transcript_id "g193.t1"; gene_id "g193"; # protein sequence = [MHNRRDIAPHLERSYDPVLPAHGKVRDIWESNYLRTFLGPDGKNLFLSPDNHNESRLVFNLNEDGFNPYGNRMAGKKA # SVGGIYLVCLNLPPQIRLKPENIFLVGVIPGPKEPSAHQINYILRPLVNDLVQLWEDGIFMARTHRHLHGRSARAALVLLVCDMPAARLLAGFAHYSS # SSDPCSMCKSSNLNDLDTQSFVPRNNEEHRRDAHAWLVAQSEAERDILFRRNGVRWSELLRLEYWDVVQNTVIDPMHGFYLRIFQRHCRQIWGMNVEL # VDCDGLWEMKLPTDEGKANARNTFEHGSTGNIRALKLDALRYLAIQEGLDYRRNKKVLADSLIQLVNTVSIQLAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g193 ### # start gene g194 Scaffold_22 AUGUSTUS gene 30929 31390 0.76 + . g194 Scaffold_22 AUGUSTUS transcript 30929 31390 0.76 + . g194.t1 Scaffold_22 AUGUSTUS start_codon 30929 30931 . + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_22 AUGUSTUS CDS 30929 31390 0.76 + 0 transcript_id "g194.t1"; gene_id "g194"; Scaffold_22 AUGUSTUS stop_codon 31388 31390 . + 0 transcript_id "g194.t1"; gene_id "g194"; # protein sequence = [MILQQKVEVLTQRCVCLLLTKCSSLYIDKFAHSGKPDYDEYLRLFFNATKSQIDHYPRRILDSIHNAVKLWKNSSTHV # RRNPSSEAVQPQDETDDFFEANSDGSLDYEPYDLDDYDLSSYRLEEDEEDEEGETPIPSTNKEKRDLLHNIVREL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g194 ### # start gene g195 Scaffold_22 AUGUSTUS gene 32064 32837 0.54 + . g195 Scaffold_22 AUGUSTUS transcript 32064 32837 0.54 + . g195.t1 Scaffold_22 AUGUSTUS start_codon 32064 32066 . + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_22 AUGUSTUS CDS 32064 32837 0.54 + 0 transcript_id "g195.t1"; gene_id "g195"; Scaffold_22 AUGUSTUS stop_codon 32835 32837 . + 0 transcript_id "g195.t1"; gene_id "g195"; # protein sequence = [MLPPDEMEKTMFTRFCMMQRLKSLFHGQAFSTMAHSLVTLYQETFEDLDPRGTRINDALAFEEIDSDSVSDWPISSLT # RLDAPTYHKVLQYESPGKWSTSVRIHNKFKQRGLTFAPQHRSFADAQVVYNTGTAELWSAGSIKRIFTATNTKDSADGKRFCKTFIEVYPYRPLTESD # ARYDKCRTFGFAGGRLFYDSTEKETRLLPLEEISSHFGYSVQSSPSIDSPIMHALPLNKVRLPSLNTLITRFHLSHRMVNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g195 ### # start gene g196 Scaffold_22 AUGUSTUS gene 35731 39694 0.38 + . g196 Scaffold_22 AUGUSTUS transcript 35731 39694 0.38 + . g196.t1 Scaffold_22 AUGUSTUS start_codon 35731 35733 . + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_22 AUGUSTUS CDS 35731 37993 0.88 + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_22 AUGUSTUS CDS 38070 38515 0.47 + 2 transcript_id "g196.t1"; gene_id "g196"; Scaffold_22 AUGUSTUS CDS 38592 39200 0.74 + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_22 AUGUSTUS CDS 39251 39694 0.81 + 0 transcript_id "g196.t1"; gene_id "g196"; Scaffold_22 AUGUSTUS stop_codon 39692 39694 . + 0 transcript_id "g196.t1"; gene_id "g196"; # protein sequence = [MSSAHASHFSDPQVPDAPVNHHHHQVVGTTHLLGDTSSSLTQDDSHPATHETQSMFEDVSEMEEEPVSEFRGAVAPKS # CLKDEVPASSSTETPTELSLVENVRNFDAQDNVAVFSDYTDASLIAPSSSFPVDQSNCVRSETPTELSHMEDMRNFDAQDNDVATMPSDYTDASFIAP # SSFFPIDQSNYLRAEVESNANIIPVSYGRHSPGSPFATEKVESVGCPQNSIEFSAAGSENEMQHYGHVLSDSSGNLSPPLFPLDDGRADSTATRFYVE # EGLSAETAPSVGCSQNFIEFVSAENDSGYPEQVPSPHGDAFHDLSTVELEAREEEAKDAAAELLEEGFGTEVGVDSDEYHCRPFHQHPDFEERETGEQ # EALGTSDGGEQNALALASDLHFPNPIVENDYWNNIRSQIHVDAVHGHDAGYMDSTIDQESGPREFDTPTVPFDIPPSVSLQRNDEDQEALVLNKNNNE # WTGSPGEFDNSAVPFDVPSLIPCRSNDEDHEAPIVNNDEGWISGPRGFDNSAVSFDDPSLIPHQSNDIDHPVPDNDPGWISGPRNIPAVPLEYPPWIF # FQGDNTDGFTTNHNSDPRRLDTSAENGSRAPIRGNDAGWMDHRDVPQHPITVTGEYDTGRGCGEDNDMGMNDLYDSLGLDEHLPSNPAPPPRPVVTIE # EIEDPDAPPNPFNNLGLDEPIIRPVTAMDKHDPRYFPNQPSRHEYFYSSDRDFPPEESNRDSNVEVFDGDTVRGNIEDNDVGMNDLYDKDPDAHPNPF # NNLGLDEPIIRPVTAMDKHDPRYFQSPPSRHEYFYSSDRDFPPEEPNVDSMGKVFDGEGDIEMEDNVLGDGLHAGGDNNIPRQFDAIDENYLRGLSPL # TEIPDIPKPENYMLYNEEEALTSIRRVLSSLIQNDIKSSSMMDDPNIDLEKLKAILDRCYRYVGALPDQIPPTSTSPKHSSDDEHLSTDLPAPKLFKA # PKHRTEGQNYLAELIRYEAGLLLGTLAVDESRAEPLFSTGKLLTTVLRGTIKDFKDSRHDGPSVEHFVLQLDIGRKTPWNKAAAEVFCKHFRSKEGHE # NYRTKDVYKAFMAHLTQLKRDYARQGREKSTQERDDERRARRLARRHTLLKRRIDMFYRIYRYHRGPLGELSRFIKRLTPECVSGDETGPDGKTYYKT # KVEWRSQELTDFLDLLSSWYTCERYLGGGKYSPGELPRPRYPSNRVDTVLIPEAAPSQLPINWYNSAWLEEYEERQMYCPHYPRFPCICPTPSNGTP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g196 ### # start gene g197 Scaffold_22 AUGUSTUS gene 56715 58014 0.43 + . g197 Scaffold_22 AUGUSTUS transcript 56715 58014 0.43 + . g197.t1 Scaffold_22 AUGUSTUS start_codon 56715 56717 . + 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_22 AUGUSTUS CDS 56715 56962 0.46 + 0 transcript_id "g197.t1"; gene_id "g197"; Scaffold_22 AUGUSTUS CDS 57058 57339 0.86 + 1 transcript_id "g197.t1"; gene_id "g197"; Scaffold_22 AUGUSTUS CDS 57399 58014 0.98 + 1 transcript_id "g197.t1"; gene_id "g197"; Scaffold_22 AUGUSTUS stop_codon 58012 58014 . + 0 transcript_id "g197.t1"; gene_id "g197"; # protein sequence = [MEKFRAKTYEVPNLNILDEATTHLLDLGGVKLRLLGLGGAVVPHKMFDNGDGSATIAGGQGTMWTTTLQLGELVDTAQ # RVHDPAGLHFRYSTSWNEFSVLADYEGFRRKLLLGKETFDKVWESVKAQVDVVVDENQRVLLDKALNVVERIPPPIGPGGAPTGVTTAKEALAAQDEP # ICERGQSQRGVEKSRLVTSKHLILLHYVNSSSLGFNYAYRRSATVPATPTSANPSNTLSPNHKPSSKSATPAPKVVSPVPPSTVHSKPATPAPVPPNS # SNTIGRTNAVATTSISNQAVDRAVPPHLAGKGSTGTSSKAASGTGTPSSEPRDQKEGVKGEKEGDQDGSGAKDKETAKLEKAERDKQKRKEKKERNRE # KAAGGSSRW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g197 ### # start gene g198 Scaffold_22 AUGUSTUS gene 62229 63003 0.26 - . g198 Scaffold_22 AUGUSTUS transcript 62229 63003 0.26 - . g198.t1 Scaffold_22 AUGUSTUS stop_codon 62229 62231 . - 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_22 AUGUSTUS CDS 62229 62318 0.84 - 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_22 AUGUSTUS CDS 62369 62604 0.31 - 2 transcript_id "g198.t1"; gene_id "g198"; Scaffold_22 AUGUSTUS CDS 62665 62867 0.9 - 1 transcript_id "g198.t1"; gene_id "g198"; Scaffold_22 AUGUSTUS CDS 62987 63003 0.81 - 0 transcript_id "g198.t1"; gene_id "g198"; Scaffold_22 AUGUSTUS start_codon 63001 63003 . - 0 transcript_id "g198.t1"; gene_id "g198"; # protein sequence = [MVVLREKLIPACYSIAATGVPVFAWKGETEDEYNWCIEQTIKGFSGGQPLNMILDDGGDLTTMVHEKFPELLPGIRGI # SEETTTGVHHLYKAFREGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAESLRSYGARVLITEIDPINALQ # AAMAG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g198 ### # start gene g199 Scaffold_22 AUGUSTUS gene 65294 66148 0.54 + . g199 Scaffold_22 AUGUSTUS transcript 65294 66148 0.54 + . g199.t1 Scaffold_22 AUGUSTUS start_codon 65294 65296 . + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_22 AUGUSTUS CDS 65294 66148 0.54 + 0 transcript_id "g199.t1"; gene_id "g199"; Scaffold_22 AUGUSTUS stop_codon 66146 66148 . + 0 transcript_id "g199.t1"; gene_id "g199"; # protein sequence = [MSPQQSDVQLASMSWHQSQMSINETSDLSLYPGVAGDIPYHYSSDADHGGFPSGTPSSSTAIYSYDDTTTPIGDATTY # NDSTSHSLSSVECLHRKIAELEERHHHDQEHIRVLQAQLASSSSRNTDYPYSPPASAFFKASWAARTTARTKYLCSLNRAGNALCAWHDSRRERRAYP # PRNAPRDTLNCGCTYEEALFEESLSRHKVGSYLPGESVRMDPALRNPLLQLLKHRYGYQDGDFERDPFTGDWVSEDGHEEGHEHWERLLASGVNPRRA # RGEQHRNTPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g199 ### # start gene g200 Scaffold_22 AUGUSTUS gene 66653 67898 0.35 + . g200 Scaffold_22 AUGUSTUS transcript 66653 67898 0.35 + . g200.t1 Scaffold_22 AUGUSTUS start_codon 66653 66655 . + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_22 AUGUSTUS CDS 66653 66859 0.46 + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_22 AUGUSTUS CDS 66914 67393 0.87 + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_22 AUGUSTUS CDS 67464 67898 0.8 + 0 transcript_id "g200.t1"; gene_id "g200"; Scaffold_22 AUGUSTUS stop_codon 67896 67898 . + 0 transcript_id "g200.t1"; gene_id "g200"; # protein sequence = [MDKLIDILAAFDAGKLPSHHQVDNFLEWLKKDIISDGAFSTQGHIVAQRLRDVATAYQLLGEHKNSKLLEAIWHLSQG # DLSDTSVDVNIKPNTDEVLKDAQDARESIRTILSIIWSGLSSEGSSLFEDFTSFARLSLADAAEVVENQASRAKDSLREVDDEVQSGKRDTLGRDKER # LKQEEDLQVAFEHGMDTVKGAGSSVIGAGQQSVAKASELSDRTSAKLHNAFYKNDEEYHRSLDTLFSTVQKWISRGFNSATNASSSLDSLVDDNTTDK # HITKALQAIETLLSRLAHTDSLSKLVSTIRKCAVDIRDDQDLRSWFDDFFTHLRRDLDEPGYIRSDENNVFVKIFVPGGKTCSTKTPSLDGPGRMMWK # Q] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g200 ### # start gene g201 Scaffold_22 AUGUSTUS gene 68509 69393 1 + . g201 Scaffold_22 AUGUSTUS transcript 68509 69393 1 + . g201.t1 Scaffold_22 AUGUSTUS start_codon 68509 68511 . + 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_22 AUGUSTUS CDS 68509 69393 1 + 0 transcript_id "g201.t1"; gene_id "g201"; Scaffold_22 AUGUSTUS stop_codon 69391 69393 . + 0 transcript_id "g201.t1"; gene_id "g201"; # protein sequence = [MRLIPASATTTLAPVSSSASRNAKVTPGSSLTNHPVPAPLATATKTVSQRSLHRAFHVIEHLDVRITDEFELDIKDSN # HGVMIAMFKPIMALRLKSALEGFVAEHLRQIFEGLDGLAYDISERAEIFKDTGLGSGASIGAAVWSEVGRMRRLGLDSRRRGQYTDWQATGTGVVAAE # RQVDLETGEDKERERKFAMGAEPQILSGEKKGPDGTASESLSKRLRSATGQALDDTGVNVDAEAMPDVTDTKQIAEQAKEIFEEGKDQVKSFKDTVKH # KSDVEKHREGWQSSSFDIKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g201 ### # start gene g202 Scaffold_22 AUGUSTUS gene 75747 77285 0.97 + . g202 Scaffold_22 AUGUSTUS transcript 75747 77285 0.97 + . g202.t1 Scaffold_22 AUGUSTUS start_codon 75747 75749 . + 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_22 AUGUSTUS CDS 75747 77285 0.97 + 0 transcript_id "g202.t1"; gene_id "g202"; Scaffold_22 AUGUSTUS stop_codon 77283 77285 . + 0 transcript_id "g202.t1"; gene_id "g202"; # protein sequence = [MATIHDHIRVKFGAGFSVQEVITGFETPWLYVNNIPSNVSQDEVTQLLSKHGTVQDFRSETGNQRGTLRVRVRFSSDI # EARNANIILNGTRQWGSLISTQLPVNTAHGRGATLQNTAVRIEWEAPSIIGYAGYPTEERAKEAIAIAKTAYYDTYISAHMYSGLPQMAAYTVRFLNL # PVDTKKEQMSKYSKPLDMMWDVPNYTSVDEVATFLRRKLESNGIDIISFEVLPPPYRDGRVKAWVHFPTPVAAKAACQLLHLRKPICTGRTRIFAYHV # QSLSYSILLEHYKKIQDDILFFRERLRREVQGTTFTVIPGASSVTIRLSAINGKDLGNLKAEFEHLRGGEVVKHDGEVLWDRFFGLPAGKSYLRRLEI # AHLGIAIREDAMRRRLTLFGQSALREVVKAALTEKHNELLVAEKRCLFLGPLIGPFIHSEFGSLSQRLGPEKVVLDMWNRQLVVSGKDHDFRVALQAV # QKSNADSIPICNATLHLVLSVLGRSIVQSLFPSASTVIAVLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g202 ### # start gene g203 Scaffold_22 AUGUSTUS gene 79756 81146 1 - . g203 Scaffold_22 AUGUSTUS transcript 79756 81146 1 - . g203.t1 Scaffold_22 AUGUSTUS stop_codon 79756 79758 . - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_22 AUGUSTUS CDS 79756 80524 1 - 1 transcript_id "g203.t1"; gene_id "g203"; Scaffold_22 AUGUSTUS CDS 80593 81146 1 - 0 transcript_id "g203.t1"; gene_id "g203"; Scaffold_22 AUGUSTUS start_codon 81144 81146 . - 0 transcript_id "g203.t1"; gene_id "g203"; # protein sequence = [MGRRSGGLGLRVNAKRASVSKRLSKSSEVQNFIPENAPVQQDSVLNATSSAPVTTTVLDTDISKPSADQPSSSLHPDS # TKLNVTVVEPTVVTEAPVQKVVQFIPKFKGAAEMEARRRIRMAGMAARRGFTNGEPAPSVEPVRPDPTLDDTSSEEDVVHIADDDSPDSDFDQVDNDS # MDDGDEFDPDFAATRPVNSDSASDISNSLPSINSSVPLATSARPRLSPVSEGGDTSEAPARSATTDTEAAVTSKVPTVSNPIRRPNAVPFSKISSHTT # SSGSLSQHSSSNHNLISFSRKPVTPIRPFPSALTAMLGATSNTSNPFAELYAAISGRGEAAATNVSVFFPHAREPRGKAMELNVRKDATVEEVIGFAL # WNYWEEAWLPKLDQGIPEGEEGQQARETRLSAIGWVLRLTEDDGEVDDDFPRMPFIHLLNPNLALAQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g203 ### # start gene g204 Scaffold_22 AUGUSTUS gene 81581 82667 0.81 + . g204 Scaffold_22 AUGUSTUS transcript 81581 82667 0.81 + . g204.t1 Scaffold_22 AUGUSTUS start_codon 81581 81583 . + 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_22 AUGUSTUS CDS 81581 81868 0.81 + 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_22 AUGUSTUS CDS 81936 82667 1 + 0 transcript_id "g204.t1"; gene_id "g204"; Scaffold_22 AUGUSTUS stop_codon 82665 82667 . + 0 transcript_id "g204.t1"; gene_id "g204"; # protein sequence = [MASNQLPQHDHRRPAMISELAARASQNDWNENGAFKYFLRLAERYRKEAKEAVARNDLEEAFVAFARSATIVLEILPV # HRDYLTSLSNAQRNNLTLNGQELLENLGHLKRILLERFDDWQAQHPDRGDTPPPTLAQLQQEQQMEHDRTVAEEARRSQQEADLVRRGQVEQPRHPPP # PPDHATNSAVPFAQSAQGISSMELSQRHQRQQEEMQSRSQELMRRKQEEKLRTHASSPSISSTTGTSSGSSMTMPTPSIAATSSAPSLSSSATMYHAA # SKQSAVSFQPPPVSHPNMYRSISQQAPTILPLENPSRFEDDSTDSEQDSRTATQRYATPTKSTRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g204 ### # start gene g205 Scaffold_22 AUGUSTUS gene 82744 83358 0.54 + . g205 Scaffold_22 AUGUSTUS transcript 82744 83358 0.54 + . g205.t1 Scaffold_22 AUGUSTUS start_codon 82744 82746 . + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_22 AUGUSTUS CDS 82744 83358 0.54 + 0 transcript_id "g205.t1"; gene_id "g205"; Scaffold_22 AUGUSTUS stop_codon 83356 83358 . + 0 transcript_id "g205.t1"; gene_id "g205"; # protein sequence = [MSPPPPDRIEYPKLMNVHQKTQGYRPSQDSMFTQTWNRDHYSLSDAYSHPQRENYHPLPRPPSQPPYTGPNQSAPAPP # IPTETKPSLTPSGASETSNGLKIVHLPRDCLNRFLTIAKVNTARDRETCGLLLGKDRGSKFVVTTLLIPKQHSTSDTCTMDEEELILQVTEERGLITL # GWVSSKFSCQVRLKLKSPLDSYTSLSVM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g205 ### # start gene g206 Scaffold_22 AUGUSTUS gene 87074 87946 0.88 + . g206 Scaffold_22 AUGUSTUS transcript 87074 87946 0.88 + . g206.t1 Scaffold_22 AUGUSTUS start_codon 87074 87076 . + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_22 AUGUSTUS CDS 87074 87946 0.88 + 0 transcript_id "g206.t1"; gene_id "g206"; Scaffold_22 AUGUSTUS stop_codon 87944 87946 . + 0 transcript_id "g206.t1"; gene_id "g206"; # protein sequence = [MDNYRLCATVTEHDAKKAGAEVVKQVESPLLSGLLYPGLQALDEQYLDVDFQFGGVDQVRLLATRSFGQLTIIYQRKI # FTFAELYLPRLGYRKRAHLMNAMVPGLMGGKMSSSDPNSKIDFLDSPEIVKKKIKGAFCEPGNVEDNGLLSFAEAVIFPISQLKIDQAKGTGVMDEDG # KEALSTDQRSFASDNAPEGTLFTVNTKFDGPMHFSTFEDLRQAFKDEKLHPGDLKPAMVDAINRLLDPIRKAFGESEEFRQTEQLAYPDPNAKQPAKK # KKVGVVSNLWIHILNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g206 ### # start gene g207 Scaffold_22 AUGUSTUS gene 88401 89527 0.45 - . g207 Scaffold_22 AUGUSTUS transcript 88401 89527 0.45 - . g207.t1 Scaffold_22 AUGUSTUS stop_codon 88401 88403 . - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_22 AUGUSTUS CDS 88401 88718 0.82 - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_22 AUGUSTUS CDS 88772 88817 0.84 - 1 transcript_id "g207.t1"; gene_id "g207"; Scaffold_22 AUGUSTUS CDS 88914 89527 0.63 - 0 transcript_id "g207.t1"; gene_id "g207"; Scaffold_22 AUGUSTUS start_codon 89525 89527 . - 0 transcript_id "g207.t1"; gene_id "g207"; # protein sequence = [MDAATLATTTPNSRKRNRENETPSQRIKREKAAERQRRKRERDRLGIPVNYVHPPPQRNPANSVVVSQPPPPPPPPPP # PAPIADPNLNNGPSNLIEPDLTPEEEARRDRVRAAARERQRKHRALVKQRKMRELGMDMGNDISGSIQAPSSEEQGDMAYPVDAQAGFHATMISPPPP # GIVQQSLNDDNNESSFTHNLATQGHGGQILEPIIADAWDQWDRQRRQQHQQPFDASQYSSQHSFVQNPPNATPQDVSATSAANEFRARFHRSLVVPTP # FQAQAAAAAAAVAQAQANAVAHAAQVAQSTVSGSMNGMTDEDGGPVKGDHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g207 ### # start gene g208 Scaffold_22 AUGUSTUS gene 91014 91637 0.84 - . g208 Scaffold_22 AUGUSTUS transcript 91014 91637 0.84 - . g208.t1 Scaffold_22 AUGUSTUS stop_codon 91014 91016 . - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_22 AUGUSTUS CDS 91014 91637 0.84 - 0 transcript_id "g208.t1"; gene_id "g208"; Scaffold_22 AUGUSTUS start_codon 91635 91637 . - 0 transcript_id "g208.t1"; gene_id "g208"; # protein sequence = [MDSPYGTHDHTVSRKRDHGMESVCAFPNGTDGGIYIVKLQLDIEEKGEKLQTYMHQLILIHQVEIHYDEGVNEGQNIS # RAEAEYPTAINLWVGVAEGDAIVCVECKSFKVLFKKEVAFFILIPCISTDEALVEFIERAVPSKLGPWCPKREVGLAMNMTPIKLNSPAKISFLPTVS # PRNNAPATAVQSGERKVRTVASERERNFREK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g208 ### # start gene g209 Scaffold_22 AUGUSTUS gene 102301 104177 0.35 - . g209 Scaffold_22 AUGUSTUS transcript 102301 104177 0.35 - . g209.t1 Scaffold_22 AUGUSTUS stop_codon 102301 102303 . - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_22 AUGUSTUS CDS 102301 102756 0.84 - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_22 AUGUSTUS CDS 102861 102894 0.36 - 1 transcript_id "g209.t1"; gene_id "g209"; Scaffold_22 AUGUSTUS CDS 103168 104177 0.55 - 0 transcript_id "g209.t1"; gene_id "g209"; Scaffold_22 AUGUSTUS start_codon 104175 104177 . - 0 transcript_id "g209.t1"; gene_id "g209"; # protein sequence = [MIPEKNVDTTEQKFFSRAIQEEEIEEAKAHIAMKNLDSSVGVDQVDYKLIMKIPNENCVKLLNHCIENRTAPSQMASC # IGSGHTETGKEADDPSSYRLVVLECCFLKMLTLIIDRRLREYAEHQDLLPSTQNGFRPGYRTTNNPLFSKTMVDTAKAIGKPLYVAYMDWTHAFPLTN # RPMMWMKLNKMGIRGPLIDWLRLMYQKLGNVVQVADSFSEAFTSNIGAWTGDPGTPMLFNLAIADFRLSEHPGDVVLYDKVVNHTEQADDVLMTTMCP # TSYQSKLNQFGEYSAQTGFIASVPKCVYAVYGKEETEGLPFTLYGKREEKRDDWTGTADRVDMPMANSILKNYSSYGNGTSVRQATSQGGRNIPRFKD # LTVQHIDGVMERVKKSMEKDIQEKVDTSNKTRDVLRDRREYDKKTKKMVIKTMAFRHYLRIPIGEHRRSLIDMVTSNHKLAVERLRWAERNKPMVQHD # KRLCRMCREKVEDGAHVCLNAATAARSYS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g209 ### # start gene g210 Scaffold_22 AUGUSTUS gene 108010 109176 0.92 + . g210 Scaffold_22 AUGUSTUS transcript 108010 109176 0.92 + . g210.t1 Scaffold_22 AUGUSTUS start_codon 108010 108012 . + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_22 AUGUSTUS CDS 108010 109176 0.92 + 0 transcript_id "g210.t1"; gene_id "g210"; Scaffold_22 AUGUSTUS stop_codon 109174 109176 . + 0 transcript_id "g210.t1"; gene_id "g210"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g210 ### # start gene g211 Scaffold_22 AUGUSTUS gene 109227 111839 0.9 + . g211 Scaffold_22 AUGUSTUS transcript 109227 111839 0.9 + . g211.t1 Scaffold_22 AUGUSTUS start_codon 109227 109229 . + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_22 AUGUSTUS CDS 109227 111839 0.9 + 0 transcript_id "g211.t1"; gene_id "g211"; Scaffold_22 AUGUSTUS stop_codon 111837 111839 . + 0 transcript_id "g211.t1"; gene_id "g211"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEETMGWSTTEVEYTYQQTTTYALRYSVNATTIQLQDTPDYTGHSTWSVPISGGLRCALLWKNTLRDARFVPVR # RSSDTHGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g211 ### # start gene g212 Scaffold_22 AUGUSTUS gene 113395 114204 1 - . g212 Scaffold_22 AUGUSTUS transcript 113395 114204 1 - . g212.t1 Scaffold_22 AUGUSTUS stop_codon 113395 113397 . - 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_22 AUGUSTUS CDS 113395 114204 1 - 0 transcript_id "g212.t1"; gene_id "g212"; Scaffold_22 AUGUSTUS start_codon 114202 114204 . - 0 transcript_id "g212.t1"; gene_id "g212"; # protein sequence = [MSSPPETDKRGLSALTNQEQGALSTEGFDGPANGVLQTEWTVGEDRGSEDKQGPAGSEETDDRRATPEAKTVGEGLVK # DGGHEEDTSSSVEGGRRVGESFNGSADTAGTVVESPKKTKKKAGAQAAPKVKARTARKSEVGGEKGTSDVKQKPRTRGLTASPAARTLPSTMSAATID # HDESGDEPLATSLLLSPMSEAPEATVDPLGNATMEARVEKEYGIDLDMSSVSKVVQVASKLKKTTIAVGGWQMEMLSRSGRGGVTNGAGKRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g212 ### # start gene g213 Scaffold_22 AUGUSTUS gene 115788 116531 0.77 + . g213 Scaffold_22 AUGUSTUS transcript 115788 116531 0.77 + . g213.t1 Scaffold_22 AUGUSTUS start_codon 115788 115790 . + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_22 AUGUSTUS CDS 115788 116531 0.77 + 0 transcript_id "g213.t1"; gene_id "g213"; Scaffold_22 AUGUSTUS stop_codon 116529 116531 . + 0 transcript_id "g213.t1"; gene_id "g213"; # protein sequence = [MDLVLTKLLLLQLRRVHSLFSVQPASSTASSDPQSIPTQGLLEQDVGPGSPSPNIMLPEIPLLSSFHFPSYALMTPVT # EEVKTLCVKNSHLVDSSNTVSSTSKSFSFPSLVVTSNEVSGSVEQGSDSLNNAQAQLGDNSNVKYNKSASEALDIAEVDALLLSSSNLSCSTKVIRNG # EESLDAAEVDGLLMTFNTTAASNSFDRLSLTSTQASQSVNISNTSTHLSFFTASPSTPSLSSSSVLSSPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g213 ### # start gene g214 Scaffold_22 AUGUSTUS gene 120370 121071 0.96 - . g214 Scaffold_22 AUGUSTUS transcript 120370 121071 0.96 - . g214.t1 Scaffold_22 AUGUSTUS stop_codon 120370 120372 . - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_22 AUGUSTUS CDS 120370 121071 0.96 - 0 transcript_id "g214.t1"; gene_id "g214"; Scaffold_22 AUGUSTUS start_codon 121069 121071 . - 0 transcript_id "g214.t1"; gene_id "g214"; # protein sequence = [MVLRRVGGKEDGGVDLNGWWWLPDGATDTDSTLQLASSNTNDDVQSSAYPFKRIRIIAQCKAEKKKIGPKYVRELEGV # VWRYMALEKDDDSGNVPKESTPVVAVFLSESPFTKSTVLRAMSSQVPFLLVYVPPLADSTHKFEETDSSSASSPGSCIYNPALGASGGLFKGEMEIRW # CWSLPTLTHLPSHSKPASQRGSHGAPALFFRGKRLRGWVPPGVHERREEVGNSFHDP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g214 ### # start gene g215 Scaffold_22 AUGUSTUS gene 122303 122974 0.51 - . g215 Scaffold_22 AUGUSTUS transcript 122303 122974 0.51 - . g215.t1 Scaffold_22 AUGUSTUS stop_codon 122303 122305 . - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_22 AUGUSTUS CDS 122303 122974 0.51 - 0 transcript_id "g215.t1"; gene_id "g215"; Scaffold_22 AUGUSTUS start_codon 122972 122974 . - 0 transcript_id "g215.t1"; gene_id "g215"; # protein sequence = [MPHPAVAAIIGSAVGGTIFLILIIALVLWYRHYKRRPRMLKQYVSSSRSWDYGQDETRIEPFPLQPLRRLPLESHSTN # NLNPQRSETSVTYPSTIITGVTGSSYHMTSEGYSSPPALDANFALPATTVRFAENTTTSETSSNSRSRNRRVDTATPSSRAGRSSRRANNGSTATSSS # APSSTHSSRKREIRELRRTVEDLKRQQQEMLARLPPSYTDISNQGLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g215 ### # start gene g216 Scaffold_22 AUGUSTUS gene 126111 126560 0.9 - . g216 Scaffold_22 AUGUSTUS transcript 126111 126560 0.9 - . g216.t1 Scaffold_22 AUGUSTUS stop_codon 126111 126113 . - 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_22 AUGUSTUS CDS 126111 126560 0.9 - 0 transcript_id "g216.t1"; gene_id "g216"; Scaffold_22 AUGUSTUS start_codon 126558 126560 . - 0 transcript_id "g216.t1"; gene_id "g216"; # protein sequence = [MPTDEELKEAGGQGEDSDIEMDDVDVTISKGKGRAKVTSSRSSRKVKRSLVFHDFIDVDASETDGENEYDDDDMSDFI # VESDDDEEEREVRKALKKCLGKRKARVILDSDEEESDEEKEVIFGKSNVKKLSPEAIKLLPRFLPSTKMKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g216 ### # start gene g217 Scaffold_22 AUGUSTUS gene 128827 129681 0.41 - . g217 Scaffold_22 AUGUSTUS transcript 128827 129681 0.41 - . g217.t1 Scaffold_22 AUGUSTUS stop_codon 128827 128829 . - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_22 AUGUSTUS CDS 128827 129681 0.41 - 0 transcript_id "g217.t1"; gene_id "g217"; Scaffold_22 AUGUSTUS start_codon 129679 129681 . - 0 transcript_id "g217.t1"; gene_id "g217"; # protein sequence = [MRSSGSIFPPAKKLKTELTSRAPLGVSTNVVIVAPTGVIPHAALDVDDIQGKIDNLQAEIFLKQDILDGLLRQDSRTP # AELMLIQRYVDELTSLDLLQGEFRSHLPVERSPFMSNVAPHYSFGEDGEIGHSALPWYAQTAHAPLGLFASSSTTRNHSLPEPVSAPLAAFPVTINSD # GVPPCVPPPLQVNAVAGPSRHAQQPAYIPGDILHNYDGGYEDESGDAEMDYAGTNETAKANEVAMQFAGTYIPNVAPIVQDDHDYDGDGNFRGRGKDH # FQGPIAKPDE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g217 ### # start gene g218 Scaffold_22 AUGUSTUS gene 131662 135620 0.31 + . g218 Scaffold_22 AUGUSTUS transcript 131662 135620 0.31 + . g218.t1 Scaffold_22 AUGUSTUS start_codon 131662 131664 . + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_22 AUGUSTUS CDS 131662 131799 0.42 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_22 AUGUSTUS CDS 132509 132868 0.75 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_22 AUGUSTUS CDS 132924 135620 1 + 0 transcript_id "g218.t1"; gene_id "g218"; Scaffold_22 AUGUSTUS stop_codon 135618 135620 . + 0 transcript_id "g218.t1"; gene_id "g218"; # protein sequence = [MNGVDQTRPESEIGIPFIDDIVCSKDQHYIALNTSELPSSAKPQQIEIENKIKVALKDLDQKWRTKSRRLKKDSKELE # EEKTKARLALENTLDGNVVRQEWERRLSNAGLVSEDWVDITDEEQRKVEMILGADLEFEEDDHRRFHESYAVVDPNSFHSLDDAWLEVTLRSDDQLSL # NASTSSASSISEAWNGPAYALWSSEASRSSAQSSQTSSPEWPNKYLASDASSASSSRPSTSTSMSSSSHSRSKSHGHYIGPQLTSDTDEDEETSFEKW # KLALRIRKIREFHDDAADADTRLTLDLDEARRTKSWSKEDEAQRVRAHEVDMLALRERKEMERKADVDSERQRRMAELRQPPLTERDYNTTAQKFLKT # LHLERDSPSISDTPTIRQSAFVRTRKQSLSHLQQQEWPESGNDTPTPTARTSTWNFKKENPASAASTLGEAPPLKRLSTAPAHVTSTSGSKVSPPSIF # GESVSAGNSKVTVGPTPGPTAQVSTKNALNTVVSVAASVSSSSKKSKKEKEKAEKEKAKAGKKANTAPVERNESSNAETSPRNNETIPVGMTMPGQWG # WGGDLTVASTSSVAPAVTGKPSSTSNVSFLASTPSTSSATTLLSSSHPSPYSHPFGSSSTSNTSSPAHSFSAPPAVSFPITTAPTIKTQASHVHAAVP # DNRRVWLPPSALETSSNSKNMKGKQPIHAMLEVPAPAPATQIHKSTSGPVNLAGNSPNLSTGAGMLDVPMPTHIQKSVSGPPDVSLKVESTVSPAVTA # AVPTSSISQGGQLNSRESHSIKPGVKATHTSSVPPAQPTGSSAPVGSTALPPSSSLTSSSSKKKSKGKKKVTIEEAQDEESANVSKGKGIERLPVDSR # YIIEPISEPEAPKPVVAEPQAQEMFKDIFEYDGLKALPISTSASTSSLASENLHQQSGHNVWAPPIASTASSSSSSLPQNDHARWIPNGGAHESFAIP # DKQEKKVRWTPNAYTYDAPNVLEQGQQDVFLSALDSLEAIIRDENGGDSLDGHSAVMIGAGKRDASKKSQGRGKAESNSDDTFWQHAMASLGRGGSNV # LAPSAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g218 ### # start gene g219 Scaffold_22 AUGUSTUS gene 136392 136868 0.74 - . g219 Scaffold_22 AUGUSTUS transcript 136392 136868 0.74 - . g219.t1 Scaffold_22 AUGUSTUS stop_codon 136392 136394 . - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_22 AUGUSTUS CDS 136392 136868 0.74 - 0 transcript_id "g219.t1"; gene_id "g219"; Scaffold_22 AUGUSTUS start_codon 136866 136868 . - 0 transcript_id "g219.t1"; gene_id "g219"; # protein sequence = [MRPQKYPIDERKIVKGESYRSRFHSPSPSSSSSNSSVDPNTDPDDEDNSVQAQTAPHVESFRSYVLKLIRNFLDDSSL # GTPEVLPSDNHQNEYKSSSSSSGYTSSQLDTQMFLTPSYRSTGSEVVDNHEMITVALVGRVVGKVLSIVALMLVFWILAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g219 ### # start gene g220 Scaffold_22 AUGUSTUS gene 138738 139367 0.98 - . g220 Scaffold_22 AUGUSTUS transcript 138738 139367 0.98 - . g220.t1 Scaffold_22 AUGUSTUS stop_codon 138738 138740 . - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_22 AUGUSTUS CDS 138738 139367 0.98 - 0 transcript_id "g220.t1"; gene_id "g220"; Scaffold_22 AUGUSTUS start_codon 139365 139367 . - 0 transcript_id "g220.t1"; gene_id "g220"; # protein sequence = [MSRSPIEAPQHVLALLNKLHKLSIEQEDRIKGDKARFVSTDVSNNADGEDGVTPHKYLNNDSNSKASLDDLMRDKFIA # LDEDKCHFVYQLIRAMGATSVIEAGTSFGVSTIYLALAVRENKKSRDGAKVKPGVIATENEPSKAARARQHWAQCGSEVEAEIDLREGNLLETLATDV # EQGVDLLLLDSESEFVAFGFLPVQINLPHDPEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g220 ### # start gene g221 Scaffold_22 AUGUSTUS gene 142815 143126 0.34 + . g221 Scaffold_22 AUGUSTUS transcript 142815 143126 0.34 + . g221.t1 Scaffold_22 AUGUSTUS start_codon 142815 142817 . + 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_22 AUGUSTUS CDS 142815 143126 0.34 + 0 transcript_id "g221.t1"; gene_id "g221"; Scaffold_22 AUGUSTUS stop_codon 143124 143126 . + 0 transcript_id "g221.t1"; gene_id "g221"; # protein sequence = [MEVKVMIKDTTVSRPMTFEIQNMIASELDNEARWDPSVEWKVTGGGDETFATSAAPSRTRFEFKGDGHEGFGELLAHP # VSTRGIVATTKTTGGLYMSDEYKGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g221 ### # start gene g222 Scaffold_22 AUGUSTUS gene 143194 144649 0.23 + . g222 Scaffold_22 AUGUSTUS transcript 143194 144649 0.23 + . g222.t1 Scaffold_22 AUGUSTUS start_codon 143194 143196 . + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_22 AUGUSTUS CDS 143194 143196 0.23 + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_22 AUGUSTUS CDS 144254 144649 0.78 + 0 transcript_id "g222.t1"; gene_id "g222"; Scaffold_22 AUGUSTUS stop_codon 144647 144649 . + 0 transcript_id "g222.t1"; gene_id "g222"; # protein sequence = [MPNALLSRALPTSSIESPGVEIRTGSDAEESTVTFDVVIKNGATTSTPLNVRSRIKSLIKDSIHNSPPTFFKWKFTGQ # GGAQNTGDSSIQFEFNGGSFEGFGEALTNSRLFEGIVMSPTGKELYASDEYKGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g222 ### # start gene g223 Scaffold_22 AUGUSTUS gene 154545 155093 0.54 - . g223 Scaffold_22 AUGUSTUS transcript 154545 155093 0.54 - . g223.t1 Scaffold_22 AUGUSTUS stop_codon 154545 154547 . - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_22 AUGUSTUS CDS 154545 155093 0.54 - 0 transcript_id "g223.t1"; gene_id "g223"; Scaffold_22 AUGUSTUS start_codon 155091 155093 . - 0 transcript_id "g223.t1"; gene_id "g223"; # protein sequence = [MGSIGSDLEEEHVRAYLDLNNVGRSLATLHVRRDRPVWPELLEYLTLSASHESSHTCSLDLSNSVSDALGSQPLRNLE # NVALDIDPIFQVLQMRDFVKSRWYDNLSSDSPRPITRLRNFSITLCFPDIPNLELESASVRKVFQRIAQGEELEDKLEVVFHKRRYTMMPMDVPLVTL # GSELII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g223 ### # start gene g224 Scaffold_22 AUGUSTUS gene 161570 162778 0.1 - . g224 Scaffold_22 AUGUSTUS transcript 161570 162778 0.1 - . g224.t1 Scaffold_22 AUGUSTUS stop_codon 161570 161572 . - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_22 AUGUSTUS CDS 161570 161817 0.48 - 2 transcript_id "g224.t1"; gene_id "g224"; Scaffold_22 AUGUSTUS CDS 161885 161908 0.62 - 2 transcript_id "g224.t1"; gene_id "g224"; Scaffold_22 AUGUSTUS CDS 162107 162675 0.37 - 1 transcript_id "g224.t1"; gene_id "g224"; Scaffold_22 AUGUSTUS CDS 162768 162778 0.63 - 0 transcript_id "g224.t1"; gene_id "g224"; Scaffold_22 AUGUSTUS start_codon 162776 162778 . - 0 transcript_id "g224.t1"; gene_id "g224"; # protein sequence = [MKGNGGENIVDYGGNHEQGSGGEQAEYARKHSGNFDNDPGNYEGEYNSFYGGGYRGRGGYGGGGYGGYDVGSYGYGYG # GGGYGGRGGGYGGGGYGGVGYGGSGYRGRGGGYGGYGGGGGGGGDGGGGYAGDYAHGYREGHTGNYGGSHGGGAEGEGYMGGYARQGFQGVQEDSKGS # YGGSYLGNEDSGRAFGGEINTTNSVKILKKRKRYIPKPPNPEILKRHGQSQQDTVEENWEEEERAEFEHDPEADNDEDEDDENDEADYEEDEATTNSR # EYKRKLFLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g224 ### # start gene g225 Scaffold_22 AUGUSTUS gene 167323 167745 0.49 - . g225 Scaffold_22 AUGUSTUS transcript 167323 167745 0.49 - . g225.t1 Scaffold_22 AUGUSTUS stop_codon 167323 167325 . - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_22 AUGUSTUS CDS 167323 167745 0.49 - 0 transcript_id "g225.t1"; gene_id "g225"; Scaffold_22 AUGUSTUS start_codon 167743 167745 . - 0 transcript_id "g225.t1"; gene_id "g225"; # protein sequence = [MSLTATTTGTTTGTPTASATPSATATPTATATTTVTATPSATTTTTATPSTTAMATPSMTAMATATATTTATATTTAT # PSATTTTTATPSMTAMATATATATATTTATPSMTTTATTMSPLSPLSPFLSTFPRLRPRPLC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g225 ### # start gene g226 Scaffold_22 AUGUSTUS gene 169424 169630 0.69 + . g226 Scaffold_22 AUGUSTUS transcript 169424 169630 0.69 + . g226.t1 Scaffold_22 AUGUSTUS start_codon 169424 169426 . + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_22 AUGUSTUS CDS 169424 169630 0.69 + 0 transcript_id "g226.t1"; gene_id "g226"; Scaffold_22 AUGUSTUS stop_codon 169628 169630 . + 0 transcript_id "g226.t1"; gene_id "g226"; # protein sequence = [MTGPTKTLGSVGMEVGGTDMEEEVKEAYEVVKLIDVLDVSVEGTEIWVAAENAYNKGCRESKTRLLHG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g226 ### # start gene g227 Scaffold_22 AUGUSTUS gene 185015 185470 0.52 + . g227 Scaffold_22 AUGUSTUS transcript 185015 185470 0.52 + . g227.t1 Scaffold_22 AUGUSTUS start_codon 185015 185017 . + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_22 AUGUSTUS CDS 185015 185470 0.52 + 0 transcript_id "g227.t1"; gene_id "g227"; Scaffold_22 AUGUSTUS stop_codon 185468 185470 . + 0 transcript_id "g227.t1"; gene_id "g227"; # protein sequence = [MRTPEFPQGRRVVVVANDITYKIGSFGPMEDQFFYLVTQYARELGLPRIYLSANSGACIGLAEEFIPLFSAAWNEEGH # PEKGVHYLYLTHENYLKLEEQGHDSIKTIDVEVAGELRHKITDILVCRMVLGGRGLVVSPWVSLLLRRALSNE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g227 ### # start gene g228 Scaffold_22 AUGUSTUS gene 190119 192377 0.36 - . g228 Scaffold_22 AUGUSTUS transcript 190119 192377 0.36 - . g228.t1 Scaffold_22 AUGUSTUS stop_codon 190119 190121 . - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_22 AUGUSTUS CDS 190119 190407 0.5 - 1 transcript_id "g228.t1"; gene_id "g228"; Scaffold_22 AUGUSTUS CDS 191689 192377 0.38 - 0 transcript_id "g228.t1"; gene_id "g228"; Scaffold_22 AUGUSTUS start_codon 192375 192377 . - 0 transcript_id "g228.t1"; gene_id "g228"; # protein sequence = [MYLGELTRGVLVALVDAVVRGDAVVRGDAVVRGDVVGGEQTQAQTQAQGEGEGESKQGTEVRLRKTHSLLFNGLSTRV # LNEKWALDTSVMSEVEEAWEAVDASSGTTMNGGTGEGTTLETGTEGMRNGVMEGGSVEGTPNEIGENPLWDGDDSGGLPDWEFLSGFDFTTTTTTTTT # TNTTTNTTTTSPSSANTALANTKLANTNTKLRTKLERVRQVVLRRLGYEDGEVRFDGFDSLDSLDSLDSFDGFDSFDGFDGFDGFDSFNSFGSFDSFD # SFDSLDSLDSFIPLSPLPLPSFFPFPIIPLPHHPLSSLFPLSPPPPPHHPN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g228 ### # start gene g229 Scaffold_22 AUGUSTUS gene 199685 201409 0.62 + . g229 Scaffold_22 AUGUSTUS transcript 199685 201409 0.62 + . g229.t1 Scaffold_22 AUGUSTUS start_codon 199685 199687 . + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_22 AUGUSTUS CDS 199685 201409 0.62 + 0 transcript_id "g229.t1"; gene_id "g229"; Scaffold_22 AUGUSTUS stop_codon 201407 201409 . + 0 transcript_id "g229.t1"; gene_id "g229"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRVRNGQTVYTYTPMR # HMHQLLVSEESEAMLCSQETRHRTLLAESDTLMLSEELSGSNLERALEFRRRLVADNRGTSYMVQCELESVGEFPPEQFDQKGQLHGSDGRFLAQKHS # SPRRGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g229 ### # start gene g230 Scaffold_22 AUGUSTUS gene 204165 204767 0.56 + . g230 Scaffold_22 AUGUSTUS transcript 204165 204767 0.56 + . g230.t1 Scaffold_22 AUGUSTUS start_codon 204165 204167 . + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_22 AUGUSTUS CDS 204165 204767 0.56 + 0 transcript_id "g230.t1"; gene_id "g230"; Scaffold_22 AUGUSTUS stop_codon 204765 204767 . + 0 transcript_id "g230.t1"; gene_id "g230"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQQPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGSTNG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g230 ### # start gene g231 Scaffold_22 AUGUSTUS gene 205878 207149 0.56 + . g231 Scaffold_22 AUGUSTUS transcript 205878 207149 0.56 + . g231.t1 Scaffold_22 AUGUSTUS start_codon 205878 205880 . + 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_22 AUGUSTUS CDS 205878 207149 0.56 + 0 transcript_id "g231.t1"; gene_id "g231"; Scaffold_22 AUGUSTUS stop_codon 207147 207149 . + 0 transcript_id "g231.t1"; gene_id "g231"; # protein sequence = [MPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYL # GVIISPLGVSMDPEKVKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVV # LECDASDLAIAGILSQLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELL # SGYDFVINYRPGRLGAKPDALTRRSDVYPKKGASRDQALAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKDCTQRGGIFVWEDGLIK # RGGRIYVPDVGTLRREVLQSYHDHKLRGHPGEKRTKKLVNQLFSGKDCPKT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g231 ### # start gene g232 Scaffold_22 AUGUSTUS gene 209048 211229 0.48 - . g232 Scaffold_22 AUGUSTUS transcript 209048 211229 0.48 - . g232.t1 Scaffold_22 AUGUSTUS stop_codon 209048 209050 . - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_22 AUGUSTUS CDS 209048 209753 0.54 - 1 transcript_id "g232.t1"; gene_id "g232"; Scaffold_22 AUGUSTUS CDS 209917 211229 0.49 - 0 transcript_id "g232.t1"; gene_id "g232"; Scaffold_22 AUGUSTUS start_codon 211227 211229 . - 0 transcript_id "g232.t1"; gene_id "g232"; # protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCSKSPAKCKVLPNSPRCTNCSVKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHQSTWGIPMVTWRQYDAALHERTSSTST # LLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPL # PPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDS # QRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRA # RGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGL # DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAVNTRVSLLLPIALWSPLFTDECSHCRRLFLIVMALEGGTTLFLP # FPVLTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g232 ### # start gene g233 Scaffold_22 AUGUSTUS gene 219658 220751 0.33 - . g233 Scaffold_22 AUGUSTUS transcript 219658 220751 0.33 - . g233.t1 Scaffold_22 AUGUSTUS stop_codon 219658 219660 . - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_22 AUGUSTUS CDS 219658 220506 0.42 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_22 AUGUSTUS CDS 220617 220751 0.37 - 0 transcript_id "g233.t1"; gene_id "g233"; Scaffold_22 AUGUSTUS start_codon 220749 220751 . - 0 transcript_id "g233.t1"; gene_id "g233"; # protein sequence = [MAIDTIPHGSGDDVKPNIVVVGGSYVGKLRVFSLRTRSESKYFGGKIQKINFSQNIFAFPRLHAVSGFESKAFIPYTS # EYFDEAYAMLSPHKTHRCTHIITGLVTSILSAEVILEDGRTIPYEYLVIATGTGQRTTLGLHNSNIVNSTLTKDTSNDKEKGLVHIHEWQADMKRANK # IVVIGGGAYGVREYTFTSVSSCIDIACRPELVTDIKTYKSTLSKNVTLVHSRAKLLHTFHHGLHDIAMEKMKEIGVDTILGQRAIRIEEVEGMFDDSN # EILGVTRKTPEFIVHLSGGEQLRADLVVRGMLHLISLILKSFIDHLSWRYTTF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g233 ### # start gene g234 Scaffold_22 AUGUSTUS gene 236769 237050 0.48 - . g234 Scaffold_22 AUGUSTUS transcript 236769 237050 0.48 - . g234.t1 Scaffold_22 AUGUSTUS stop_codon 236769 236771 . - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_22 AUGUSTUS CDS 236769 237050 0.48 - 0 transcript_id "g234.t1"; gene_id "g234"; Scaffold_22 AUGUSTUS start_codon 237048 237050 . - 0 transcript_id "g234.t1"; gene_id "g234"; # protein sequence = [MLHRAFPDDPIVGEEDAADLRAASGASLRDRIVELANEALTAELGIGDVAEWGIGPGSEQSVDDLLDAIDRGNHEGGR # NGSTSSLLPIFRRTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g234 ### # start gene g235 Scaffold_22 AUGUSTUS gene 241903 242277 0.59 + . g235 Scaffold_22 AUGUSTUS transcript 241903 242277 0.59 + . g235.t1 Scaffold_22 AUGUSTUS start_codon 241903 241905 . + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_22 AUGUSTUS CDS 241903 242277 0.59 + 0 transcript_id "g235.t1"; gene_id "g235"; Scaffold_22 AUGUSTUS stop_codon 242275 242277 . + 0 transcript_id "g235.t1"; gene_id "g235"; # protein sequence = [MAQGTTPCTRVERNALIDVPFTIIALQFTQDLKLGHYMKIPPRTMFAAQVIAAVIAGTTQLGVQAWMFTNIQGMCDQD # QPDGFICPSTTVFGTASIIWGVIGPRRIFSQGATYYGQLNACSAQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g235 ### # start gene g236 Scaffold_22 AUGUSTUS gene 242431 242742 0.79 - . g236 Scaffold_22 AUGUSTUS transcript 242431 242742 0.79 - . g236.t1 Scaffold_22 AUGUSTUS stop_codon 242431 242433 . - 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_22 AUGUSTUS CDS 242431 242742 0.79 - 0 transcript_id "g236.t1"; gene_id "g236"; Scaffold_22 AUGUSTUS start_codon 242740 242742 . - 0 transcript_id "g236.t1"; gene_id "g236"; # protein sequence = [MNEQLRNKPSTDGIAPPGGYGTLPDLSSVREFQAEKYYNSRDCHSRIHSGGKNIIVLRPPRKVFATNDILEDESYNGP # WDVVDGSGGWKKAGTGEHDGEAMVN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g236 ### # start gene g237 Scaffold_22 AUGUSTUS gene 243204 243551 1 - . g237 Scaffold_22 AUGUSTUS transcript 243204 243551 1 - . g237.t1 Scaffold_22 AUGUSTUS stop_codon 243204 243206 . - 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_22 AUGUSTUS CDS 243204 243551 1 - 0 transcript_id "g237.t1"; gene_id "g237"; Scaffold_22 AUGUSTUS start_codon 243549 243551 . - 0 transcript_id "g237.t1"; gene_id "g237"; # protein sequence = [MNAYCNFNGIGLIPWAPVAGGKLCRPVETNATVRAEEAKSSPSYSPFSDADKTIIGRVEEIAKKKGWTMTQVALAWVN # MKVTSPIVGMSSIPRVEENVITGLVLDGKEVEYLEEP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g237 ### # start gene g238 Scaffold_22 AUGUSTUS gene 245733 246053 0.88 - . g238 Scaffold_22 AUGUSTUS transcript 245733 246053 0.88 - . g238.t1 Scaffold_22 AUGUSTUS stop_codon 245733 245735 . - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_22 AUGUSTUS CDS 245733 246053 0.88 - 0 transcript_id "g238.t1"; gene_id "g238"; Scaffold_22 AUGUSTUS start_codon 246051 246053 . - 0 transcript_id "g238.t1"; gene_id "g238"; # protein sequence = [MKEAFKIVYTFLNASVWDGYILEPPTGLPSIPDFFTMNATELDVQLESYIRNSTGSSAHPVGTVAMSAKDASYGALDP # DLKVKGVDGLRVVDASAFVSCSLLGFYA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g238 ### # start gene g239 Scaffold_22 AUGUSTUS gene 250451 253165 0.96 + . g239 Scaffold_22 AUGUSTUS transcript 250451 253165 0.96 + . g239.t1 Scaffold_22 AUGUSTUS start_codon 250451 250453 . + 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_22 AUGUSTUS CDS 250451 253165 0.96 + 0 transcript_id "g239.t1"; gene_id "g239"; Scaffold_22 AUGUSTUS stop_codon 253163 253165 . + 0 transcript_id "g239.t1"; gene_id "g239"; # protein sequence = [MTTISAPQNKGSINHRAKVIAKQEQERARERKRKADQERGKKLELARQRQEAAQKKKEAELEAKHRAEEEALALEKFK # IREQALLAEKHRSDALVTIQRNTFGSTIATFGAGAQIVWIVPGFQTCRVRIRDIPLGVQAVPFRDFLQTNLGDMGVDARQKFYVVSLKRWNQLQEAVV # VADVDNAKDLVRRLDGVIFKGQSLKLDLNQNGGMGGMHTRNSGTFSLKISWKDPSSRYVVTYLSQITAEDQRRRFNGTLAFGRKIKVENNTNRHGDIT # PDQILISDLPFELTDGSVRNFFDGITVRRISGQSLGYAEDNVRPQLKEHIRWLCSVRSIEPPEFDEGRSQIHTTAIAVEHTVYARFDKWESAKQIHDL # LKSQKFSWIGNAFFRLWLPDPIQYEITIPFRQYQAQLTRWKSFLSDAGGKKDLRMRINEKPDKEKVFVQVEGADAKALGMLKVRIENLAAGEKLGIWH # RSFCTDSGRSFLRSLLSLTGVVVVPDWRLRVVKAYGEQPAIEKAREAILREIDRLAGLEYTVTLNRDSVRFFAQEGMTSLKERFGNDSVSLNISGLPR # ITIRGGEDAQRALHTLIEQSHRKVQPSKNEGGSSCPICLDEVSVPVQLGCGHEYCNACLHHFLTADVKNFPIVCLGDEAQCKKPIALPVIQKFLTEVQ # FDTLLEAAFMQHIEKNPEVFKYCSTPDCEQLYRCADSGLSESHVCCPSCLAEICTRCHEGHKGMSCDERQRSRNDQENNEELNARWAGMTGVKKCPRC # SVWIEKTDGCNHISCRCGAHVCWRCMGIFDAGTIYAHMTNAHGGYGDGDGLIQNLDYDAQARELQVWNNLATARRIAQEPPQPLYHIDTGRNDRLVQE # AQRRIALMHEQRRQQQEQRVRDLEATQRRTRQEEGGNWCTIM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g239 ### # start gene g240 Scaffold_22 AUGUSTUS gene 254300 254644 0.63 + . g240 Scaffold_22 AUGUSTUS transcript 254300 254644 0.63 + . g240.t1 Scaffold_22 AUGUSTUS start_codon 254300 254302 . + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_22 AUGUSTUS CDS 254300 254644 0.63 + 0 transcript_id "g240.t1"; gene_id "g240"; Scaffold_22 AUGUSTUS stop_codon 254642 254644 . + 0 transcript_id "g240.t1"; gene_id "g240"; # protein sequence = [MNAYCKYNGIGLIPWAPVAAGSLCRPVDANTTDRAESRKDHPPSQLSDVDKLIIGRVEELAKRKGWTMTQVALTWVKM # KVSSPIVGMSSVQRVEDNIVKGLTLTEEDTRYLEEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g240 ### # start gene g241 Scaffold_22 AUGUSTUS gene 265615 267112 0.32 + . g241 Scaffold_22 AUGUSTUS transcript 265615 267112 0.32 + . g241.t1 Scaffold_22 AUGUSTUS start_codon 265615 265617 . + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_22 AUGUSTUS CDS 265615 265665 0.84 + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_22 AUGUSTUS CDS 266414 267112 0.98 + 0 transcript_id "g241.t1"; gene_id "g241"; Scaffold_22 AUGUSTUS stop_codon 267110 267112 . + 0 transcript_id "g241.t1"; gene_id "g241"; # protein sequence = [MLYTRNTNDGNSSASYLANIDDWTPASNSPNTGTGSTGSCCAEMDIWEANSISAAVTPHPCTVTEQTSCTGTTCSSPN # STAGVCDQAGCDFNSYRLGDTTFYGPGMTVDTTKPFTVVTQFVSSNNETTGTLSAIRRLYVQNGVVIQNSETNIPGITTTNEITADFCEEQKTAFGDT # DTFDQKGGLTGMGTSLADGMTLVLSIWDDYAVNMLWLDSTYPTDGTSPGDFRGSCATSSGVPATVEVSFVVCP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g241 ### # start gene g242 Scaffold_22 AUGUSTUS gene 275380 276042 0.96 - . g242 Scaffold_22 AUGUSTUS transcript 275380 276042 0.96 - . g242.t1 Scaffold_22 AUGUSTUS stop_codon 275380 275382 . - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_22 AUGUSTUS CDS 275380 276042 0.96 - 0 transcript_id "g242.t1"; gene_id "g242"; Scaffold_22 AUGUSTUS start_codon 276040 276042 . - 0 transcript_id "g242.t1"; gene_id "g242"; # protein sequence = [MNGLSPRFAGMPLPTFNELELGGMINTAHSLGIKVAAHASNTNTIVKLLELGVDSIEHGSTLTPHPDSLMRLLSTTPN # TIWVPTLAVSYYQVQFTEGKDPRANQAWQSVSEMFQRALAIGMDNIACGGDTGAFPHGENSLEMKLMVRLGADWKKVLKWATLGGWECIRPMGWEVVN # ATDGSHDMPLGDNDHRFGCIKPGWAADLVGVEGDFEKELRRNSG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g242 ### # start gene g243 Scaffold_22 AUGUSTUS gene 279106 279492 0.89 + . g243 Scaffold_22 AUGUSTUS transcript 279106 279492 0.89 + . g243.t1 Scaffold_22 AUGUSTUS start_codon 279106 279108 . + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_22 AUGUSTUS CDS 279106 279492 0.89 + 0 transcript_id "g243.t1"; gene_id "g243"; Scaffold_22 AUGUSTUS stop_codon 279490 279492 . + 0 transcript_id "g243.t1"; gene_id "g243"; # protein sequence = [MPQATTSSSRDNPNHHKDDKIDKSQKTLQGKALKTGKAVSFFCNLPFDHIDGRLADLTAAYQASSDFQSNNQDEISKT # SSKFASSAEVKAMEEKVKDFVSSSQVLMSVLDDIRKIHPVIGGIIGAVTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g243 ### # start gene g244 Scaffold_22 AUGUSTUS gene 280352 282915 0.08 + . g244 Scaffold_22 AUGUSTUS transcript 280352 282915 0.08 + . g244.t1 Scaffold_22 AUGUSTUS start_codon 280352 280354 . + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_22 AUGUSTUS CDS 280352 280832 0.67 + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_22 AUGUSTUS CDS 280910 281136 0.46 + 2 transcript_id "g244.t1"; gene_id "g244"; Scaffold_22 AUGUSTUS CDS 281252 281577 0.92 + 0 transcript_id "g244.t1"; gene_id "g244"; Scaffold_22 AUGUSTUS CDS 281816 282042 0.3 + 1 transcript_id "g244.t1"; gene_id "g244"; Scaffold_22 AUGUSTUS CDS 282309 282353 0.46 + 2 transcript_id "g244.t1"; gene_id "g244"; Scaffold_22 AUGUSTUS CDS 282446 282915 0.44 + 2 transcript_id "g244.t1"; gene_id "g244"; Scaffold_22 AUGUSTUS stop_codon 282913 282915 . + 0 transcript_id "g244.t1"; gene_id "g244"; # protein sequence = [MNVPPVPPVPSAMYPGYSTYSSPGAAAVLGLNPTPSTYQPQLQPRTSTASQGFAAPMSTEMYYGSSLPVYNSSPPPPL # ERHMKPVHSHRSYSSNRRVSNSQPIEYLHRPESPTRYHSTFATRSSAPSQAWAGYAPATYEYSESRQRHRSTTTQRTSSTHERSTWSPAHEVNQLKQE # LQLDVDDDLKKNMTVFKRKLDEQQRQLQQIENTVINQGDRVISVVREGPHDRIHDPVSQCGWKLGVPVQEFVHTLHDYYVAQNNDSAVVDNYFTIMAS # PAPGSTADDQTLALRAAFSAAKQRAAEKWALKHINIKNIIPLMEVFDGDASGFVSVWEANQVASLRPKDWRDIVNHYLLGLWAVDQVLCQIVPCTEPP # DGILAEKIASYTHTEEDIMEQKLKALNYEIDGPDTLGLIIGDSQIERVRLFGSTIVDSPFLRETVFRGIDPYYPLALDYGITKEIAPLSDIPDVPLKH # RSPGIIEPADSTFHPFTLNEYITGVEGFWSGYLYNEAWNRTVHGIIEFGVHTWNFSDEQFSAIGSYSQGMLSINGSIRIHGQQGTLEARLLAHPDYDR # DQKWDIVLRGTLDIVRNYVGKAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/6 # CDS introns: 0/5 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g244 ### # start gene g245 Scaffold_22 AUGUSTUS gene 285624 287340 0.36 - . g245 Scaffold_22 AUGUSTUS transcript 285624 287340 0.36 - . g245.t1 Scaffold_22 AUGUSTUS stop_codon 285624 285626 . - 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_22 AUGUSTUS CDS 285624 286012 0.61 - 2 transcript_id "g245.t1"; gene_id "g245"; Scaffold_22 AUGUSTUS CDS 286092 287340 0.36 - 0 transcript_id "g245.t1"; gene_id "g245"; Scaffold_22 AUGUSTUS start_codon 287338 287340 . - 0 transcript_id "g245.t1"; gene_id "g245"; # protein sequence = [MFYTRGSADDYNRFAAVTEDEGWSWDNIQPFLARVRLVSYRVLSEVQSVYFQNERFEPPADRHNTSGQFNPLVHSFSG # VNAVSLPGFPTNIDSMVFDAVDELGGIFHYNEDVNSGMPLGFGEPVLYHISESNISSYITSRHSLVLSPITHLCCCSGWLQKTVTSQGRRSSSATSYL # APEFISRPNLDVLLNARVARILPNASSTERSTSGLAFRTVEFAHDLDGMSFIYLHKNSSTIAYMHTGPRQRVSAAKEVILSAGVIGSPQILLNSGIGN # STTLFDLGITPLVNLPSVGQNLTDQPSISNEFLVNTTQTFDDLKRNATLLNEVYTEFNKSGMGPLVDTGGNQISFFRVNESLTDIYGDPSSGKNSPHL # EMVPGVSITLVWLFITSNMILSFEERIFPHTSGYWPLSLNEHCGCGSVTINSTNPFAPPLIDPGYLTSPFDLAAMRQALEIMFQYLSAPIWDGYILSA # FGTLANITSLSDDNILNTYIREFSSSTAHPVGTAAMSAKGADYGVVDPDLRVKGVVGLRIVDASVFVSIFIFSSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g245 ### # start gene g246 Scaffold_22 AUGUSTUS gene 293290 293715 0.93 - . g246 Scaffold_22 AUGUSTUS transcript 293290 293715 0.93 - . g246.t1 Scaffold_22 AUGUSTUS stop_codon 293290 293292 . - 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_22 AUGUSTUS CDS 293290 293715 0.93 - 0 transcript_id "g246.t1"; gene_id "g246"; Scaffold_22 AUGUSTUS start_codon 293713 293715 . - 0 transcript_id "g246.t1"; gene_id "g246"; # protein sequence = [MSFETTIPASPTPATLHLCYLIFNYKSFASNPISGPPEFTLDEWVSILKLATKWDMSTARACAIEKIAEYDGIPAKKI # RLARDYRVPRYFIPSLVQLIGRSNPLTADDYKDIGVECALKVVSLRERYYDPNRNGECSVSRE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g246 ### # start gene g247 Scaffold_22 AUGUSTUS gene 298630 298935 1 + . g247 Scaffold_22 AUGUSTUS transcript 298630 298935 1 + . g247.t1 Scaffold_22 AUGUSTUS start_codon 298630 298632 . + 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_22 AUGUSTUS CDS 298630 298935 1 + 0 transcript_id "g247.t1"; gene_id "g247"; Scaffold_22 AUGUSTUS stop_codon 298933 298935 . + 0 transcript_id "g247.t1"; gene_id "g247"; # protein sequence = [MDAISLVFRDSLHNTSAPAKSFAALTRFETKLQNNGNSDDSQSTFISLALVKRANLDQDVGLTNIIPDPFIWSDDGYD # SADDDDDIQDSISREVQSEISTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g247 ### # start gene g248 Scaffold_22 AUGUSTUS gene 299992 300717 0.79 - . g248 Scaffold_22 AUGUSTUS transcript 299992 300717 0.79 - . g248.t1 Scaffold_22 AUGUSTUS stop_codon 299992 299994 . - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_22 AUGUSTUS CDS 299992 300717 0.79 - 0 transcript_id "g248.t1"; gene_id "g248"; Scaffold_22 AUGUSTUS start_codon 300715 300717 . - 0 transcript_id "g248.t1"; gene_id "g248"; # protein sequence = [MLLNETGAKVQYTLGTTENWTTSQLSKRDILEKFKYNKDDENLILENMQLAADIYALMPKPFKWFKKGDGGGKTDDTL # PNQESRGEPLQGDDSVGGDSGQEDGPGGGHDGQGDDNVWVQDPNLNRGCSQIPSSINDEDSLFRSSSSEGSNSIDDQGINELLFETFKERDVAPKVNK # WISGLEPGLPSSGTTIRGHLQSLGKEREREVGISTLTKRKTRSFLLSLRVLLSQSRTGGDPNLEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g248 ### # start gene g249 Scaffold_22 AUGUSTUS gene 303561 305502 0.38 + . g249 Scaffold_22 AUGUSTUS transcript 303561 305502 0.38 + . g249.t1 Scaffold_22 AUGUSTUS start_codon 303561 303563 . + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_22 AUGUSTUS CDS 303561 303853 0.38 + 0 transcript_id "g249.t1"; gene_id "g249"; Scaffold_22 AUGUSTUS CDS 304845 305502 0.99 + 1 transcript_id "g249.t1"; gene_id "g249"; Scaffold_22 AUGUSTUS stop_codon 305500 305502 . + 0 transcript_id "g249.t1"; gene_id "g249"; # protein sequence = [MTYYFTSYSLNYKGLSYRTEWIEYPDIEALCIKIGAAPTDVKADGITPDYTLPVIYDRSTDKTISDSFAIALYLDTAY # PDTPKLFPPGTQALQEAFVQTEWIEYPDIEALCIKIGAAPTDVKADGTTPEYTLPVIFDPSTNKAISDSFNIAQYLDTTYPDTPRLIPPGTRALQSGF # AQYVNLRVKSILGQFVRPVVFQRLPFGKSQEYFRRTREALYNVKIEEWAPQGEHRAREWKGLRRALISLDGHYREAKEETGGDFLCGVDPSFVDFALA # GILQWSKHILGAESEEWNDILSWQEGKWANFMSRLERYAVVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g249 ### # start gene g250 Scaffold_22 AUGUSTUS gene 307080 307409 0.96 - . g250 Scaffold_22 AUGUSTUS transcript 307080 307409 0.96 - . g250.t1 Scaffold_22 AUGUSTUS stop_codon 307080 307082 . - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_22 AUGUSTUS CDS 307080 307409 0.96 - 0 transcript_id "g250.t1"; gene_id "g250"; Scaffold_22 AUGUSTUS start_codon 307407 307409 . - 0 transcript_id "g250.t1"; gene_id "g250"; # protein sequence = [MPSASFVPALTSSLPSLPTSPAAPVPAAKPLTKPSTSTSIVGINSQLHDKDDDSDDGDVNGMDELVPPSKVGLGIGDD # AVDAGRASPGRYIHGAPLHNVLEEEEEEDEE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g250 ### # start gene g251 Scaffold_22 AUGUSTUS gene 307616 311598 0.78 - . g251 Scaffold_22 AUGUSTUS transcript 307616 311598 0.78 - . g251.t1 Scaffold_22 AUGUSTUS stop_codon 307616 307618 . - 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_22 AUGUSTUS CDS 307616 309940 0.92 - 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_22 AUGUSTUS CDS 311074 311598 0.91 - 0 transcript_id "g251.t1"; gene_id "g251"; Scaffold_22 AUGUSTUS start_codon 311596 311598 . - 0 transcript_id "g251.t1"; gene_id "g251"; # protein sequence = [MLIGVQFETSGFLSPPSSSARGSRDIESALKFDLTESARKARTAKRGIRDSVDWGDFVNGGFDLSEQRRSGGVSPVAL # SSSTNSSHLNNNGYGYGAGDDPDKSYVGADGRLTDVGEFALDTGLDAALQFNLSEFGIIGSGKDRDKDGKEGKEVRGERERTITGVSLGKRLKKKEKI # GITLLARCVDFDPGLGVDERFRKRKKEKKVKEAKTKKDKKDKKDKKDKVKTEKEKAGPVSFFSGSTRTLTSSTPTPQDSRNDSTPTPTPYLHSTSLSH # PSRSGKQVQTPDGSPSTPTGPAIPRPPKDKFEEFDAMLADGNRGTKVITLNGALHTLSPEGRLGSEEGGEGYTDVEDLGDELRRHNTTTHEAGFSSAT # GSGHPLPPLPPPPISQPLPQSLPSQLEPSMPTLSAPRPQNEEPSPITSTPIKNIFRLGPPSAALSPKPSSGTSKPALKPKGPKPKTSRRQSRQNLVPA # EYHTVEFETRLTGLGSGGESDVDIDVDGDRFGEGGRRGGLDGELDGRCDTHGEGVVLELDGTRGDGFVEEAARRRRAARLAERDRLRSERRGKRFSLG # LGGGPKGGDFDDDEAWVDIVVPGYGAHRVSVEASKRNGGPEEASQEVARVLSAVRDGQPYPGIDDDESIFEGVDNSATSAVKVNSDSDDVEVQMVPRF # GKDKETGHANGLRIGHGHGGQGHHDDQSYTQSSKQSFTSGGDLDASYTSESYNFPDADAEEDPEFKPLTSSVPNRRLGYFDLHPERKRASQEMLKQIT # TDDDLLNVRQPEAMSSRDADMFASGSLNGHSDIDDDVDADDIEAVEVDEVDEDDEDDEDPRARYAHGSDDEHDDAPRDLDKLYAAKTEKARPLPSLPP # DQKSGSFSTSATFSSLPATSHLDRLLSLTRLPLPALHLILRQCPFPTSPLSHQSLPLWPSPQLPQRNHLSSHPHLALRQARPERRPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g251 ### # start gene g252 Scaffold_22 AUGUSTUS gene 312898 313584 0.76 - . g252 Scaffold_22 AUGUSTUS transcript 312898 313584 0.76 - . g252.t1 Scaffold_22 AUGUSTUS stop_codon 312898 312900 . - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_22 AUGUSTUS CDS 312898 313584 0.76 - 0 transcript_id "g252.t1"; gene_id "g252"; Scaffold_22 AUGUSTUS start_codon 313582 313584 . - 0 transcript_id "g252.t1"; gene_id "g252"; # protein sequence = [MPNISLSPKPSDTFKTLSTVGGRNILNTLHNSSTYTLFDTLNTLANRQSPMSFLFSRSNSHSSPSDTDFSPYPPYTTH # TLLTLLNSLPTDESGSFVGTVLPSQSSDSPSSHGATGNAYGYLSSYPTLVLGLPDLRELVQLISEHLDVETPFVFSNGGSTVSQGGGGVPVAIDLDAG # RVKRLIDKYVEYLTSNSGRNTNLRKSGDHIAGFDDEARFAGPHELGCSYAGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g252 ### # start gene g253 Scaffold_22 AUGUSTUS gene 315601 315969 0.58 + . g253 Scaffold_22 AUGUSTUS transcript 315601 315969 0.58 + . g253.t1 Scaffold_22 AUGUSTUS start_codon 315601 315603 . + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_22 AUGUSTUS CDS 315601 315969 0.58 + 0 transcript_id "g253.t1"; gene_id "g253"; Scaffold_22 AUGUSTUS stop_codon 315967 315969 . + 0 transcript_id "g253.t1"; gene_id "g253"; # protein sequence = [MFALRELYFPTRSDLLAVDLLTLITLSSLPSTSPSSTLSSPTTSLETLSSSIENIISMIDRVLTYVRAVLAGEARGNA # AIGRYLMDTLGASTEGDTGVGGSAVEMGGFSGRLQDTLMVSYFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g253 ### # start gene g254 Scaffold_22 AUGUSTUS gene 319432 320680 0.27 + . g254 Scaffold_22 AUGUSTUS transcript 319432 320680 0.27 + . g254.t1 Scaffold_22 AUGUSTUS start_codon 319432 319434 . + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_22 AUGUSTUS CDS 319432 319603 0.27 + 0 transcript_id "g254.t1"; gene_id "g254"; Scaffold_22 AUGUSTUS CDS 319767 320680 0.87 + 2 transcript_id "g254.t1"; gene_id "g254"; Scaffold_22 AUGUSTUS stop_codon 320678 320680 . + 0 transcript_id "g254.t1"; gene_id "g254"; # protein sequence = [MQDLQSSHSPIASAPQPPPHFPSPGEAFPPLPHPTPAAPATLHIDNLTTSALTQGLADGNSTDDEQSSNEGDDPSDDE # DQQVCDEEMDVDQAPSSLSPPEIHSSLLRFNILVEPVYRLVVCTECAIPVRLEHMYTHQKTKHFKGLNLPPELNLPSRANLESLLVTLGAGQPLEVPA # GPIPRIRGVQIVQGLKCTTSGCSGKVFGSIEGRSRNLRVHQLQVHPQVALADRRSVQVSCHPLSANRRDRQFVEVSPSSTSTSASFRLVEKAAETCNL # LEHSQVFSLASNEREKNAVFAQSRWDELLDGVNLTLLIATISNSKRDAFGSFQRLKRIAREYYKGVADRLMTLPVLTRRYLLSSSTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g254 ### # start gene g255 Scaffold_22 AUGUSTUS gene 331170 331858 0.66 + . g255 Scaffold_22 AUGUSTUS transcript 331170 331858 0.66 + . g255.t1 Scaffold_22 AUGUSTUS start_codon 331170 331172 . + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_22 AUGUSTUS CDS 331170 331215 0.66 + 0 transcript_id "g255.t1"; gene_id "g255"; Scaffold_22 AUGUSTUS CDS 331296 331858 0.91 + 2 transcript_id "g255.t1"; gene_id "g255"; Scaffold_22 AUGUSTUS stop_codon 331856 331858 . + 0 transcript_id "g255.t1"; gene_id "g255"; # protein sequence = [MTKATHKAEYHSGGHVRVHRRNDGKIPCPCGREDHARYSFKKLTAINKQDPHPISEASEWADHLPDVKPSQTSSPSPY # PPNPTDPSPEANAEISEQNGQNAMQDLQSSHSPIASAPQPPPHFPSPGEAFPPLPHPTPAAPATLHIDNLTTSALTQGLAGDSGDMKDLNEGRDIGIE # VEGVQEIDATGDTAELDKGACSMNNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g255 ### # start gene g256 Scaffold_22 AUGUSTUS gene 343295 343983 0.52 + . g256 Scaffold_22 AUGUSTUS transcript 343295 343983 0.52 + . g256.t1 Scaffold_22 AUGUSTUS start_codon 343295 343297 . + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_22 AUGUSTUS CDS 343295 343340 0.52 + 0 transcript_id "g256.t1"; gene_id "g256"; Scaffold_22 AUGUSTUS CDS 343421 343983 0.85 + 2 transcript_id "g256.t1"; gene_id "g256"; Scaffold_22 AUGUSTUS stop_codon 343981 343983 . + 0 transcript_id "g256.t1"; gene_id "g256"; # protein sequence = [MTKATHKAEYHSGGHVRVHRRNDGKIPCPCGREDHARYSFKKLTAINKQDPHPISEASEWADHLPDVKPSQTSSPSPY # PPNPTDPSPEANAEISEQNGQNAMQDLQSSHSPIASAPQPPPHFPSPGEAFPPLPHPTPAAPATLHIDNLTTSALTQGLAGDSGDMKDLNEGRDIGIE # VEGVQEIDATGDTAELDKGACSMNNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g256 ### # # ----- prediction on sequence number 9 (length = 652519, name = Scaffold_17) ----- # # Predicted genes for sequence number 9 on both strands # start gene g257 Scaffold_17 AUGUSTUS gene 4144 4521 0.91 - . g257 Scaffold_17 AUGUSTUS transcript 4144 4521 0.91 - . g257.t1 Scaffold_17 AUGUSTUS stop_codon 4144 4146 . - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_17 AUGUSTUS CDS 4144 4521 0.91 - 0 transcript_id "g257.t1"; gene_id "g257"; Scaffold_17 AUGUSTUS start_codon 4519 4521 . - 0 transcript_id "g257.t1"; gene_id "g257"; # protein sequence = [MFLKLEAKPGTLVQTADCAGTGEGVPGAGGEIEIESGMHEEFAAVGTNGGGGSPRRHARFGVATPYLLKYHLGRLAPI # LSPPRTLTAQQMALEVFVDGEKEEEEKSLIILWFLLLHMLQVMASPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g257 ### # start gene g258 Scaffold_17 AUGUSTUS gene 6199 6845 0.25 + . g258 Scaffold_17 AUGUSTUS transcript 6199 6845 0.25 + . g258.t1 Scaffold_17 AUGUSTUS start_codon 6199 6201 . + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_17 AUGUSTUS CDS 6199 6444 0.28 + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_17 AUGUSTUS CDS 6516 6845 0.72 + 0 transcript_id "g258.t1"; gene_id "g258"; Scaffold_17 AUGUSTUS stop_codon 6843 6845 . + 0 transcript_id "g258.t1"; gene_id "g258"; # protein sequence = [MKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREA # GKPFPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEE # TPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g258 ### # start gene g259 Scaffold_17 AUGUSTUS gene 7658 8161 0.57 + . g259 Scaffold_17 AUGUSTUS transcript 7658 8161 0.57 + . g259.t1 Scaffold_17 AUGUSTUS start_codon 7658 7660 . + 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_17 AUGUSTUS CDS 7658 8161 0.57 + 0 transcript_id "g259.t1"; gene_id "g259"; Scaffold_17 AUGUSTUS stop_codon 8159 8161 . + 0 transcript_id "g259.t1"; gene_id "g259"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLIQIFSTLRKELKYTPNWISLTLII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g259 ### # start gene g260 Scaffold_17 AUGUSTUS gene 8445 9166 0.29 + . g260 Scaffold_17 AUGUSTUS transcript 8445 9166 0.29 + . g260.t1 Scaffold_17 AUGUSTUS start_codon 8445 8447 . + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_17 AUGUSTUS CDS 8445 8527 0.39 + 0 transcript_id "g260.t1"; gene_id "g260"; Scaffold_17 AUGUSTUS CDS 8611 9166 0.61 + 1 transcript_id "g260.t1"; gene_id "g260"; Scaffold_17 AUGUSTUS stop_codon 9164 9166 . + 0 transcript_id "g260.t1"; gene_id "g260"; # protein sequence = [MDTVEYLGYILSPDGLTMSKEKVQTVLDDIVVPMTRLTRKGASWIWDSSCQEAFENLKIAFTSAPILAHWEPNRPLIV # ETDASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQ # FNMVIRFRPGKLGEKPDSITRRWDVYPKEGISATPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g260 ### # start gene g261 Scaffold_17 AUGUSTUS gene 11134 12180 0.72 - . g261 Scaffold_17 AUGUSTUS transcript 11134 12180 0.72 - . g261.t1 Scaffold_17 AUGUSTUS stop_codon 11134 11136 . - 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_17 AUGUSTUS CDS 11134 11667 0.72 - 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_17 AUGUSTUS CDS 11719 12180 0.72 - 0 transcript_id "g261.t1"; gene_id "g261"; Scaffold_17 AUGUSTUS start_codon 12178 12180 . - 0 transcript_id "g261.t1"; gene_id "g261"; # protein sequence = [MSASRTITTTTSATAGPSRSRPVPPPPPPASDSAAQEEEGLEDEDEDDIIRKAQARVERVRARKAAEAARKKAEEEAA # RAAAEKKRKAQEAQERAKRARQQEEEVVERRRLLAAAATARSQRGTSPSEVSASPRRPVVEIRRTKSKGKGKARAEPVGGDPDDGDEGDDDDDDDKEP # CERCRAKKISCQMQAGKRSSIICKPCHDAKVRCSYSGRPSTVKREGGSNPTGERLAVLESQVAQLLADNRQLRDGQVKANTYHRHMNRKLDWLVTDAA # RRRRTPPELPQAGPSELPKKRRRVMDSDEEEERGREQEMEEDGEGEEEEGGMEVEEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g261 ### # start gene g262 Scaffold_17 AUGUSTUS gene 12907 13515 0.98 - . g262 Scaffold_17 AUGUSTUS transcript 12907 13515 0.98 - . g262.t1 Scaffold_17 AUGUSTUS stop_codon 12907 12909 . - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_17 AUGUSTUS CDS 12907 13515 0.98 - 0 transcript_id "g262.t1"; gene_id "g262"; Scaffold_17 AUGUSTUS start_codon 13513 13515 . - 0 transcript_id "g262.t1"; gene_id "g262"; # protein sequence = [MLTWDSGPVEITPAPSGTHTTTNEINIIISNSTTPSGSSTTEAIATAIGNILSIIGDPLGPGDQSTMKPTRISQSASE # GEVSNTIIQFSSVTVNATSTSPPSFAFSSSSPSSSSSSSSSSSPKSGANSHIGVIISGAVGGGVALAIATTILVLVGIWWKLLRSCTPSNRAKATRCL # SAEDEWDSSEVINNTAVTPLVPGERE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g262 ### # start gene g263 Scaffold_17 AUGUSTUS gene 14206 14805 0.99 - . g263 Scaffold_17 AUGUSTUS transcript 14206 14805 0.99 - . g263.t1 Scaffold_17 AUGUSTUS stop_codon 14206 14208 . - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_17 AUGUSTUS CDS 14206 14805 0.99 - 0 transcript_id "g263.t1"; gene_id "g263"; Scaffold_17 AUGUSTUS start_codon 14803 14805 . - 0 transcript_id "g263.t1"; gene_id "g263"; # protein sequence = [MNSALASGSGDDDSRSLTLGGHVGSIGEGRGRITSAREGELSAGGWICEQLLAASGMGFGVVTPYLLKYSPTTLTTNT # NPDSDQNPNPLRILSESPHSPRLALDAVLPPPASTLDVSIDIRANGGSYNLATDTRDGRDETAAAGSRSTTSGLGRWNSGNVLQDGRRIQFAMLLRGE # GEREREQDEEQDEIPPTYESFDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g263 ### # start gene g264 Scaffold_17 AUGUSTUS gene 15289 16302 0.56 - . g264 Scaffold_17 AUGUSTUS transcript 15289 16302 0.56 - . g264.t1 Scaffold_17 AUGUSTUS stop_codon 15289 15291 . - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_17 AUGUSTUS CDS 15289 16302 0.56 - 0 transcript_id "g264.t1"; gene_id "g264"; Scaffold_17 AUGUSTUS start_codon 16300 16302 . - 0 transcript_id "g264.t1"; gene_id "g264"; # protein sequence = [MPPAFLPTALTDVDFGFRTSWNNPVPSSTRTTTDEIDNIGDPIVPTTTISNAIIGDGFTITGVRPRPGDVEPTRTSQS # ASEVEGFNTTIQLSSVAVNTTSTSPPFTLLFLLLSLLHLHLLLPSPPSPLHNSGANSHIGVIIGSTIGGGVALAITIIVLVLVGIWCKRYKLKEMFLK # LETKPAMSVPAVDRAGAGEGVPGAGGEITSGSGSHRGARFEASLYPLEHYPAHPAMILLPPAMSAGHDAVSIVGSRNSGSGRRSSRNMFIHRDREMVS # INVDMLQGRVQEEVESQLEEQVPEEILPTYESLMSDLMTVGIQSRSRNITEVGVGVELVEVES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g264 ### # start gene g265 Scaffold_17 AUGUSTUS gene 17278 17766 0.45 - . g265 Scaffold_17 AUGUSTUS transcript 17278 17766 0.45 - . g265.t1 Scaffold_17 AUGUSTUS stop_codon 17278 17280 . - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_17 AUGUSTUS CDS 17278 17561 0.91 - 2 transcript_id "g265.t1"; gene_id "g265"; Scaffold_17 AUGUSTUS CDS 17700 17766 0.45 - 0 transcript_id "g265.t1"; gene_id "g265"; Scaffold_17 AUGUSTUS start_codon 17764 17766 . - 0 transcript_id "g265.t1"; gene_id "g265"; # protein sequence = [MAAAGYAPGNINGYYTAGTSTDFTEHVGGIGENRGRRSVRAEEGAPSAGGDIYGLLLAASGARSGVITPYSLKYSTAT # LTSNTYPGPNPDPLPPLRLTLDPVTGLPLTEMSRTQHT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g265 ### # start gene g266 Scaffold_17 AUGUSTUS gene 21254 22138 0.82 + . g266 Scaffold_17 AUGUSTUS transcript 21254 22138 0.82 + . g266.t1 Scaffold_17 AUGUSTUS start_codon 21254 21256 . + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_17 AUGUSTUS CDS 21254 22138 0.82 + 0 transcript_id "g266.t1"; gene_id "g266"; Scaffold_17 AUGUSTUS stop_codon 22136 22138 . + 0 transcript_id "g266.t1"; gene_id "g266"; # protein sequence = [MFTTMELFPGKYFFFIGYIMHQRRTNILLVTSPEPTSSPLEIEVASTSTLLEAVVENTSPPSSSSFGSESEDTSFPSP # SPDTLTTSFFTFTVTPTTPFPTPSRTFTTSTIMSFSFIFHTSSATTSFHSHFSATISNIPNSSSNPGSSSVSPISSKSHIGAIIGGTIGGVVLITTVI # ILVLIHRSKKRRHRQRSMSETLDHGIGGATPFPLKDQLTTITNSDPNSHSNLTPVVPPEMTTLGESNSVVATQLTASTFGTRRNLFVHQDGGRIEMPL # QAEPEDVVLEEIPPPYESLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g266 ### # start gene g267 Scaffold_17 AUGUSTUS gene 28989 29459 0.52 - . g267 Scaffold_17 AUGUSTUS transcript 28989 29459 0.52 - . g267.t1 Scaffold_17 AUGUSTUS stop_codon 28989 28991 . - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_17 AUGUSTUS CDS 28989 29459 0.52 - 0 transcript_id "g267.t1"; gene_id "g267"; Scaffold_17 AUGUSTUS start_codon 29457 29459 . - 0 transcript_id "g267.t1"; gene_id "g267"; # protein sequence = [MNHLLENVLSDIECTLGARNPGEKCTLYVAVDECQFIAQLKPHSNFFRSDNWTVERPLLRQIARSLDMMFNMKSHTTG # IQACFIFTGTGLSREIIYEALSSVILKPGFTVDINETGAFNDATAQLEYMQEFFPPKIYQNKEFEQLRGRIFYWLRGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g267 ### # start gene g268 Scaffold_17 AUGUSTUS gene 31948 33337 0.1 - . g268 Scaffold_17 AUGUSTUS transcript 31948 33337 0.1 - . g268.t1 Scaffold_17 AUGUSTUS stop_codon 31948 31950 . - 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_17 AUGUSTUS CDS 31948 32462 0.42 - 2 transcript_id "g268.t1"; gene_id "g268"; Scaffold_17 AUGUSTUS CDS 32519 32813 0.5 - 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_17 AUGUSTUS CDS 32888 33337 0.33 - 0 transcript_id "g268.t1"; gene_id "g268"; Scaffold_17 AUGUSTUS start_codon 33335 33337 . - 0 transcript_id "g268.t1"; gene_id "g268"; # protein sequence = [MASGAPASSATTSSSSPTSASTTTSSSSSTTSSTTSSNTSNTSNTSSSTSASNTASSAQSSGSSLGSGSSSGTSSATK # TSSSTTSTSTLTASLTTAVATTVVGTSADGQVYTTVIQTSTVLPPGATVTSSSSSDSGSSSSSDSHTGAIVGKQRSLEAFDGNFDPDRIVTEGKAMKG # EPKGMRGRGATLPNVGDDDDGMGGRLAGSALGAGVVAPYPLYHPTNANAIPPEMSTHNNNNNKTPIHLQHPSGVPASVYAAAYGDNGPPPTQPQGSNA # PYGFGVGERLPNPYTQNPNQPNPASNTGSTSTHTTHTGAGQGYGRFNVANPDPGAAAGASSSSAAGPEGLFVGGFTPGARGENKSAAGPAFGGRSRDV # LVHQDGGRVDVPRGEGEGEGPDEIPPTYDSLLPDRSGSGPPQRGGKR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g268 ### # start gene g269 Scaffold_17 AUGUSTUS gene 37846 38448 0.74 - . g269 Scaffold_17 AUGUSTUS transcript 37846 38448 0.74 - . g269.t1 Scaffold_17 AUGUSTUS stop_codon 37846 37848 . - 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_17 AUGUSTUS CDS 37846 38448 0.74 - 0 transcript_id "g269.t1"; gene_id "g269"; Scaffold_17 AUGUSTUS start_codon 38446 38448 . - 0 transcript_id "g269.t1"; gene_id "g269"; # protein sequence = [MFLITAIFAFKSSLFHDHPLSGHFGQNRTLEAVRRQYTWPKVRDFVRDYVTSCTTVVAISPPSSALRLVETFAGSGPT # MGFHSMDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKALSMELHYTSGYHPEA # DGQTERVNQTLEAVHQDLLLLPTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g269 ### # start gene g270 Scaffold_17 AUGUSTUS gene 39578 40648 0.5 - . g270 Scaffold_17 AUGUSTUS transcript 39578 40648 0.5 - . g270.t1 Scaffold_17 AUGUSTUS stop_codon 39578 39580 . - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_17 AUGUSTUS CDS 39578 40560 0.51 - 2 transcript_id "g270.t1"; gene_id "g270"; Scaffold_17 AUGUSTUS CDS 40630 40648 0.55 - 0 transcript_id "g270.t1"; gene_id "g270"; Scaffold_17 AUGUSTUS start_codon 40646 40648 . - 0 transcript_id "g270.t1"; gene_id "g270"; # protein sequence = [MAISPFVLGYSFLSRYNPLIDWASRNITFRNTSHLILHRRLCLLPSTRCCKGRCSATGTFAVGFTDNSGDPSWGLTLL # SLSLPLSDFTGQAPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFAD # VFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPLCPKKDGKLRLCVDFRGQSYHQKDRLPLSRL # LAPKRAKIYTKLDSLTLIIWSESLKVTNGRPPFGPVRLLRMEGHAVRPYERPCGFPAVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g270 ### # start gene g271 Scaffold_17 AUGUSTUS gene 42832 43359 0.99 - . g271 Scaffold_17 AUGUSTUS transcript 42832 43359 0.99 - . g271.t1 Scaffold_17 AUGUSTUS stop_codon 42832 42834 . - 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_17 AUGUSTUS CDS 42832 43359 0.99 - 0 transcript_id "g271.t1"; gene_id "g271"; Scaffold_17 AUGUSTUS start_codon 43357 43359 . - 0 transcript_id "g271.t1"; gene_id "g271"; # protein sequence = [MEEEQQFEYSTLYTGDGQPVQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDL # DAVDHDDQDPPVDPDDPGADNNNDNLDDNSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPCSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g271 ### # start gene g272 Scaffold_17 AUGUSTUS gene 49473 52982 0.95 - . g272 Scaffold_17 AUGUSTUS transcript 49473 52982 0.95 - . g272.t1 Scaffold_17 AUGUSTUS stop_codon 49473 49475 . - 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_17 AUGUSTUS CDS 49473 52982 0.95 - 0 transcript_id "g272.t1"; gene_id "g272"; Scaffold_17 AUGUSTUS start_codon 52980 52982 . - 0 transcript_id "g272.t1"; gene_id "g272"; # protein sequence = [MFATSSYDSLPSCTISSIWELNSSSPHFRIHAKLRGRNHSITTAAMVDCGATALFLNQDFATRNHVTCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVHIEEVEDEQTSHPHLVASTTDSPIQELLN # EGSQREPNHTEADLEENEIITATEESPIHRIRANHKTRRAWVKAGILEEQTEEVWCSAGFTYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESA # SERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVAD # IISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVRE # VLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQ # QEAFDTLREAFISAPILALWAPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDII # TDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNQQQTVLKPGHFTKIAASILRNPLEDRIRKASEREAQV # LEGLETVKKHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNNLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEICARKKIQ # RHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRSLLA # RLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRILRE # ARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYRLDLPLSLDRLHPVFMSTNYIHGKVTP # SMAKYQHHQSRCT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g272 ### # start gene g273 Scaffold_17 AUGUSTUS gene 57959 59125 0.83 + . g273 Scaffold_17 AUGUSTUS transcript 57959 59125 0.83 + . g273.t1 Scaffold_17 AUGUSTUS start_codon 57959 57961 . + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_17 AUGUSTUS CDS 57959 59125 0.83 + 0 transcript_id "g273.t1"; gene_id "g273"; Scaffold_17 AUGUSTUS stop_codon 59123 59125 . + 0 transcript_id "g273.t1"; gene_id "g273"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g273 ### # start gene g274 Scaffold_17 AUGUSTUS gene 63524 64239 0.45 + . g274 Scaffold_17 AUGUSTUS transcript 63524 64239 0.45 + . g274.t1 Scaffold_17 AUGUSTUS start_codon 63524 63526 . + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_17 AUGUSTUS CDS 63524 63532 0.46 + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_17 AUGUSTUS CDS 63655 64239 0.88 + 0 transcript_id "g274.t1"; gene_id "g274"; Scaffold_17 AUGUSTUS stop_codon 64237 64239 . + 0 transcript_id "g274.t1"; gene_id "g274"; # protein sequence = [MTGERIRVANEVYAQYANQKHQEAPDWKEGDHVWLNMENVRTRRPMKKLDHKWTGSYSIWAKREPRVPIGPPWGPPQN # HNVFHVDRLKPHFHDKFKCQTSPPPPIFIKGEMEHFVEDILDSKPKKGRPEEVEYLVKWEGYSEEFNSWVGWEGMAGSLELLRSWHEKHPRKRQPSQR # HWARLVKDAQEDEEDEREDRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g274 ### # start gene g275 Scaffold_17 AUGUSTUS gene 64596 65033 0.9 - . g275 Scaffold_17 AUGUSTUS transcript 64596 65033 0.9 - . g275.t1 Scaffold_17 AUGUSTUS stop_codon 64596 64598 . - 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_17 AUGUSTUS CDS 64596 65033 0.9 - 0 transcript_id "g275.t1"; gene_id "g275"; Scaffold_17 AUGUSTUS start_codon 65031 65033 . - 0 transcript_id "g275.t1"; gene_id "g275"; # protein sequence = [MAAHHAGFVPPPDDSVEPPLHRRMLALSTALPHSEGVGRWEDIVPALPSIDQLTADWEQMMLQYIHHITDTPLPGTDP # QGPMSSVEPATESLPEVLVQQSPEAPAALESTSSVGPHPRVPLFLPEQESLKLPFPHSAPLFGSVAI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g275 ### # start gene g276 Scaffold_17 AUGUSTUS gene 70503 72158 0.33 + . g276 Scaffold_17 AUGUSTUS transcript 70503 72158 0.33 + . g276.t1 Scaffold_17 AUGUSTUS start_codon 70503 70505 . + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_17 AUGUSTUS CDS 70503 70660 0.56 + 0 transcript_id "g276.t1"; gene_id "g276"; Scaffold_17 AUGUSTUS CDS 70817 71235 0.81 + 1 transcript_id "g276.t1"; gene_id "g276"; Scaffold_17 AUGUSTUS CDS 71830 72158 0.96 + 2 transcript_id "g276.t1"; gene_id "g276"; Scaffold_17 AUGUSTUS stop_codon 72156 72158 . + 0 transcript_id "g276.t1"; gene_id "g276"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTHSPPYGKQPQRRAASESPRDPPPHF # DLDTGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSIETLGTVLAALGRPS # DSSESKSKVKEPEVFDAFGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNPSGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKA # RESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g276 ### # start gene g277 Scaffold_17 AUGUSTUS gene 80721 81969 0.35 - . g277 Scaffold_17 AUGUSTUS transcript 80721 81969 0.35 - . g277.t1 Scaffold_17 AUGUSTUS stop_codon 80721 80723 . - 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_17 AUGUSTUS CDS 80721 81359 0.69 - 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_17 AUGUSTUS CDS 81409 81969 0.35 - 0 transcript_id "g277.t1"; gene_id "g277"; Scaffold_17 AUGUSTUS start_codon 81967 81969 . - 0 transcript_id "g277.t1"; gene_id "g277"; # protein sequence = [MPPKTRAQSRANSEENTFFTTVQSFAPFTESISAIGQPRRRNHGFGPATIPTTSTLPEAMEEEQQFEYSTLFTSDGQP # VQVLTPRHGQPPVVAPGWGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVNPDDPGADNNHDDLDDNSGGLPRGEPG # DPVDLVDLVDLGSIETLGTVLAALGCPPDTSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTFSYLSGSAKEWFVPDILDPD # LDSLPAWTSSFKALVKELQDNFGVYDTQGEAEDSLGNLKMKETKNIRKYNIRFNTLAASTNWDSAALKWAYGQGLAECIKDEMALTSLPCFCVKEKGR # NLMGTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g277 ### # start gene g278 Scaffold_17 AUGUSTUS gene 89786 91520 0.56 + . g278 Scaffold_17 AUGUSTUS transcript 89786 91520 0.56 + . g278.t1 Scaffold_17 AUGUSTUS start_codon 89786 89788 . + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_17 AUGUSTUS CDS 89786 90141 0.77 + 0 transcript_id "g278.t1"; gene_id "g278"; Scaffold_17 AUGUSTUS CDS 90305 91520 0.57 + 1 transcript_id "g278.t1"; gene_id "g278"; Scaffold_17 AUGUSTUS stop_codon 91518 91520 . + 0 transcript_id "g278.t1"; gene_id "g278"; # protein sequence = [MRSPSPNANPKARGEQTPTQTRTKQGERDDDPDEQSRSNKKSKASHPTHPTHPTRTYTPVVPNGHGHGHSSSNTNTKN # PSSSPFAAFGASVVEEVGDEDEDEEMTSMEVVQGKDIKDKPTGPTQKNPTIPREPSKLRFSYKPDSEAGVPPPTVIPFGVSEGGFEGVSEGVSGDPRG # GAGAGAGSEGKSESESTAATAPRAFTNFVPKPAPTSAPTSVVSDPKHLVQSLPVADLPVFSFDVDVDVDVDKTVGAGGLLAKIGGGSGFGSGIGGSTS # GFGGSTSGFGGSTSGFGGSGSGNSASGNGFSASASASGSTKAKQTANQTPLSDLPHFDFDSVPVPVASTSTSSSTSFLPSSSKRDAPHPQPPPKSQKS # LAPSFDWAAAGLHPPDASQWVCPSCAVQNKPAAGRCVACDGAKPGISTAVALPAVQGPSAFSAPATAQTPAQAQAQAQTPAQVQAQVQVTAQAQAQAT # AKAQAPPAPAPAQSFNWEAVGMKKPEGKWECPACMCLNGMEVGRCPACDGAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g278 ### # start gene g279 Scaffold_17 AUGUSTUS gene 100784 101086 1 + . g279 Scaffold_17 AUGUSTUS transcript 100784 101086 1 + . g279.t1 Scaffold_17 AUGUSTUS start_codon 100784 100786 . + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_17 AUGUSTUS CDS 100784 101086 1 + 0 transcript_id "g279.t1"; gene_id "g279"; Scaffold_17 AUGUSTUS stop_codon 101084 101086 . + 0 transcript_id "g279.t1"; gene_id "g279"; # protein sequence = [MIGRKILTDPIDAHGHEAGAHAAPGPETLAQDNIEGEKDVRDLSRVMEEARAGSRSSRSLNREDESDLKETSRGNDAV # LDSPLTQILGVAILEFGVVLHR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g279 ### # start gene g280 Scaffold_17 AUGUSTUS gene 102015 104532 0.62 + . g280 Scaffold_17 AUGUSTUS transcript 102015 104532 0.62 + . g280.t1 Scaffold_17 AUGUSTUS start_codon 102015 102017 . + 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_17 AUGUSTUS CDS 102015 103339 0.78 + 0 transcript_id "g280.t1"; gene_id "g280"; Scaffold_17 AUGUSTUS CDS 104073 104532 0.82 + 1 transcript_id "g280.t1"; gene_id "g280"; Scaffold_17 AUGUSTUS stop_codon 104530 104532 . + 0 transcript_id "g280.t1"; gene_id "g280"; # protein sequence = [MALLRALLLGLSLLHCAFAAIFDLSELSWSLKNENGSIVVPGNVPSQAHIDLLKAGVITEPLLEINDFTQRWVWMDNW # TYTADLSKFFDTIQPASSDQTLLVFYGLDTIANITFAGIPIAWVNNQFRQYVYDLTPHIPAAAASGGNLTVEFESAFWYGLNVSSRPDAEFFPGGNGV # FEVPAARHYIRKQQIDFGWDWSPAFVPTGIYKPAYLVTLANESDTSSITLSSTPPLSPSGSTNTSDVIFIEEVAVDIYKLGSSFNVLPDQSADWVVNV # SLAIRAGASVEAPTVQLALPELDVSSEAFTIPTLNGHANETVWAIVQWQIPDAVPQRWYPHNLGTPQLYNLTATLSLPTSSPTSEPHKVSFTTRTGFR # TIRLVQLPVPQSDVTERGLTPGDQYHFEVNGKEFWSKGSNLVPFDPFYSRITTDRVQWVLQSAVTSGQKXFHSMPSIYAWEQALLSPGDFAFNSTVVV # SREHHNPAGSLAFPNPNAPEGQAEMTLAAEQWLPVPPFLGSNSSITSGSAQDNATFAAWCYTTQVFQALTIASEINFYRRGAGLPENNLGGIVWQLND # IWQAPSWSSIEFDGRWKVLAYAEERA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g280 ### # start gene g281 Scaffold_17 AUGUSTUS gene 112689 113036 0.26 - . g281 Scaffold_17 AUGUSTUS transcript 112689 113036 0.26 - . g281.t1 Scaffold_17 AUGUSTUS stop_codon 112689 112691 . - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_17 AUGUSTUS CDS 112689 113036 0.26 - 0 transcript_id "g281.t1"; gene_id "g281"; Scaffold_17 AUGUSTUS start_codon 113034 113036 . - 0 transcript_id "g281.t1"; gene_id "g281"; # protein sequence = [MHNITVMDAFFAGIRGLISHNSASIFEAEIRRFFETYMEDTDDMSRMEPNVFERAEKAWGEVELLRGKGRIARETERV # KAESAVAANEVLKKEMEEKGAEGAVNVPLASNGEVMM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g281 ### # start gene g282 Scaffold_17 AUGUSTUS gene 117381 118427 0.93 + . g282 Scaffold_17 AUGUSTUS transcript 117381 118427 0.93 + . g282.t1 Scaffold_17 AUGUSTUS start_codon 117381 117383 . + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_17 AUGUSTUS CDS 117381 118427 0.93 + 0 transcript_id "g282.t1"; gene_id "g282"; Scaffold_17 AUGUSTUS stop_codon 118425 118427 . + 0 transcript_id "g282.t1"; gene_id "g282"; # protein sequence = [MPRRAPANPNLNLPNQFIPLSQPACLKIPMAVGPRKNKILTTQSTTILTFFTPGASSSKSTITSVAQKKKRRTPSVNV # LPNQHEIIVIDSDSDEDDPSGPMLRKKRKTESKRERRAVDNSSDIEFVEHKTVAPSAEPSESYVPFGKPTSLLLDPSSSPKVSKTPSPTIAPAPFGKP # TVLLRSSKDNISLENEAGTSTEETFPEVLDIEDWDTGDDEVAQIVLDDELEDEVREVAPDQSTTATPSAEVSKSRSTPALKSQRPLSSFDIIKTSPTP # SSTTSDLYSVLLSSRKENDAWKEAVVAEDRGFRPSKSNGGRRKAPFYKVLQGMPIAVDAFKYGTIPSVTAYFLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g282 ### # start gene g283 Scaffold_17 AUGUSTUS gene 135696 136154 0.65 - . g283 Scaffold_17 AUGUSTUS transcript 135696 136154 0.65 - . g283.t1 Scaffold_17 AUGUSTUS stop_codon 135696 135698 . - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_17 AUGUSTUS CDS 135696 136154 0.65 - 0 transcript_id "g283.t1"; gene_id "g283"; Scaffold_17 AUGUSTUS start_codon 136152 136154 . - 0 transcript_id "g283.t1"; gene_id "g283"; # protein sequence = [MWFNQSVHPIQAFGICLTFAGLYMYNNAKSDVEKGEKKMMRVEAARDLKLPTTNADARMMAGTDSPPESYANTAMTSA # TGLGSASIVHGRPRAASAVSHLNAHNLSVKITPPSFNTKRSPKDRIASPTDSYPSPPPSLDSPPSSTVPSQVLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g283 ### # start gene g284 Scaffold_17 AUGUSTUS gene 139405 140033 0.73 - . g284 Scaffold_17 AUGUSTUS transcript 139405 140033 0.73 - . g284.t1 Scaffold_17 AUGUSTUS stop_codon 139405 139407 . - 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_17 AUGUSTUS CDS 139405 139971 0.73 - 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_17 AUGUSTUS CDS 140025 140033 0.75 - 0 transcript_id "g284.t1"; gene_id "g284"; Scaffold_17 AUGUSTUS start_codon 140031 140033 . - 0 transcript_id "g284.t1"; gene_id "g284"; # protein sequence = [MLKTGPAVLQNSIVSNVHHEDPVPAIEAMVGHVPKHPTPQDFVSASSGDNACTPVAQRFTVPVLSYQSTLSNSRQGCS # ASTSGAQNPKTSSIPSSTQPHVYRTVPLGGSIGYAARATHTQASADANLDPRNSTHIRSFRASESQLSTSVVRPNASGANGTFQDHDQSYLPTACPPP # SPEYSALCLPRPTYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g284 ### # start gene g285 Scaffold_17 AUGUSTUS gene 140575 141152 0.88 + . g285 Scaffold_17 AUGUSTUS transcript 140575 141152 0.88 + . g285.t1 Scaffold_17 AUGUSTUS start_codon 140575 140577 . + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_17 AUGUSTUS CDS 140575 140757 1 + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_17 AUGUSTUS CDS 140829 140977 0.93 + 0 transcript_id "g285.t1"; gene_id "g285"; Scaffold_17 AUGUSTUS CDS 141044 141152 0.88 + 1 transcript_id "g285.t1"; gene_id "g285"; Scaffold_17 AUGUSTUS stop_codon 141150 141152 . + 0 transcript_id "g285.t1"; gene_id "g285"; # protein sequence = [MSETEATQTAVAPADSEPQETSYGVIQESAPEGLAVEPIEPKTALTDQFTPKEWDALKAFRVEIPDALASAYPDKNNA # KTAAVKLWGVTIEPSNLLDAKVSVVLMKFLRASVSEGKTMFIATLRWRDQFNVEAACKEDFLKTCSDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g285 ### # start gene g286 Scaffold_17 AUGUSTUS gene 152621 153565 0.78 + . g286 Scaffold_17 AUGUSTUS transcript 152621 153565 0.78 + . g286.t1 Scaffold_17 AUGUSTUS start_codon 152621 152623 . + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_17 AUGUSTUS CDS 152621 153565 0.78 + 0 transcript_id "g286.t1"; gene_id "g286"; Scaffold_17 AUGUSTUS stop_codon 153563 153565 . + 0 transcript_id "g286.t1"; gene_id "g286"; # protein sequence = [MEPILLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEGRFAASRPYLPL # SEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEW # KTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYILS # PDGLTMSKEKVQTVLEWPVPRKVKDIQSFWVLQTSIVVYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g286 ### # start gene g287 Scaffold_17 AUGUSTUS gene 154022 155144 1 + . g287 Scaffold_17 AUGUSTUS transcript 154022 155144 1 + . g287.t1 Scaffold_17 AUGUSTUS start_codon 154022 154024 . + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_17 AUGUSTUS CDS 154022 154577 1 + 0 transcript_id "g287.t1"; gene_id "g287"; Scaffold_17 AUGUSTUS CDS 154666 155144 1 + 2 transcript_id "g287.t1"; gene_id "g287"; Scaffold_17 AUGUSTUS stop_codon 155142 155144 . + 0 transcript_id "g287.t1"; gene_id "g287"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFWKARFYEPRLSWISKPYTKLS # SRPPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVPNHGDLRLQVLAISMIIHSPAISARTALSKLYVVNTPGPRSETLFVTTLPLALSVVAI # SPAVIGLTASILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVLIMLLRSWFRICFGVFRALGKALSMELHYTSGYHPEADGQTERVNQTL # EQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVKSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g287 ### # start gene g288 Scaffold_17 AUGUSTUS gene 163791 164924 0.98 + . g288 Scaffold_17 AUGUSTUS transcript 163791 164924 0.98 + . g288.t1 Scaffold_17 AUGUSTUS start_codon 163791 163793 . + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_17 AUGUSTUS CDS 163791 164924 0.98 + 0 transcript_id "g288.t1"; gene_id "g288"; Scaffold_17 AUGUSTUS stop_codon 164922 164924 . + 0 transcript_id "g288.t1"; gene_id "g288"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDEL # HVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRRIHPVFHVSQLEPVTPNPF # PNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYTFGGPVTKVLMMNSPGLLLMNYMLTNLYRRSTPDTLTNLDLDHKKSFYSFPFSARSAE # VTLCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g288 ### # start gene g289 Scaffold_17 AUGUSTUS gene 177398 177685 0.7 - . g289 Scaffold_17 AUGUSTUS transcript 177398 177685 0.7 - . g289.t1 Scaffold_17 AUGUSTUS stop_codon 177398 177400 . - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_17 AUGUSTUS CDS 177398 177685 0.7 - 0 transcript_id "g289.t1"; gene_id "g289"; Scaffold_17 AUGUSTUS start_codon 177683 177685 . - 0 transcript_id "g289.t1"; gene_id "g289"; # protein sequence = [MSHSRTQTITTPSSTTAAVPLNPPPADPVNDDDEALEEDDDEAIRQAEETVRRMKARKAAAAARRKAEEEAAKKAAEE # AQRKKEAAARELEERRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g289 ### # start gene g290 Scaffold_17 AUGUSTUS gene 179156 180205 0.69 - . g290 Scaffold_17 AUGUSTUS transcript 179156 180205 0.69 - . g290.t1 Scaffold_17 AUGUSTUS stop_codon 179156 179158 . - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_17 AUGUSTUS CDS 179156 180205 0.69 - 0 transcript_id "g290.t1"; gene_id "g290"; Scaffold_17 AUGUSTUS start_codon 180203 180205 . - 0 transcript_id "g290.t1"; gene_id "g290"; # protein sequence = [MDIEKFNLKWSSTLTTLRNYGYNIPWDTLISKYISKLPSGPRYVYLKQVLEEEFDEPGAIPNRELFDKFAIHLENTRN # QELLDLSKSGGGSYNRRFQKTGTGSNDKPLDSQKPRDTPNSTKLNTKPTAYVMNANSHATTTTSKIENVDTVSDVTTVLPTNNTTVRSTYPARRLKPF # AALLSTLPSSPSPNECSTKNQPVAYSSMVQKKHTLLDSACTNHIVNDRRFFHTYNVDGAIAVQTANSGVLSTQASGTCYFETHIEGTTDTLILEMHDC # LFAPDAPVSLISVGTMLEHGFTFIILPDIVRIHPDADRHFIADVTNRLCFLRGKFILPDKDFTDPIHLAMPVFIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g290 ### # start gene g291 Scaffold_17 AUGUSTUS gene 188115 188792 0.38 - . g291 Scaffold_17 AUGUSTUS transcript 188115 188792 0.38 - . g291.t1 Scaffold_17 AUGUSTUS stop_codon 188115 188117 . - 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_17 AUGUSTUS CDS 188115 188792 0.38 - 0 transcript_id "g291.t1"; gene_id "g291"; Scaffold_17 AUGUSTUS start_codon 188790 188792 . - 0 transcript_id "g291.t1"; gene_id "g291"; # protein sequence = [MKEWTVKELLLGYLHEPIDSSLSDSFKTIPFRRHFQSFEQSPNYLKYFFALLGGSAREAFSSEFLSPDDCYQKMKEDL # QNLEDSKLRDIWSSKFNAHTMTNSIEEGISHKFFSVFPYDDDIRSKAAVRTPSDKILDMIITEYDRRFHQKKVDIFSQYLIAAGVGSRSMAAELYDTH # FHEYLLRLVNAGSVQVRAMKPPSKPRQSATQKTREWSTSDSYRHWQCPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g291 ### # start gene g292 Scaffold_17 AUGUSTUS gene 190447 191962 0.42 - . g292 Scaffold_17 AUGUSTUS transcript 190447 191962 0.42 - . g292.t1 Scaffold_17 AUGUSTUS stop_codon 190447 190449 . - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_17 AUGUSTUS CDS 190447 191152 0.96 - 1 transcript_id "g292.t1"; gene_id "g292"; Scaffold_17 AUGUSTUS CDS 191256 191279 0.67 - 1 transcript_id "g292.t1"; gene_id "g292"; Scaffold_17 AUGUSTUS CDS 191451 191962 0.58 - 0 transcript_id "g292.t1"; gene_id "g292"; Scaffold_17 AUGUSTUS start_codon 191960 191962 . - 0 transcript_id "g292.t1"; gene_id "g292"; # protein sequence = [MPATDVEAAPVSERLRYLHSISLPPKWELERELANRFISLGVIRSALDIYERLEMWEEVVKCHVSLDRPDRGITIVKD # LLAGNKVESEAVISREKASGAVDSMKRLQRFDSVREAKLWCILGDIEPEHAVEHYKRAWGISKNTSGRAMRSLGGFYFARAEYGLARNAYKNPPTRMV # ILQALKEGLRRSYDNWRMWSNYMIIAVDVGELAEACRALGRVVEETSNQAGGVVLDEDVLDRLVNAVTRAPSDPQEAVAISNSDQVQYSLNPNEGHGL # LPRVLDLFDRIILPRVSSTRVFRAYARLLTWMGRWEDTMKAWMDAYRESDAGKLTRGELDTVAVVGDDMGRRVWRDAVGEVEEIVDILRNVGARLASS # SAKKWRLQAKSVVRSFMARTRENFEDDSEWIRLEELLDGLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g292 ### # start gene g293 Scaffold_17 AUGUSTUS gene 192460 193197 0.37 - . g293 Scaffold_17 AUGUSTUS transcript 192460 193197 0.37 - . g293.t1 Scaffold_17 AUGUSTUS stop_codon 192460 192462 . - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_17 AUGUSTUS CDS 192460 193197 0.37 - 0 transcript_id "g293.t1"; gene_id "g293"; Scaffold_17 AUGUSTUS start_codon 193195 193197 . - 0 transcript_id "g293.t1"; gene_id "g293"; # protein sequence = [MTEMNVVAIEKSLLNGHWDNSFPHTPLVDVAQAVVRGRFGEALTSSYAQQLFQFRLADTLKNSFNISASLMQDGPQNE # LLRLALAVACLHAFLQVNWTGPDLDFQPLDILSQTESHDLSNETLNGLAISELALGGEPAYHLAQHAIFLRLAQILLDAPYHHCQTAIWWRLRAHLVH # QQVIDEPVILPDNDMTTFEHWQSPFALDSPDLNGRLLLEHGLLHHIFQQDKIAAEYFVKAARATIYSTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g293 ### # start gene g294 Scaffold_17 AUGUSTUS gene 198128 199310 0.12 + . g294 Scaffold_17 AUGUSTUS transcript 198128 199310 0.12 + . g294.t1 Scaffold_17 AUGUSTUS start_codon 198128 198130 . + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_17 AUGUSTUS CDS 198128 198133 0.12 + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_17 AUGUSTUS CDS 198219 199310 0.89 + 0 transcript_id "g294.t1"; gene_id "g294"; Scaffold_17 AUGUSTUS stop_codon 199308 199310 . + 0 transcript_id "g294.t1"; gene_id "g294"; # protein sequence = [MDDPFADSNGQSPNGILERLRLENDAASTDYDPLASDQRGTHWLKEQNERAKRSLGVLPASSASDESSFSLLEQEDQV # GPLSLQRAPTGRYYYEYDSEASQSQMTGPEDRGFEIDPSIDGGINGKPRPTSRQWAWVTAQQDATALRPPPHTHRSDPSLETIVPAEILQNLDPPRGE # NLTCCSGCGRFLNYVKYVCYTCRDKETGSDISSPTSSNKGKGRDCPPFTYPPTPLQTNIYTSPLSLNFSSSSNTFVGSPSKRRPLPPQPSVSTSFATL # VPPTSPRMATGYELCYECIDEVGHMHAIEAMNEPGSSPTTSNLSSSSPKDAAVQWRRAPPKQKGQLRHAYVEKIWGHNGWDDIGQRWFTYI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g294 ### # start gene g295 Scaffold_17 AUGUSTUS gene 215851 216553 0.48 + . g295 Scaffold_17 AUGUSTUS transcript 215851 216553 0.48 + . g295.t1 Scaffold_17 AUGUSTUS start_codon 215851 215853 . + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_17 AUGUSTUS CDS 215851 216058 0.48 + 0 transcript_id "g295.t1"; gene_id "g295"; Scaffold_17 AUGUSTUS CDS 216117 216553 0.99 + 2 transcript_id "g295.t1"; gene_id "g295"; Scaffold_17 AUGUSTUS stop_codon 216551 216553 . + 0 transcript_id "g295.t1"; gene_id "g295"; # protein sequence = [MRMVSSKDLDVFASLRGKESSAVALKATTSSPPLEIQSSTSVSKAFVAPPRLIRRNRELENLKADASSFLASPRSAHS # KDSDNELLSGFPSAGSAPVASSSTKVSIGKGEPKSKTTVKVVEDSKADRPLPAGMAYKRIRLPPRSRKNTSIASKGKARQIVVTDEGSTSNEVESEDE # AEDEDIAPPPKRLKTTSSISGRIFILHFSSHFINLIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g295 ### # start gene g296 Scaffold_17 AUGUSTUS gene 221805 222950 0.92 - . g296 Scaffold_17 AUGUSTUS transcript 221805 222950 0.92 - . g296.t1 Scaffold_17 AUGUSTUS stop_codon 221805 221807 . - 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_17 AUGUSTUS CDS 221805 222950 0.92 - 0 transcript_id "g296.t1"; gene_id "g296"; Scaffold_17 AUGUSTUS start_codon 222948 222950 . - 0 transcript_id "g296.t1"; gene_id "g296"; # protein sequence = [MACRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAV # DTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKGMLDNPSCGPNATINRWIEHVRN # YHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEER # SYEIRRNHMLESKDATCEVFSRNLFPTFDEEFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESLGEMSKDERIKFIRLIKIFKGRPRKVVPLE # VLINLINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g296 ### # start gene g297 Scaffold_17 AUGUSTUS gene 224062 226297 0.25 - . g297 Scaffold_17 AUGUSTUS transcript 224062 226297 0.25 - . g297.t1 Scaffold_17 AUGUSTUS stop_codon 224062 224064 . - 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_17 AUGUSTUS CDS 224062 224792 0.6 - 2 transcript_id "g297.t1"; gene_id "g297"; Scaffold_17 AUGUSTUS CDS 224867 225130 0.25 - 2 transcript_id "g297.t1"; gene_id "g297"; Scaffold_17 AUGUSTUS CDS 225226 226297 0.34 - 0 transcript_id "g297.t1"; gene_id "g297"; Scaffold_17 AUGUSTUS start_codon 226295 226297 . - 0 transcript_id "g297.t1"; gene_id "g297"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSID # DERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDATPFQVLLGRPFDVLV # ESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDLKGNFHSSMNGYKRCEQETFSKKELSEAYVLASR # EHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQFNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSEST # ETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRYESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKL # NQQDRSPINLIDETNKQVIMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g297 ### # start gene g298 Scaffold_17 AUGUSTUS gene 226327 226647 0.64 - . g298 Scaffold_17 AUGUSTUS transcript 226327 226647 0.64 - . g298.t1 Scaffold_17 AUGUSTUS stop_codon 226327 226329 . - 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_17 AUGUSTUS CDS 226327 226647 0.64 - 0 transcript_id "g298.t1"; gene_id "g298"; Scaffold_17 AUGUSTUS start_codon 226645 226647 . - 0 transcript_id "g298.t1"; gene_id "g298"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEE # LSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g298 ### # start gene g299 Scaffold_17 AUGUSTUS gene 226692 227723 1 - . g299 Scaffold_17 AUGUSTUS transcript 226692 227723 1 - . g299.t1 Scaffold_17 AUGUSTUS stop_codon 226692 226694 . - 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_17 AUGUSTUS CDS 226692 227723 1 - 0 transcript_id "g299.t1"; gene_id "g299"; Scaffold_17 AUGUSTUS start_codon 227721 227723 . - 0 transcript_id "g299.t1"; gene_id "g299"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFD # NYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQ # SHFKEGADIMTQLTAVMAQMAKENAKGMINSIPPSGPSNQSNRFERNTTPKVRMELSGHVSCASRQIIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g299 ### # start gene g300 Scaffold_17 AUGUSTUS gene 233437 233757 0.41 - . g300 Scaffold_17 AUGUSTUS transcript 233437 233757 0.41 - . g300.t1 Scaffold_17 AUGUSTUS stop_codon 233437 233439 . - 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_17 AUGUSTUS CDS 233437 233757 0.41 - 0 transcript_id "g300.t1"; gene_id "g300"; Scaffold_17 AUGUSTUS start_codon 233755 233757 . - 0 transcript_id "g300.t1"; gene_id "g300"; # protein sequence = [MKEQYKRLDTLTVFPYLRTPPTSSSKSFSSPKSLTHSSTAPTYTLNASSAFRNVLARFRITCEFGNGSWKFVVFVETV # SAKEGGGDEKGGGNDAAYASNEVTEAFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g300 ### # start gene g301 Scaffold_17 AUGUSTUS gene 234117 236321 0.29 + . g301 Scaffold_17 AUGUSTUS transcript 234117 236321 0.29 + . g301.t1 Scaffold_17 AUGUSTUS start_codon 234117 234119 . + 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_17 AUGUSTUS CDS 234117 234141 0.63 + 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_17 AUGUSTUS CDS 234251 234816 0.41 + 2 transcript_id "g301.t1"; gene_id "g301"; Scaffold_17 AUGUSTUS CDS 234861 236321 0.9 + 0 transcript_id "g301.t1"; gene_id "g301"; Scaffold_17 AUGUSTUS stop_codon 236319 236321 . + 0 transcript_id "g301.t1"; gene_id "g301"; # protein sequence = [MRSRNVAGVPHTSEHKPLPPLIAPVPIHPPEFHHRDDRPSSDLSSIAPSQSASQTEFTRPSPPPPLPPSQQPVISPRP # HTSHIYSDFEAISGASPLSSAHGHDHDHDFMSSHIPPAHSIEDALNILPTLDSDATITISHSDRRHVLPRRITEEDLGLSVDHGGDEERKADGDALDS # DEESDGTVYSDAEDIHANDLRTDDTHLDPDSNIRSTSKLSLHPPNSPIKNPVNALTPNPNMNHTLIPVSNSNSFASGSASASGFFGSLRGLFTRNAKG # GKDSKKAIGGIFHDERDKEEDGSVVSSPPFFPSSSSTPAMPTAYSIRGRTMSEAHTPSTRSTNSTSTIIRTPTSPSRTSRVGTTTTDTGNGKKLKKSP # GVGPGSGPRGRTPSNNVPPTELAQRRRSASVDYGELSVRSRNVPRPRSRAEEWVEGQGQREQHQREASVMETKEEENSALTKKTSVKRRKSDKRRSLP # VSSATSSSPSPPSSSSPLPSKPPRAPPTGDTPKKSMSVSVSRTSSIRSAASAPTSSSMSTSTTTTKQTTNQATNTKPDRRSSAPPVGGSTNGHGRPAE # LSGGTSLMSIVEDVAKANREGWGKVDKEKENIGAGSGLGVELRVREEEEEGANTLSSKKQPTSIALEDVRAPRGIDLEDLKEQMERERAEKLEKRGHV # LSQCKKISFALFCVDFD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g301 ### # start gene g302 Scaffold_17 AUGUSTUS gene 250601 251161 0.92 + . g302 Scaffold_17 AUGUSTUS transcript 250601 251161 0.92 + . g302.t1 Scaffold_17 AUGUSTUS start_codon 250601 250603 . + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_17 AUGUSTUS CDS 250601 251161 0.92 + 0 transcript_id "g302.t1"; gene_id "g302"; Scaffold_17 AUGUSTUS stop_codon 251159 251161 . + 0 transcript_id "g302.t1"; gene_id "g302"; # protein sequence = [MHSPALPPPSSKGQSTPETETGSGRSRYKRFETPASPGEYHNISQEVVDMLVDLEVIHSTPPLNNLIFTFAQTNSGVF # SHSGRFPALASPVHHNTSQGVMVISLDSGVPQSTPLPTNVPSRTDGRSPTTEYRSPGQFQTEDLSSQKREETLTADLNAPQLDLVTLSEIRSSKQNAS # FSSSSGPSWQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g302 ### # start gene g303 Scaffold_17 AUGUSTUS gene 251346 252068 0.76 + . g303 Scaffold_17 AUGUSTUS transcript 251346 252068 0.76 + . g303.t1 Scaffold_17 AUGUSTUS start_codon 251346 251348 . + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_17 AUGUSTUS CDS 251346 252068 0.76 + 0 transcript_id "g303.t1"; gene_id "g303"; Scaffold_17 AUGUSTUS stop_codon 252066 252068 . + 0 transcript_id "g303.t1"; gene_id "g303"; # protein sequence = [MSKLVTPSRKSESQSDFELQRGNTDRGGGRRRGGVDYCDCSEYEDDGPHLSQLFSLSSLSPLSTTYNSDVEIDDAEEI # DEEERDSEDNCEHDSDLILTVRMPPLPPPHLPLIPQYPHLHSKYQIPMIEETGLWTIPSPKSTEEELGNSESRHIRQEERPFDFTSTTSTPDIKDEFY # SMSHYGPISLGQGGFADGVRAPSPHPLDLEAELIHREFLSFPPRDRLSSPAVVRINSMVQGALA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g303 ### # start gene g304 Scaffold_17 AUGUSTUS gene 256831 258660 0.97 - . g304 Scaffold_17 AUGUSTUS transcript 256831 258660 0.97 - . g304.t1 Scaffold_17 AUGUSTUS stop_codon 256831 256833 . - 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_17 AUGUSTUS CDS 256831 258660 0.97 - 0 transcript_id "g304.t1"; gene_id "g304"; Scaffold_17 AUGUSTUS start_codon 258658 258660 . - 0 transcript_id "g304.t1"; gene_id "g304"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLIPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSSDLQEHRRVVREVLIRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPAPTNLRELRGF # LGFANFYRRFIRNFARIARPLNDLTRKDISFTWMDTQQQAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGALMQKQDDGQWHPVAFRSASMQP # AERNYEIYDREMLAIIEALKDWRNFLEGLPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRINTQADALSRMAAHQVLDNEDNR # QQTVLKPNHFTKIAASILRNPLEDRIRKASQREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPADNDLRTEVLRQCHDHPTAGHPGL # HGTLDLVSTHFWWPTLRSFVEKYVEGCETCARKKSKDTHEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g304 ### # start gene g305 Scaffold_17 AUGUSTUS gene 259490 260467 0.98 - . g305 Scaffold_17 AUGUSTUS transcript 259490 260467 0.98 - . g305.t1 Scaffold_17 AUGUSTUS stop_codon 259490 259492 . - 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_17 AUGUSTUS CDS 259490 260467 0.98 - 0 transcript_id "g305.t1"; gene_id "g305"; Scaffold_17 AUGUSTUS start_codon 260465 260467 . - 0 transcript_id "g305.t1"; gene_id "g305"; # protein sequence = [MAQFQNWASEQPDLTKSQAKLIKSALGFFTESAGDWATPHLLHFNAEHPPFGGNWEEFLKEFGQRFESVDPGMEARSE # IKNLKQSKGQTVAEFAQKFKDIGDRTGMSDIDLRERFFTALLPEIRQNLIIVNIAQGLAPTLKEAIKRAISVDVYMHDPTMTGRNSGHTPTHAAHTTP # ADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQISATGPTPFSLFPNESVQI # ASSTPTSAPATVPATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g305 ### # start gene g306 Scaffold_17 AUGUSTUS gene 265614 266243 0.96 + . g306 Scaffold_17 AUGUSTUS transcript 265614 266243 0.96 + . g306.t1 Scaffold_17 AUGUSTUS start_codon 265614 265616 . + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_17 AUGUSTUS CDS 265614 266243 0.96 + 0 transcript_id "g306.t1"; gene_id "g306"; Scaffold_17 AUGUSTUS stop_codon 266241 266243 . + 0 transcript_id "g306.t1"; gene_id "g306"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVHSPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g306 ### # start gene g307 Scaffold_17 AUGUSTUS gene 270120 274358 0.75 + . g307 Scaffold_17 AUGUSTUS transcript 270120 274358 0.75 + . g307.t1 Scaffold_17 AUGUSTUS start_codon 270120 270122 . + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_17 AUGUSTUS CDS 270120 274358 0.75 + 0 transcript_id "g307.t1"; gene_id "g307"; Scaffold_17 AUGUSTUS stop_codon 274356 274358 . + 0 transcript_id "g307.t1"; gene_id "g307"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEASQQPPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAMEKVTPKPTKDSEEAYQKWKSRDTERSSSWPGAKQKVRWRKKRREHGPYPDL # PTLDIESLNIPKIPSRSGLTPKGSIRRNNFRRKQLIAGTHVVERKSDPTIQGKPISLIGAAGMDRLLREGTPAYFLHISPTKEESPTEEMLRASDSSA # TEGVQQPKDPESGDPSSEQGGVVKELDKEESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDIKIETEGDAIPPIGKLYNMSEKELKSLKE # YIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTKIDLRAGYNNVRVAQGHEWKTAFRTRYGS # FEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIYSDDEASHVGHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEK # VKAVMDWPKPRTVKELQAFLGFANFYRRFIDNYSGITKVFTKLLRKDSVWNWTPQCSSAFELLKSAFSEAPVLGHYNPDLPVVLECDASDLAIAGILS # QLDPETGEIHPIAFHARSMISAELNYDIYDKELLAIVDCFKQWRAYCEGSRHQIQVYSDHNNLQYFTTTKQLTARQARWAELLSGYDFVINYRPGRLG # AKPDALTRRSDVYPKRGASRDQVLAGRERVLIPPERLNATILMNEDLLVNRVREAPKDTTIIEALKRIARNEEESFVWEDGLIKRGGRIYVPDVGTLR # REVLQSYHDHKLRGHPGEKRTKKLVNQLFFWKGLSKDVNYYVRSCHSCLRAKASRSKPYGNLRPLPIGQRPWSSISLDHITQLPATAGPEKYDAILVV # VCRLTKQAIYVPCHTTDKAEDFANLFITYVFSKHGMPSDITSDRGSLFVSQFWRELCRALGIESRLSTAYHPQTDGQTERVNQSVEAYLRIYCSYDQD # DWDLLLPMAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQEAEVNEYASNLKELHAYLQERIEVANKVYAKYANQKRQEAPDWKEGDQVWLNME # NVRTRRPMKKLDHKWTGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGKTEHFVEDILDSKPKKGRPEEVEYLV # KWEGYNDEFNSWVGWEGMVGSIELLRSWHKHHPRKRQPSRLQWASLEREAREDEEEGSGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g307 ### # start gene g308 Scaffold_17 AUGUSTUS gene 274598 277205 0.59 - . g308 Scaffold_17 AUGUSTUS transcript 274598 277205 0.59 - . g308.t1 Scaffold_17 AUGUSTUS stop_codon 274598 274600 . - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_17 AUGUSTUS CDS 274598 275729 0.75 - 1 transcript_id "g308.t1"; gene_id "g308"; Scaffold_17 AUGUSTUS CDS 275893 277205 0.59 - 0 transcript_id "g308.t1"; gene_id "g308"; Scaffold_17 AUGUSTUS start_codon 277203 277205 . - 0 transcript_id "g308.t1"; gene_id "g308"; # protein sequence = [MSAPLRRSSSRTRSPQLPILTTIGEVPSPDLESDGEAEQDQLAFTIEFPSRPQLQLFETVFNTGKPLSGYCQDDPLWP # LLAEVASPCSNCSKSPAKCKVLPNSPRCTNCSVKKTCSLGKILRYRYFARRCNQDLAYSRRFLELHGTPAHQSTWGIPMVTWRQYDAALHERTSSTST # LLELNMLDDQDAADVDQQELRDFLALQQEEAAVAAKRKRDLSPLPVAGPSSKKVRSNASKKRPRRRSPVQETAEESPRRVRLVVPPVRSLPVTTSTPL # PPRAFPSSMEVPDADLSVQGHSNLVRLAAVAGAQSGLVQQPAVSSSIKGTGQDLLSSNMPPVPRPTLVPRALATHPYRAENQRLAARVRLLESQLSDS # QRENSSLTSALRDTSHALESRQREVEQLRSSSREVREQQVEYRRVLDQFRALDEALPGPPDRVRILLLYQQGVVDESNALATRQRRLVEELQEEVHRA # RGRAAFVEQMIKEYPDEGYYEVVLPPLSQLEGDLHKAREDLRRVATFAHRLYRSEPATVLHHHYRYLGAIIEAVVAFLRRGLDSDDLDTVVHNFQLGL # DYMQAARGVHGDMYMRSLSSIQWFFNNAVDEDEGLYRMVLEHSRFDNDGPFLTAAQHAGFAPPPDSSLEPPLHRRMFALSTALPHSDGAGRWDDIVPA # LPSIDQLTADWEQLMLQYIHHITDTPLPVPDPPVPMSSMGPVPESSGEANVEQSLEAPIVQVSSPSAGSHPPVPLFLSEQESPTSPSPPPCSPVPPLL # FGSVASLSIDLTGDDDELYETEESYAGRIAVAREGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g308 ### # start gene g309 Scaffold_17 AUGUSTUS gene 283507 285478 0.2 + . g309 Scaffold_17 AUGUSTUS transcript 283507 285478 0.2 + . g309.t1 Scaffold_17 AUGUSTUS start_codon 283507 283509 . + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_17 AUGUSTUS CDS 283507 283717 0.5 + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_17 AUGUSTUS CDS 283781 284173 0.72 + 2 transcript_id "g309.t1"; gene_id "g309"; Scaffold_17 AUGUSTUS CDS 284227 284261 0.39 + 2 transcript_id "g309.t1"; gene_id "g309"; Scaffold_17 AUGUSTUS CDS 284480 284612 0.59 + 0 transcript_id "g309.t1"; gene_id "g309"; Scaffold_17 AUGUSTUS CDS 284934 285478 0.9 + 2 transcript_id "g309.t1"; gene_id "g309"; Scaffold_17 AUGUSTUS stop_codon 285476 285478 . + 0 transcript_id "g309.t1"; gene_id "g309"; # protein sequence = [MMRSVPSKDLDVFASLRGKVSPVVASKISTLSPPLEIKSSTSVPKAPVAPPRLIRRNRELESLKADASTFFSSPRSTR # SRDSDNELLSGFPSAVSASRASSSTKVSTDRKEPKPKTTVKVVEDSKASKPTSSAMVYKRVRLPSRSRKIAPTTAKGKSRQVVVSDDDSASNEVESED # EEEDEDEEEDSAPPPKRLKTTSSLPASLPRRSVKRVTNSAALNRENPLLAINPDFVELGSILETQNARFTMQDLMQVNRVIHLAISLRRAIDLNDQLK # QLESLFDSTRDLFLSRSDLQNAGEDPIVVLEALKAAEPNRRAISLNEWTLMATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDDKGHL # VESSPPPDSATEALEGLKEVERGSADEGTSSQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/5 # CDS introns: 0/4 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g309 ### # start gene g310 Scaffold_17 AUGUSTUS gene 287209 287982 0.38 + . g310 Scaffold_17 AUGUSTUS transcript 287209 287982 0.38 + . g310.t1 Scaffold_17 AUGUSTUS start_codon 287209 287211 . + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_17 AUGUSTUS CDS 287209 287231 0.46 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_17 AUGUSTUS CDS 287342 287478 0.82 + 1 transcript_id "g310.t1"; gene_id "g310"; Scaffold_17 AUGUSTUS CDS 287560 287711 0.74 + 2 transcript_id "g310.t1"; gene_id "g310"; Scaffold_17 AUGUSTUS CDS 287791 287982 0.74 + 0 transcript_id "g310.t1"; gene_id "g310"; Scaffold_17 AUGUSTUS stop_codon 287980 287982 . + 0 transcript_id "g310.t1"; gene_id "g310"; # protein sequence = [MNSASEDEIVAALPIPHTGSNKGSNKEEKSAVNDVSPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPAP # LESQSTKFIAATLNFQAAEFEFNANLTGSDSSVLTQVSLLLRVFHHGSEDTVVTPTEMAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g310 ### # start gene g311 Scaffold_17 AUGUSTUS gene 288294 289269 0.4 - . g311 Scaffold_17 AUGUSTUS transcript 288294 289269 0.4 - . g311.t1 Scaffold_17 AUGUSTUS stop_codon 288294 288296 . - 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_17 AUGUSTUS CDS 288294 288820 0.95 - 2 transcript_id "g311.t1"; gene_id "g311"; Scaffold_17 AUGUSTUS CDS 288948 289269 0.4 - 0 transcript_id "g311.t1"; gene_id "g311"; Scaffold_17 AUGUSTUS start_codon 289267 289269 . - 0 transcript_id "g311.t1"; gene_id "g311"; # protein sequence = [MSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQMKNMLAWLEEKYGIKGIR # ISAYNSQANGKIERAHLDIRQALIKATGGLESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQ # LVQVRNSGIEKSLDRKMYPRYRGPMVVIRRTKGGSYIIAEMDGTVLKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYCHQKMI # TYSMPYRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g311 ### # start gene g312 Scaffold_17 AUGUSTUS gene 289629 290662 0.24 - . g312 Scaffold_17 AUGUSTUS transcript 289629 290662 0.24 - . g312.t1 Scaffold_17 AUGUSTUS stop_codon 289629 289631 . - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_17 AUGUSTUS CDS 289629 290104 0.97 - 2 transcript_id "g312.t1"; gene_id "g312"; Scaffold_17 AUGUSTUS CDS 290197 290662 0.26 - 0 transcript_id "g312.t1"; gene_id "g312"; Scaffold_17 AUGUSTUS start_codon 290660 290662 . - 0 transcript_id "g312.t1"; gene_id "g312"; # protein sequence = [MASCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLA # VDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCRRLTVETDASYIKACATHGPDGLSRITPGGWQTKR # PEVNPEDYVDEDGGEPINFIMGDGETEEPYQFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLFPTFDE # EFVQNNPYPEAHRSSEGNRLDELIPLIGKYLSNPSDESW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g312 ### # start gene g313 Scaffold_17 AUGUSTUS gene 291768 292243 0.63 - . g313 Scaffold_17 AUGUSTUS transcript 291768 292243 0.63 - . g313.t1 Scaffold_17 AUGUSTUS stop_codon 291768 291770 . - 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_17 AUGUSTUS CDS 291768 292164 0.69 - 1 transcript_id "g313.t1"; gene_id "g313"; Scaffold_17 AUGUSTUS CDS 292221 292243 0.71 - 0 transcript_id "g313.t1"; gene_id "g313"; Scaffold_17 AUGUSTUS start_codon 292241 292243 . - 0 transcript_id "g313.t1"; gene_id "g313"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRIVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQADVVTEPPTNKLEERIKLNQQDRSPINLIDETNKQVIMKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g313 ### # start gene g314 Scaffold_17 AUGUSTUS gene 292415 294003 0.34 - . g314 Scaffold_17 AUGUSTUS transcript 292415 294003 0.34 - . g314.t1 Scaffold_17 AUGUSTUS stop_codon 292415 292417 . - 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_17 AUGUSTUS CDS 292415 293373 0.6 - 2 transcript_id "g314.t1"; gene_id "g314"; Scaffold_17 AUGUSTUS CDS 293493 294003 0.34 - 0 transcript_id "g314.t1"; gene_id "g314"; Scaffold_17 AUGUSTUS start_codon 294001 294003 . - 0 transcript_id "g314.t1"; gene_id "g314"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLNGETEI # LDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESFLRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEI # NNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNKAPFQVLLGRPFDVLVESEIKTFG # NGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGENDFKGKFSFLDELSSDQGEDEYAISFHFDEKQNIVLDGYKRCEQ # ETFSKKSFLKHMFLHLGNI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g314 ### # start gene g315 Scaffold_17 AUGUSTUS gene 294033 294302 0.68 - . g315 Scaffold_17 AUGUSTUS transcript 294033 294302 0.68 - . g315.t1 Scaffold_17 AUGUSTUS stop_codon 294033 294035 . - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_17 AUGUSTUS CDS 294033 294302 0.68 - 0 transcript_id "g315.t1"; gene_id "g315"; Scaffold_17 AUGUSTUS start_codon 294300 294302 . - 0 transcript_id "g315.t1"; gene_id "g315"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVR # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g315 ### # start gene g316 Scaffold_17 AUGUSTUS gene 294689 295552 0.79 - . g316 Scaffold_17 AUGUSTUS transcript 294689 295552 0.79 - . g316.t1 Scaffold_17 AUGUSTUS stop_codon 294689 294691 . - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_17 AUGUSTUS CDS 294689 295552 0.79 - 0 transcript_id "g316.t1"; gene_id "g316"; Scaffold_17 AUGUSTUS start_codon 295550 295552 . - 0 transcript_id "g316.t1"; gene_id "g316"; # protein sequence = [MTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDITDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKT # RQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRR # GVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPINNPNSFSRGHINLPFAADVPKTDRNYLQALKPKVEDEFKD # LLGIKLESLIQGN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g316 ### # start gene g317 Scaffold_17 AUGUSTUS gene 299293 300015 0.56 - . g317 Scaffold_17 AUGUSTUS transcript 299293 300015 0.56 - . g317.t1 Scaffold_17 AUGUSTUS stop_codon 299293 299295 . - 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_17 AUGUSTUS CDS 299293 300015 0.56 - 0 transcript_id "g317.t1"; gene_id "g317"; Scaffold_17 AUGUSTUS start_codon 300013 300015 . - 0 transcript_id "g317.t1"; gene_id "g317"; # protein sequence = [MSNPTPAPTTTTSNIHGKSLLREPSIFDGDKAQFKEWRRTLFAYIRDPRNRIVTDSERIDIAVSYMRGPKVSSWVQNY # TDDNFNDDEEEWKVTWKGFKDALNASFLDKGLTENAQEKLEHLRQGPNERAEDFFKEFEVIMRDAGYAKDAPYVIRLIEMNVKPKLIDQVYGTSNERI # EKFDELKQKIISIDDMWWRREEMRRNWSSRYQRNAGQGPSNQRWQPQTTQASRTDSDSCGTHPG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g317 ### # start gene g318 Scaffold_17 AUGUSTUS gene 305016 306037 0.42 - . g318 Scaffold_17 AUGUSTUS transcript 305016 306037 0.42 - . g318.t1 Scaffold_17 AUGUSTUS stop_codon 305016 305018 . - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_17 AUGUSTUS CDS 305016 305861 1 - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_17 AUGUSTUS CDS 306035 306037 0.42 - 0 transcript_id "g318.t1"; gene_id "g318"; Scaffold_17 AUGUSTUS start_codon 306035 306037 . - 0 transcript_id "g318.t1"; gene_id "g318"; # protein sequence = [MDGVGVGGSGLISAGVTATEGNLDHAQLMDQVKFPIIPYNLFLFYLQYTALRNTVRFLRTENAYLRGYDLIREIQALP # LIPVPRSSRPPTPALAPSGLSDTDTDTEGDEEYNDPASRTTLKKSSSSQPLPLLTETKLVYRSVMKYTSSPRVVDLSEVNARRLEVSRRRGLRLQKGR # KNGQIEMREDGDMEEVAADREKDNGVLEGEGIKDAETGIEKLDPIGSTAPEIPRRPSPSGVWMPRKRMPAHQVLERKIRGERLGERVRGLMERVERAS # VVRVGGGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g318 ### # start gene g319 Scaffold_17 AUGUSTUS gene 312976 313388 0.66 + . g319 Scaffold_17 AUGUSTUS transcript 312976 313388 0.66 + . g319.t1 Scaffold_17 AUGUSTUS start_codon 312976 312978 . + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_17 AUGUSTUS CDS 312976 313036 0.7 + 0 transcript_id "g319.t1"; gene_id "g319"; Scaffold_17 AUGUSTUS CDS 313126 313388 0.66 + 2 transcript_id "g319.t1"; gene_id "g319"; Scaffold_17 AUGUSTUS stop_codon 313386 313388 . + 0 transcript_id "g319.t1"; gene_id "g319"; # protein sequence = [MTSTTSRSVIDGVQEIKVVGEYDLESLSESMSSRHETLGRSMLNNKFDIADSGISRISFSALQVYSRGSALSSESEIS # ISFNRSSLRFGQYEISTQACPGDTWLIAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g319 ### # start gene g320 Scaffold_17 AUGUSTUS gene 317655 318392 0.93 - . g320 Scaffold_17 AUGUSTUS transcript 317655 318392 0.93 - . g320.t1 Scaffold_17 AUGUSTUS stop_codon 317655 317657 . - 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_17 AUGUSTUS CDS 317655 318392 0.93 - 0 transcript_id "g320.t1"; gene_id "g320"; Scaffold_17 AUGUSTUS start_codon 318390 318392 . - 0 transcript_id "g320.t1"; gene_id "g320"; # protein sequence = [MDRITRGAYVGRLSPTSRVTSNPPENFESRDSSRPVREVTGLTDAIPSPLIRIHSECFTGETVGSMRCDCGEQLDEAI # RLISQPIAIPSQSFSTPSKVLPGRGAVIYLRQEGRGIGLLSKIRAYNLQDLGHDTVTANLMLGHQADERGYEVACAILRDLGLGNPDGAGENVRVLTN # NPDKVEALEKEGIRVVERVPMIPKKLEDPQLVDHVMLAPVDDARVAGATLIGGGAVHGEDLDKFFVRRC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g320 ### # start gene g321 Scaffold_17 AUGUSTUS gene 321030 321395 0.59 + . g321 Scaffold_17 AUGUSTUS transcript 321030 321395 0.59 + . g321.t1 Scaffold_17 AUGUSTUS start_codon 321030 321032 . + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_17 AUGUSTUS CDS 321030 321395 0.59 + 0 transcript_id "g321.t1"; gene_id "g321"; Scaffold_17 AUGUSTUS stop_codon 321393 321395 . + 0 transcript_id "g321.t1"; gene_id "g321"; # protein sequence = [MENVALRNENTALRAGNAALRNTQSSMETSMKKLWQDNEILDRTLKSIGPERDFFKDRADRYHALFAASPEALPAVCR # DLQQEVERLRRQYAALTSTTERLVNDGLALGVLVKTDNSPDGM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g321 ### # start gene g322 Scaffold_17 AUGUSTUS gene 322349 323125 0.35 + . g322 Scaffold_17 AUGUSTUS transcript 322349 323125 0.35 + . g322.t1 Scaffold_17 AUGUSTUS start_codon 322349 322351 . + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_17 AUGUSTUS CDS 322349 323125 0.35 + 0 transcript_id "g322.t1"; gene_id "g322"; Scaffold_17 AUGUSTUS stop_codon 323123 323125 . + 0 transcript_id "g322.t1"; gene_id "g322"; # protein sequence = [MGPPSTVVYRTSIPVSSSSGVHISAQVHDAQLDEKKPIQGPAPPTPPQSDKSLSPDQEQYPTLPSPLLIRTPLKRASI # DEGIPSSPSKRMRLDGKEAATPVHSAEAPTVPQSVGSMVQDVAPSPHLDQQVTGNIIVQSPNLEFTGTIVMTTEKDELVSTSHVLASIEPDPENLEIP # QSNLMSDDPSDPVISDIGSRQMVNNAEAEGSEDDEAGRDKENKEEGDEDEDEDEDESSFTEKEALEEVLKLEHSGNICKLCR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g322 ### # start gene g323 Scaffold_17 AUGUSTUS gene 325727 326434 0.58 - . g323 Scaffold_17 AUGUSTUS transcript 325727 326434 0.58 - . g323.t1 Scaffold_17 AUGUSTUS stop_codon 325727 325729 . - 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_17 AUGUSTUS CDS 325727 326105 0.92 - 1 transcript_id "g323.t1"; gene_id "g323"; Scaffold_17 AUGUSTUS CDS 326160 326434 0.58 - 0 transcript_id "g323.t1"; gene_id "g323"; Scaffold_17 AUGUSTUS start_codon 326432 326434 . - 0 transcript_id "g323.t1"; gene_id "g323"; # protein sequence = [MIYSEAEIQRITRVAAQIALSTNPPMEIHSIDKANVLACSRLWRKTVTETLTKEFPQIKFDHQLVDSTAMVMVANPRK # LNGVILTENLFGDILSDQSSVIPGSLGLLPSASLAGAPVETSSADFKPTPGLYEPIHGSAPDIAGKGIANPIGTILSAAMLLRYSLGLDKPASAIEAA # VRKVLDLPSAGGYGLRTADLGGKVATTELGDKVVEALKEIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g323 ### # start gene g324 Scaffold_17 AUGUSTUS gene 327251 328393 0.2 + . g324 Scaffold_17 AUGUSTUS transcript 327251 328393 0.2 + . g324.t1 Scaffold_17 AUGUSTUS start_codon 327251 327253 . + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_17 AUGUSTUS CDS 327251 327488 0.46 + 0 transcript_id "g324.t1"; gene_id "g324"; Scaffold_17 AUGUSTUS CDS 327537 327662 0.7 + 2 transcript_id "g324.t1"; gene_id "g324"; Scaffold_17 AUGUSTUS CDS 327798 328393 0.34 + 2 transcript_id "g324.t1"; gene_id "g324"; Scaffold_17 AUGUSTUS stop_codon 328391 328393 . + 0 transcript_id "g324.t1"; gene_id "g324"; # protein sequence = [MATDKKPYCKSLVLDAGPLLSLSPLRGIAESYYTVPQVLAELKDKNAKEHLERLGLNFGIKIEVKNPDPASLASGGCV # LLIQWAKKTGDYAVLSHPDLSVLALTHTLQVRAKRDAEIKASIHVESLAIDDTADGPTAADSDGSVADEGEDATEREALNVELHPIEESPQPVASVPI # SAPSPDVPLYDDPSDSDDGEGEWITPANVALHKSRALDLLPSGGQEKKGKGHRKEEVVDVGCMTADFAMQNVLMQMGLNLVGTEGKRIQRVKTWVLRC # HACFKYVLDCDGQLIVLTISVSEYARTHQNNSVLHVEIHRLSVLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g324 ### # start gene g325 Scaffold_17 AUGUSTUS gene 336822 338291 0.97 + . g325 Scaffold_17 AUGUSTUS transcript 336822 338291 0.97 + . g325.t1 Scaffold_17 AUGUSTUS start_codon 336822 336824 . + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_17 AUGUSTUS CDS 336822 338291 0.97 + 0 transcript_id "g325.t1"; gene_id "g325"; Scaffold_17 AUGUSTUS stop_codon 338289 338291 . + 0 transcript_id "g325.t1"; gene_id "g325"; # protein sequence = [MHSIEEQQKFLTAYADGLEHLLAPINRLSEDILVEIFKYVCCEDAGANYIDYTVWRKPLPTLTLRGVCSRWFRFIGNT # PVLWSCFGIRCVARNRDNLGPSFSSFLTRSQFHPIDFKIELRLGTAKQLGLLLNMETTRRWRVAVFAGVAHGFSEYVLRELVNSKLDLPELVKLDIDT # GSQTETIKFLIKCPKLRILHLRGFFLRLLYDRPSITHLVMHELSFVSVLDILGYCPNVQDVTVTHLRTFDLMSAHVKPEMARVCNAKSLSIDFGIHSL # DGYGATDLDNFLKSITMPRLTHLAILDTFLNNENFVEPLRDMLERSMCSVTHVRIRGAQFNKDRMHRLFDSCLSLVTNFEFEETGDAGYGCFFDGLTA # HHQEKDTAKNSTSGCNAEVGGSASTGVTQTQVEGDSAPSTNNGAEVGVKAAVAPTQEDQSSPSFLPNLTDLSLIIIPQTEMVVKLIRARWKPATDLTT # ADRSSELSCIEGSYRILVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g325 ### # start gene g326 Scaffold_17 AUGUSTUS gene 344122 345603 0.98 + . g326 Scaffold_17 AUGUSTUS transcript 344122 345603 0.98 + . g326.t1 Scaffold_17 AUGUSTUS start_codon 344122 344124 . + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_17 AUGUSTUS CDS 344122 345603 0.98 + 0 transcript_id "g326.t1"; gene_id "g326"; Scaffold_17 AUGUSTUS stop_codon 345601 345603 . + 0 transcript_id "g326.t1"; gene_id "g326"; # protein sequence = [MSPAIYPVPAAVDLLFSTSQRWKSAYIACTIEATSPVTLFPNNLGGGNNSKINYADLEELTLEYDVSGLNEEQFNHGL # GFVGNGHGLRIPSFVRAPKLHALRLVKMKWWPVLDSELDISIQDDDAIGETDDGDDGEGFERNDGEGRHEMEEGVVPHYLPYSQIRSLTGSASLPTLY # TLLKLCTNLERVEVEQERFPGLTLPPPDVSDSDPNGGGGRGDIGEGGRGLASGVASPHTSTQQVYSPIYDWNSTFHTGHAPNTKINTPCLHTLHLTLP # TDQPSLTNWIRRAPSLRSLSLTGGKLTSKIIHAQVVRDLIAFVRRHRESGFFDSGFGRFDDGFGGPRRCDFDNFMPSAHAESYTSGLESFALSTVEIS # PDQLVELFTYAWVERVEPSTQSWAARSYLEVLRGGSGEVLRWLRVSSSLSPSRVHRRLQTISHSVSHRSAKDMFIERGPDGVCQIADPKNIPSETFKK # RKKKRSKELRVRLLVEDKSYSLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g326 ### # start gene g327 Scaffold_17 AUGUSTUS gene 353337 353906 0.73 + . g327 Scaffold_17 AUGUSTUS transcript 353337 353906 0.73 + . g327.t1 Scaffold_17 AUGUSTUS start_codon 353337 353339 . + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_17 AUGUSTUS CDS 353337 353906 0.73 + 0 transcript_id "g327.t1"; gene_id "g327"; Scaffold_17 AUGUSTUS stop_codon 353904 353906 . + 0 transcript_id "g327.t1"; gene_id "g327"; # protein sequence = [MIIHPRDTYDRTTILQDIKEVHKNAVWYHYFDTRDNTGLKTTYRGFLLSLIKQMGLGNEQINSALYALYKTNKFNGIT # IEELQKLLKTVIEERNAGYIVVDAMDECKEADKVSKWLSSHSSQLWMLVTSRLPAVGFENGIINIALGEKGSRMNADIELYLKSTIDTIPRFRDTTRD # YIKESLKNGAHGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g327 ### # start gene g328 Scaffold_17 AUGUSTUS gene 353947 354570 0.59 + . g328 Scaffold_17 AUGUSTUS transcript 353947 354570 0.59 + . g328.t1 Scaffold_17 AUGUSTUS start_codon 353947 353949 . + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_17 AUGUSTUS CDS 353947 354570 0.59 + 0 transcript_id "g328.t1"; gene_id "g328"; Scaffold_17 AUGUSTUS stop_codon 354568 354570 . + 0 transcript_id "g328.t1"; gene_id "g328"; # protein sequence = [MFRFRWVECQLRAVQQCTSHTSVKKALGKLPKDLEETYEQALKRCKDQGNAEEAQHLLLWLLYAYEPLTKRQFGEILA # VDLGEQVVNPYMEFKEGLVIDTTIVTVGQDKIVQLAHASVKEYLISYSLQKETQDLFQLNEKLAHDIMTQTTIIYLMQKENIDSGYYRSFAHYSVEKW # LSHASKVEEYKLKGKAQNLIHRMLENNNQYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g328 ### # start gene g329 Scaffold_17 AUGUSTUS gene 355309 356143 0.2 + . g329 Scaffold_17 AUGUSTUS transcript 355309 356143 0.2 + . g329.t1 Scaffold_17 AUGUSTUS start_codon 355309 355311 . + 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_17 AUGUSTUS CDS 355309 355319 0.21 + 0 transcript_id "g329.t1"; gene_id "g329"; Scaffold_17 AUGUSTUS CDS 355402 356143 0.55 + 1 transcript_id "g329.t1"; gene_id "g329"; Scaffold_17 AUGUSTUS stop_codon 356141 356143 . + 0 transcript_id "g329.t1"; gene_id "g329"; # protein sequence = [MKPLKNEAIVRLLLENGADVNAQGGQYGNALQAAAYRANEAIVKLLLENGADVNLQGGYFENALQAASSQGNEVIVKL # LLENGAEYGNALQAAAYGKNEAIVKLLLENGADVNAQGGEYSNALQAAAHARDEAIVKLLLEKGADVNAQGGEYGNALQVAAYQENEVIVKLLLEKGA # DVNAQGGEYGNALQAAAYQENEAIVQALLEKGVDVNAQGGKYGNALQAAAHAGDEAIVKLLLEMGADVNTQGGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g329 ### # start gene g330 Scaffold_17 AUGUSTUS gene 359850 360236 0.85 + . g330 Scaffold_17 AUGUSTUS transcript 359850 360236 0.85 + . g330.t1 Scaffold_17 AUGUSTUS start_codon 359850 359852 . + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_17 AUGUSTUS CDS 359850 360236 0.85 + 0 transcript_id "g330.t1"; gene_id "g330"; Scaffold_17 AUGUSTUS stop_codon 360234 360236 . + 0 transcript_id "g330.t1"; gene_id "g330"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRLPPWVTPNLPVVPWEVSHTPLPGEREDLPLDRYRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g330 ### # start gene g331 Scaffold_17 AUGUSTUS gene 362211 363510 0.51 + . g331 Scaffold_17 AUGUSTUS transcript 362211 363510 0.51 + . g331.t1 Scaffold_17 AUGUSTUS start_codon 362211 362213 . + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_17 AUGUSTUS CDS 362211 362861 0.63 + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_17 AUGUSTUS CDS 363031 363510 0.53 + 0 transcript_id "g331.t1"; gene_id "g331"; Scaffold_17 AUGUSTUS stop_codon 363508 363510 . + 0 transcript_id "g331.t1"; gene_id "g331"; # protein sequence = [MREYTRGGPSPVVPQPRSWQATEPISFNRNTPTGAKDGNPQVEQAGQIPDTPSVDRRRIHEWGARVQRAELGEYGRPE # GGAYALENEGGGKGGFNPPPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGDSNSEGSNEGEQNQSSRNGGRREEDRG # ELPTGAPDVPPTRYDPDQPWYYDPDKVGTVRQLLDLPTRDEDKCASAASHLTGAALSHFDTLNRQRLRGEYTCLEDWTEFKREFGSKFGPIDEADEAR # RRLAWMKQMPEESFANFFIRFNEYAPLTGFNDEALVTYLKKGVAPWLPLQVVTGREEPRSYDEWTRVFTKLDGAVRAQAESLRNLHGEKVLQGWLSRF # PGLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g331 ### # start gene g332 Scaffold_17 AUGUSTUS gene 368086 368598 0.37 + . g332 Scaffold_17 AUGUSTUS transcript 368086 368598 0.37 + . g332.t1 Scaffold_17 AUGUSTUS start_codon 368086 368088 . + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_17 AUGUSTUS CDS 368086 368598 0.37 + 0 transcript_id "g332.t1"; gene_id "g332"; Scaffold_17 AUGUSTUS stop_codon 368596 368598 . + 0 transcript_id "g332.t1"; gene_id "g332"; # protein sequence = [MKKLDHKWTGPYSILSQVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFPDKFRRQNSPPPIFVKGESEHFVESILDSKP # IKGKPEEVEYLVKWEGYDEDFNSWVGWEGMAGSLELMKQWHREHNRKRKPKRDQWELLEKQAEDDRGEAVGSTGGTGNERENKDGWRRRNTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g332 ### # start gene g333 Scaffold_17 AUGUSTUS gene 371363 371857 0.91 + . g333 Scaffold_17 AUGUSTUS transcript 371363 371857 0.91 + . g333.t1 Scaffold_17 AUGUSTUS start_codon 371363 371365 . + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_17 AUGUSTUS CDS 371363 371857 0.91 + 0 transcript_id "g333.t1"; gene_id "g333"; Scaffold_17 AUGUSTUS stop_codon 371855 371857 . + 0 transcript_id "g333.t1"; gene_id "g333"; # protein sequence = [MDWAVFNIVASRKSCLQTGLPGDLHKIHNVFHVDRLKPHFPDKFRRQNSPPPPIFVKGESEHFVESILDSKPIKGKPE # EVEYLVKWEGYDEDFNSWVGWEGMAGSLELMKQWHREHNRKRKPKRDQWELLEKQAEDDRGEAVGSTGGTGNERENKDGWRRRNTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g333 ### # start gene g334 Scaffold_17 AUGUSTUS gene 372175 373701 0.51 - . g334 Scaffold_17 AUGUSTUS transcript 372175 373701 0.51 - . g334.t1 Scaffold_17 AUGUSTUS stop_codon 372175 372177 . - 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_17 AUGUSTUS CDS 372175 373287 0.96 - 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_17 AUGUSTUS CDS 373414 373701 0.53 - 0 transcript_id "g334.t1"; gene_id "g334"; Scaffold_17 AUGUSTUS start_codon 373699 373701 . - 0 transcript_id "g334.t1"; gene_id "g334"; # protein sequence = [MRPYPRSQASSALRVENDRLKAEVEEFRTLLAQSRGQVSTLTSLLRDTSSSLDLRSQELEASRRSLEEVARDRVEYQR # VLSQFQAIEAELPEPASEEIGELCKQVDDASSRSSDAYAELDSANARALRQQDRLEELEEMVCSYRDRAHVAEGLIRQYPEDEGLYEVELPSLSEVQR # KLDASEALVRRLATFAHRLYRADPANLLHYHNRYVGGLLEAITLLLYRGLHHTPERLSSVVDFVLGYLSQARFTHGELHLRSTSSLLYYYSNAADRVE # GLYREMLTHSRFPSHDAFLTAAQHAGYVDARPGSLEPPLHRRFFSFDHPIPIAPSPTSDHLPAVPAMDSIMVSWERLIANYIRDMIDTPGPHYFFPTS # ADLTVVGGGSSPVEGSVLAEEDDENAPREVVEVAGEVGANVATPAEEDDRGLPVGGSETPAMARTPLFLLASRSPSSPLLPPSSLSSLTSSTSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g334 ### # start gene g335 Scaffold_17 AUGUSTUS gene 378891 380057 0.86 + . g335 Scaffold_17 AUGUSTUS transcript 378891 380057 0.86 + . g335.t1 Scaffold_17 AUGUSTUS start_codon 378891 378893 . + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_17 AUGUSTUS CDS 378891 380057 0.86 + 0 transcript_id "g335.t1"; gene_id "g335"; Scaffold_17 AUGUSTUS stop_codon 380055 380057 . + 0 transcript_id "g335.t1"; gene_id "g335"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g335 ### # start gene g336 Scaffold_17 AUGUSTUS gene 380108 382246 0.81 + . g336 Scaffold_17 AUGUSTUS transcript 380108 382246 0.81 + . g336.t1 Scaffold_17 AUGUSTUS start_codon 380108 380110 . + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_17 AUGUSTUS CDS 380108 382246 0.81 + 0 transcript_id "g336.t1"; gene_id "g336"; Scaffold_17 AUGUSTUS stop_codon 382244 382246 . + 0 transcript_id "g336.t1"; gene_id "g336"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGSKHPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g336 ### # start gene g337 Scaffold_17 AUGUSTUS gene 388023 388649 0.94 + . g337 Scaffold_17 AUGUSTUS transcript 388023 388649 0.94 + . g337.t1 Scaffold_17 AUGUSTUS start_codon 388023 388025 . + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_17 AUGUSTUS CDS 388023 388649 0.94 + 0 transcript_id "g337.t1"; gene_id "g337"; Scaffold_17 AUGUSTUS stop_codon 388647 388649 . + 0 transcript_id "g337.t1"; gene_id "g337"; # protein sequence = [MLENSRLTVIVRFLTAAQHAGFTSPPPDSLEPPLHRRMLSLSTALPHRGGAGRWDDLVPAIPSDDQLTQDWEQLMLQY # MHHITDTPLPVPDPPVPMSSTGPVPESSVEANVEQSLEAPIVQVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSPVLPLLFGSVASLSIDLTGDDDEL # YETEEAYASRIDVAMEGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g337 ### # start gene g338 Scaffold_17 AUGUSTUS gene 389072 389638 0.9 - . g338 Scaffold_17 AUGUSTUS transcript 389072 389638 0.9 - . g338.t1 Scaffold_17 AUGUSTUS stop_codon 389072 389074 . - 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_17 AUGUSTUS CDS 389072 389638 0.9 - 0 transcript_id "g338.t1"; gene_id "g338"; Scaffold_17 AUGUSTUS start_codon 389636 389638 . - 0 transcript_id "g338.t1"; gene_id "g338"; # protein sequence = [MAEFVYNNTPNTTTGVSPFFANKGYHPKLSITLEQVQGAEVNEYASNLKELHAYLQERIGVANKAYAKYANQKRQEAP # DWKEGDQVWLNMENVRTRRPMKKLDHKWTGPYTILSKVGSHAYRLDLPGDLHKIHNVFHVDRLKPHFHDKFKRQTSPPPPIFIKGETEHFVEDILDSK # PKKDDRRKWNTS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g338 ### # start gene g339 Scaffold_17 AUGUSTUS gene 396825 397601 0.95 - . g339 Scaffold_17 AUGUSTUS transcript 396825 397601 0.95 - . g339.t1 Scaffold_17 AUGUSTUS stop_codon 396825 396827 . - 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_17 AUGUSTUS CDS 396825 397601 0.95 - 0 transcript_id "g339.t1"; gene_id "g339"; Scaffold_17 AUGUSTUS start_codon 397599 397601 . - 0 transcript_id "g339.t1"; gene_id "g339"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g339 ### # start gene g340 Scaffold_17 AUGUSTUS gene 401166 401855 0.76 + . g340 Scaffold_17 AUGUSTUS transcript 401166 401855 0.76 + . g340.t1 Scaffold_17 AUGUSTUS start_codon 401166 401168 . + 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_17 AUGUSTUS CDS 401166 401855 0.76 + 0 transcript_id "g340.t1"; gene_id "g340"; Scaffold_17 AUGUSTUS stop_codon 401853 401855 . + 0 transcript_id "g340.t1"; gene_id "g340"; # protein sequence = [MNLVLKILPSPFSNSEGEETTQLSPESSSQHVGPTVPGVGPIDDMTSGAPQAFVAGTHFGSLVNEPRVGQAQINSASH # IWYFIRALSSPDDPTPTSSTEPKKNWEMRPPAKKFSHLSCKLCLYVFNLLTSYLFIHLQSRTNCKPKIWRNSDGQNKTILQHLLRHHQKAWTNTVVLK # KLKGCEEVVRKADPDTRSKIPKEKLPFTIEGFRERLERWVAVDDQVQFYTPPQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g340 ### # start gene g341 Scaffold_17 AUGUSTUS gene 406078 406569 0.39 - . g341 Scaffold_17 AUGUSTUS transcript 406078 406569 0.39 - . g341.t1 Scaffold_17 AUGUSTUS stop_codon 406078 406080 . - 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_17 AUGUSTUS CDS 406078 406569 0.39 - 0 transcript_id "g341.t1"; gene_id "g341"; Scaffold_17 AUGUSTUS start_codon 406567 406569 . - 0 transcript_id "g341.t1"; gene_id "g341"; # protein sequence = [MFALEMALPHHGAGNWEDLIPAVPTLDHLMQEWEAMMLSYIHFVTDTPLPQIGPQEEGSGHHEEASDLQEGVGVGTAA # VPLFLPDLLSPTPVASPASPLSPPPLFGSVANLAIDMMADDNNEDIYESAGCIEHRNRLEGNLGEDDPMGDGANSSLKAESSVAS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g341 ### # start gene g342 Scaffold_17 AUGUSTUS gene 412813 413118 0.55 - . g342 Scaffold_17 AUGUSTUS transcript 412813 413118 0.55 - . g342.t1 Scaffold_17 AUGUSTUS stop_codon 412813 412815 . - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_17 AUGUSTUS CDS 412813 413118 0.55 - 0 transcript_id "g342.t1"; gene_id "g342"; Scaffold_17 AUGUSTUS start_codon 413116 413118 . - 0 transcript_id "g342.t1"; gene_id "g342"; # protein sequence = [MTITSFENLDFSARDTLYQQVEHIVNEHIEIMTPTAIGMQFYNNIFSKSPIPEPSTISIQRVPSMGDRGGLWLVDPSR # DVITIPVMAQISSYADDLNVENI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g342 ### # start gene g343 Scaffold_17 AUGUSTUS gene 426016 427806 0.99 + . g343 Scaffold_17 AUGUSTUS transcript 426016 427806 0.99 + . g343.t1 Scaffold_17 AUGUSTUS start_codon 426016 426018 . + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_17 AUGUSTUS CDS 426016 427806 0.99 + 0 transcript_id "g343.t1"; gene_id "g343"; Scaffold_17 AUGUSTUS stop_codon 427804 427806 . + 0 transcript_id "g343.t1"; gene_id "g343"; # protein sequence = [MLTLSVGSRRQKHAVVVDDLVQRLLRFSDDNAVNNPKNSNVYSEIYKQCSLQFGEVVTKILYTHFRAHHEIDRCDDPL # IAKSNLGVIITVFQNLTKEELSNMKQALKICERSDKSMLVFYSLNDEGHSEIRSNDLFKLMGKCFQRDYKKYYFKDNIGICNDYLYHYGIPLTDIGLQ # DVVFQVLVALGYVQHILQQILHSVQSKDLSYSSRNFYKKNKRKQIRIERASKEYSVLHQYSESWPERISTETKMNCVRNYRQFVQYSPPSICACCGSE # DRLRTGSYKNQAEWPNLSVLKIKDPYIVANTHPSRFIYICRELDGLLLNKEGIRSVDVTCTVFEIYFCHDCYGSLRRLKMPRLALNNYLYRGESLKEL # ENVTWVEEMACSIYRTTAHVTRIFGSSSVTDPLQLHGNVCAHPLNMCAIAKKLPWSPTDLNDLITIIFVGKRKLSETDLLKLKPFFVRRSVIRILLSD # LCKRNRLYKDLYSMDNSVLNQYPENDILPGLAERIIYDHESSSANLFGVESDGFDDHPAELLSDAAEDSILLERSGLYDPESQDVPARFMTASSINNI # AQSLSSTDVSKKDVFLMYERDPINEYKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g343 ### # start gene g344 Scaffold_17 AUGUSTUS gene 428036 428401 0.86 + . g344 Scaffold_17 AUGUSTUS transcript 428036 428401 0.86 + . g344.t1 Scaffold_17 AUGUSTUS start_codon 428036 428038 . + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_17 AUGUSTUS CDS 428036 428401 0.86 + 0 transcript_id "g344.t1"; gene_id "g344"; Scaffold_17 AUGUSTUS stop_codon 428399 428401 . + 0 transcript_id "g344.t1"; gene_id "g344"; # protein sequence = [MVAPAFSTVTANVLLDLAQKLKNEKDKSDFTDDEQHAFQLLNQVNVISAKIPGSQASRTTTRNQIRSYYAYFGMPQLF # LTLNPSAVHSPIFQVMYGQTDIDLAERFPHVVHPRSERACRVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g344 ### # start gene g345 Scaffold_17 AUGUSTUS gene 428744 433138 0.85 + . g345 Scaffold_17 AUGUSTUS transcript 428744 433138 0.85 + . g345.t1 Scaffold_17 AUGUSTUS start_codon 428744 428746 . + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_17 AUGUSTUS CDS 428744 433138 0.85 + 0 transcript_id "g345.t1"; gene_id "g345"; Scaffold_17 AUGUSTUS stop_codon 433136 433138 . + 0 transcript_id "g345.t1"; gene_id "g345"; # protein sequence = [MPPEFYVIGKGNTFSTELISDWKKLFEDEHKRIGERFQRHRCRPVCHKGQTNTDVCRFGYPYEIVENSSYNIEQNSII # FARKETDVNGHNPQLLVCTRHNHDIKCILSGKAAKAAMFYISDYITKMPLNTEALLSTLSKAVASLTSDEFDESTVFDSKKLLHRCLTHFGRKQQIHA # QQCARYLRRQGDNMCSHQTIPLPSANLMIFIQQTYFNDTHNWEDENNHELDMQLSLGIKNGKMIGYNQVIDYWYRDALLDDMCFYDFIRYISLQPQTR # TRTSNTSTTRLGVLSRYKLSIHHPLCDTHELIRHTNFKQGDVGKEYVPVMIGAIPPRKNQQQYALFVIAHFKPFSERNVLFKDDKVESEFHNLVISTE # HQRVLTNWEEIHECADQRDAERLRKRANMLAKSLHVPVTIDEELDAEDETCYVFIDAKTSNPKNSKGNEHNHELQLLKMDLTRSAWLNHPPEKLKKSM # SASSNASVKLPSLNFTNVGKWIKDSKMIAEKLSSARFSQSNLYSQNSNEINGDLLDTTKSTLKGYHKSKMIDNVQDHNIPEFTPAEVKNHIAKEYNLN # NEQKIAFEIISSIIIFKEILKVPEWSEKQPLIMNLTGPGGTGKTHVVQAVQKVMEHYGMAHAYRALAPTGNAASLINGKTIHSGLNIKVRENKNGRSK # RNLGELKEKMAVYATVKKNNSIRTEWKDVCLLLIDEVSMVDSILLADIDGSLRYAKEKPDDFFGGINIIFSGDPFQYPPVGTSLYTPIRSSGKQSEDE # LMQRLGRMAWKSINAVVELHEQKRMEDDPEYAAAVSRLRICECIKSDVELFNSRAIKTLSNPKGVIFDSETDYLASMIVSKNATRRALNEYKAIAICN # GVESLELVKVVAHDELKYKKYTEKKSKHENTFPSIFEQTQLQSMDTSSAKFRASLPGILNLYIGMPVILKHENINTELGITNGARGCLRKLELSIDNN # GFTYCEYALIEFFDCKVQLPGLPQGYFPIKARTWHFTTYIWDDKHEKVLVSVVRKQLPFEPLFALTGQGAQGRTLPAILCMLHLGGYGSYVAASRPRT # RKGLFITKKVTLDDLNTPAIPYDLWFEMRRFHTIAHNTKVIWGFDKGDLIEVPDAESEKKSNLSNVHYEFNNYRDIKRQLDDSNDSPKKIKIAKTSSK # TESNSNSFIAKPFNQDAFIMKGPSWDSENWSCSFDTAFIIFYNCFFSMSDKSRQLWINQSKSKHLFNHLQKLLSNVMETTVDTINVMRNEWRDGLFNE # FGRACVQYGHVLLPISTLIQYHLHVCERSCVQLERICEVHNTCYRHISGLKCYNLIMPALEPLYSYKEIVSSVQDYIDVMFMNHHGTFPTNKDYDNTE # CDEHCVSVTAMNNELPQIIAFEIIGVNNIIPLSEIHVSLPDLNVKLTYVLNSIIYHGMNHFCARIFNIHGTWLYDGQIDGGKLQHDKISHNSEENLTI # LNEKSAHIYIYVRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g345 ### # start gene g346 Scaffold_17 AUGUSTUS gene 436717 437607 0.72 - . g346 Scaffold_17 AUGUSTUS transcript 436717 437607 0.72 - . g346.t1 Scaffold_17 AUGUSTUS stop_codon 436717 436719 . - 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_17 AUGUSTUS CDS 436717 437607 0.72 - 0 transcript_id "g346.t1"; gene_id "g346"; Scaffold_17 AUGUSTUS start_codon 437605 437607 . - 0 transcript_id "g346.t1"; gene_id "g346"; # protein sequence = [MELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPE # VDMKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSEKYLGPFKVISRPGTLSYELKLPDYLRR # IHPVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTMMSSLGLLLMNYMLTNLYRRSTPDTLTNLD # LDHKKSFYSFLRRAPPKSTLCV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g346 ### # start gene g347 Scaffold_17 AUGUSTUS gene 440661 442344 0.17 - . g347 Scaffold_17 AUGUSTUS transcript 440661 442344 0.17 - . g347.t1 Scaffold_17 AUGUSTUS stop_codon 440661 440663 . - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_17 AUGUSTUS CDS 440661 441365 1 - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_17 AUGUSTUS CDS 441784 442344 0.26 - 0 transcript_id "g347.t1"; gene_id "g347"; Scaffold_17 AUGUSTUS start_codon 442342 442344 . - 0 transcript_id "g347.t1"; gene_id "g347"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISASVNHVAVIAVSVQLQFLLRRLFLKPWKKNNNSSTALYTGDGQPV # QVLTPRRGQPPVVAPARGRSTTRIDSPILQAIARRTGKQPQRRAASESPRDPPPHFDLDTGDHDDQDPPVDPDDPGADNNMTIWMTIPAVYRVVNLVT # PVDLVVLVVPADNFGVYDAQGEAEDSLGNLKMKETENIRKYIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYW # KREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRM # KNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g347 ### # start gene g348 Scaffold_17 AUGUSTUS gene 452948 453616 0.58 - . g348 Scaffold_17 AUGUSTUS transcript 452948 453616 0.58 - . g348.t1 Scaffold_17 AUGUSTUS stop_codon 452948 452950 . - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_17 AUGUSTUS CDS 452948 453616 0.58 - 0 transcript_id "g348.t1"; gene_id "g348"; Scaffold_17 AUGUSTUS start_codon 453614 453616 . - 0 transcript_id "g348.t1"; gene_id "g348"; # protein sequence = [MWQELMVLNQEVGSLPDNVEVVSVNVQLKSLRNHIESSFTLLDRIDCLAALCESLSIRDDALSDLLEHIDSFPATSLG # PLSSSYRSLSNLVIEQQNSHRLSFTKSTTEVVINAFEVVEGDPRSIVENECILQSWSELEEMGNDRVHGTKSRPSSVMSTQNSRHDGCVSLNKFQLRF # QVGPSKSAEVQKSGRYIQSNFGECVWPNSGRGKTANNVLESVGNLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g348 ### # start gene g349 Scaffold_17 AUGUSTUS gene 453982 454374 0.85 - . g349 Scaffold_17 AUGUSTUS transcript 453982 454374 0.85 - . g349.t1 Scaffold_17 AUGUSTUS stop_codon 453982 453984 . - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_17 AUGUSTUS CDS 453982 454374 0.85 - 0 transcript_id "g349.t1"; gene_id "g349"; Scaffold_17 AUGUSTUS start_codon 454372 454374 . - 0 transcript_id "g349.t1"; gene_id "g349"; # protein sequence = [MIGCFFLEREVSVNWKVKLLLGSAPNIRSQETSQGEAEHAQVEKFKQEEDERRRLEQACLAEEEERARLEKKQHEETE # RIKLNEIRLTEEAPTKEEPKKNGIGRRRESSIREEENRNGFEIERRERGITC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g349 ### # start gene g350 Scaffold_17 AUGUSTUS gene 454886 455356 0.72 - . g350 Scaffold_17 AUGUSTUS transcript 454886 455356 0.72 - . g350.t1 Scaffold_17 AUGUSTUS stop_codon 454886 454888 . - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_17 AUGUSTUS CDS 454886 455356 0.72 - 0 transcript_id "g350.t1"; gene_id "g350"; Scaffold_17 AUGUSTUS start_codon 455354 455356 . - 0 transcript_id "g350.t1"; gene_id "g350"; # protein sequence = [MDATLKEVEAIRRDAVDDMDRRIWRQDITTNANGVPPMPESPSTVPFSSDSLQRYTELEHQMTQVGARLQTAVDDPLP # SLSITVKVPLKEQLSQGAENLKSHFIRVQRMIDLLQFVHKQITVLNGIREVFNALQLCLDDLMTRYESKTEDVLDEYL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g350 ### # start gene g351 Scaffold_17 AUGUSTUS gene 458563 459705 0.09 - . g351 Scaffold_17 AUGUSTUS transcript 458563 459705 0.09 - . g351.t1 Scaffold_17 AUGUSTUS stop_codon 458563 458565 . - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_17 AUGUSTUS CDS 458563 458955 0.43 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_17 AUGUSTUS CDS 459481 459705 0.25 - 0 transcript_id "g351.t1"; gene_id "g351"; Scaffold_17 AUGUSTUS start_codon 459703 459705 . - 0 transcript_id "g351.t1"; gene_id "g351"; # protein sequence = [MERTDFDSLKERQLFGAGPYSNRRTNSQSDTVSVQTSNAGRSDGIMRQFSSTQLFESGGGLGSWITDDMKKMFHASTF # VPLQLSHPHEIENSTNMQFRKIDNEFPDRTTTGSGQENLTYGYSVAQEHPSTSISPTSVDSSASYFENKQLPLNRFLTPIIPYYTPAVPYRCPSRHVP # GSIGQYRNPDSFHQQFRESSGCVSFKIIP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g351 ### # start gene g352 Scaffold_17 AUGUSTUS gene 464140 465242 0.28 + . g352 Scaffold_17 AUGUSTUS transcript 464140 465242 0.28 + . g352.t1 Scaffold_17 AUGUSTUS start_codon 464140 464142 . + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_17 AUGUSTUS CDS 464140 464235 0.42 + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_17 AUGUSTUS CDS 464284 464694 0.42 + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_17 AUGUSTUS CDS 464854 464935 0.65 + 0 transcript_id "g352.t1"; gene_id "g352"; Scaffold_17 AUGUSTUS CDS 464992 465242 0.87 + 2 transcript_id "g352.t1"; gene_id "g352"; Scaffold_17 AUGUSTUS stop_codon 465240 465242 . + 0 transcript_id "g352.t1"; gene_id "g352"; # protein sequence = [MFFCMKFNVIGDEPILTTSTRRFVLFPIEYDEIWSMYKKAQSSFWTSEEIDLSSDITDWNNKLNVNEKFFLSRVLAFF # AASDGIVNENLIRHFSNEIQVPEARCFYGFQIMMENIHSETYSLLIQTYIRDAPERSMLFNSIETIPCIKRKAKWALQWIQDNRFTFAERLSSPASPS # CSVITSIVIEAVDIEQQFVKEAIPIRLIGMNSKLMCNYIEFVADQLLAMLGCGKIYNSQNPFEFMDMISVDGKTNFFEKRVSEYQKARVFDNTDSIKR # EFQSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g352 ### # start gene g353 Scaffold_17 AUGUSTUS gene 467896 469062 0.87 + . g353 Scaffold_17 AUGUSTUS transcript 467896 469062 0.87 + . g353.t1 Scaffold_17 AUGUSTUS start_codon 467896 467898 . + 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_17 AUGUSTUS CDS 467896 469062 0.87 + 0 transcript_id "g353.t1"; gene_id "g353"; Scaffold_17 AUGUSTUS stop_codon 469060 469062 . + 0 transcript_id "g353.t1"; gene_id "g353"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g353 ### # start gene g354 Scaffold_17 AUGUSTUS gene 469427 470545 0.99 + . g354 Scaffold_17 AUGUSTUS transcript 469427 470545 0.99 + . g354.t1 Scaffold_17 AUGUSTUS start_codon 469427 469429 . + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_17 AUGUSTUS CDS 469427 470545 0.99 + 0 transcript_id "g354.t1"; gene_id "g354"; Scaffold_17 AUGUSTUS stop_codon 470543 470545 . + 0 transcript_id "g354.t1"; gene_id "g354"; # protein sequence = [MDGFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPELEPPAEN # PHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFSESASERL # PAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISR # LQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g354 ### # start gene g355 Scaffold_17 AUGUSTUS gene 473643 474813 0.23 + . g355 Scaffold_17 AUGUSTUS transcript 473643 474813 0.23 + . g355.t1 Scaffold_17 AUGUSTUS start_codon 473643 473645 . + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_17 AUGUSTUS CDS 473643 474263 0.53 + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_17 AUGUSTUS CDS 474415 474813 0.47 + 0 transcript_id "g355.t1"; gene_id "g355"; Scaffold_17 AUGUSTUS stop_codon 474811 474813 . + 0 transcript_id "g355.t1"; gene_id "g355"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISLACEDDASAAVPKVMSSKTAHTEKPPAATVDVEDIWKQSAKTNSWDSDETRPSRRQQPRRQQISATG # PAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g355 ### # start gene g356 Scaffold_17 AUGUSTUS gene 474864 475988 0.83 + . g356 Scaffold_17 AUGUSTUS transcript 474864 475988 0.83 + . g356.t1 Scaffold_17 AUGUSTUS start_codon 474864 474866 . + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_17 AUGUSTUS CDS 474864 475988 0.83 + 0 transcript_id "g356.t1"; gene_id "g356"; Scaffold_17 AUGUSTUS stop_codon 475986 475988 . + 0 transcript_id "g356.t1"; gene_id "g356"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKKPIPSPI # SC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g356 ### # start gene g357 Scaffold_17 AUGUSTUS gene 482877 483407 0.97 + . g357 Scaffold_17 AUGUSTUS transcript 482877 483407 0.97 + . g357.t1 Scaffold_17 AUGUSTUS start_codon 482877 482879 . + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_17 AUGUSTUS CDS 482877 483407 0.97 + 0 transcript_id "g357.t1"; gene_id "g357"; Scaffold_17 AUGUSTUS stop_codon 483405 483407 . + 0 transcript_id "g357.t1"; gene_id "g357"; # protein sequence = [MDVAIIKTNIEPPPSGLFFDHIYYVGGDTEHSFMIPAISEKNELLWPFKMIGIHDWYGRSRRQPSSCLQNWNEEIFDR # FDPMLNKGDDLRNEHAGQSASTFVAPLTRSNPDDSGAANNVWQSFQEPDLIESSVSLNSSPERVASSLGKRMRRVTDVDSCPSEPATKKSRGQFPETS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g357 ### # start gene g358 Scaffold_17 AUGUSTUS gene 484228 484632 0.43 + . g358 Scaffold_17 AUGUSTUS transcript 484228 484632 0.43 + . g358.t1 Scaffold_17 AUGUSTUS start_codon 484228 484230 . + 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_17 AUGUSTUS CDS 484228 484276 0.43 + 0 transcript_id "g358.t1"; gene_id "g358"; Scaffold_17 AUGUSTUS CDS 484340 484632 0.71 + 2 transcript_id "g358.t1"; gene_id "g358"; Scaffold_17 AUGUSTUS stop_codon 484630 484632 . + 0 transcript_id "g358.t1"; gene_id "g358"; # protein sequence = [MLGSAYNDQDVQWSPIAREHELVLKIKDLEALLESKSLALQQKLTEWDAKSLEVTSLEGKLQETIISRGMMKQERDIA # IAERDVAIQATGQVELKLQEYREYFRLHKKLSLCD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g358 ### # start gene g359 Scaffold_17 AUGUSTUS gene 489462 490031 0.81 - . g359 Scaffold_17 AUGUSTUS transcript 489462 490031 0.81 - . g359.t1 Scaffold_17 AUGUSTUS stop_codon 489462 489464 . - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_17 AUGUSTUS CDS 489462 490031 0.81 - 0 transcript_id "g359.t1"; gene_id "g359"; Scaffold_17 AUGUSTUS start_codon 490029 490031 . - 0 transcript_id "g359.t1"; gene_id "g359"; # protein sequence = [MLHVGVGNGGGEMAAASNAETEYIVPGLDRPYSMELDSNTQQEQCDEGTVAFHMVHVGMGDGGGEIHYTNKNARMTQG # EDTRTLAPASMSETEYIRLGDLDSPHAKDGESAVLFLAALQWKYTKVETVSVWLNLEEVADEMEKVVWNYFTTSSGVLWIQWNLRVEVGEKHQLQAEI # EKMKDCVGQMYER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g359 ### # start gene g360 Scaffold_17 AUGUSTUS gene 492462 494462 0.96 + . g360 Scaffold_17 AUGUSTUS transcript 492462 494462 0.96 + . g360.t1 Scaffold_17 AUGUSTUS start_codon 492462 492464 . + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_17 AUGUSTUS CDS 492462 494462 0.96 + 0 transcript_id "g360.t1"; gene_id "g360"; Scaffold_17 AUGUSTUS stop_codon 494460 494462 . + 0 transcript_id "g360.t1"; gene_id "g360"; # protein sequence = [MLSEDSHSSTNLADKRTRKGLRSTTGTKNTNNNIVLANSNEASTTRSTSPLLTKDSLVPLNHSSPTSPVSSPASSDDD # AMTTRLNESGNIELSSGKYGPRVKTAAILSPEDLDDLYEEARRYAKNRSSDSIENVREVIAEAFPARVHRDWFRAEKIFHLTLDLELKDGEDPLAPPT # FPFLDVLRCKFCGHDWAQVHAARRDELRMSVGGVGCFDEYLSQVEGCNNRLKGVGNYFTPPQLLTILARGITPTLTAILSEQGVMVDETTTYKAWVTS # CRDFEVRFKARLTAADRGGRRGNFGNFNQTSNSSSTSIPPHKRTATSDPVGHPNKRTTGDVSSSTGPFYMRAFSKMPEPMQKEQRELLGRINACVKCR # TAWGSCASNLDKCTGATLSVPWRPLTNEMVDWAIAAHKSTGRPILYNAILKQAANTSSSSSVAAVHGLPLDDISAYVGNQAPAAAAVYGARSIAYVAQ # GTNVYGSYAGPLFRRAASVSSQYSARAVAPVVGHQRLTRDDQDKEVDWSDGSGSPSPSSRRQSQAMPAAKSNEEPREPSKSTSDEETDNVRTSSMPFE # LPHFVWNAVLRGATSEVLHPLLIDDGCPFVLIRSDIVSDLGLKKRPLHRPQAMSVAMSEGSPQVFHAAHYCKVSLDDPPVGGLPVPFALLLFRLFVTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g360 ### # start gene g361 Scaffold_17 AUGUSTUS gene 494525 495673 0.98 + . g361 Scaffold_17 AUGUSTUS transcript 494525 495673 0.98 + . g361.t1 Scaffold_17 AUGUSTUS start_codon 494525 494527 . + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_17 AUGUSTUS CDS 494525 495673 0.98 + 0 transcript_id "g361.t1"; gene_id "g361"; Scaffold_17 AUGUSTUS stop_codon 495671 495673 . + 0 transcript_id "g361.t1"; gene_id "g361"; # protein sequence = [MDKTSGFDLMNPSVPSPPPVPTTPKQRRAAIVATYEDSLEFKKSVILELYAYFRDHPRLRRSDPVLPIDVVAAIRSRI # EHLSVIERLQKRGDDIKDQYADVFGDIPHIDELPSDITCNISLKEADMTMQSRGYASPRKYREAWSVLIEKHLQAGRIRPSSSQYSSPAFLVPKADPT # ALPRWVNDFRKLNANTVPDRHPLPRIDSILADCAKGRIWGKMDMTDSFFQSRMDPASVPLVSVQTPLGQYEWLVMPQGLRNAPAIQQRRVTQALREYI # GRFCHVYLDDIIIWSEDEDEHARHVQLILDALRKAKLFCNPKKCTFFQLEIDFLGHHISQRGVEAQSSKCEAIINYPRPTSASEVRRFLGMVRFIAGY # LVNLAGIPEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g361 ### # start gene g362 Scaffold_17 AUGUSTUS gene 496518 497811 0.48 + . g362 Scaffold_17 AUGUSTUS transcript 496518 497811 0.48 + . g362.t1 Scaffold_17 AUGUSTUS start_codon 496518 496520 . + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_17 AUGUSTUS CDS 496518 497022 0.48 + 0 transcript_id "g362.t1"; gene_id "g362"; Scaffold_17 AUGUSTUS CDS 497156 497811 0.99 + 2 transcript_id "g362.t1"; gene_id "g362"; Scaffold_17 AUGUSTUS stop_codon 497809 497811 . + 0 transcript_id "g362.t1"; gene_id "g362"; # protein sequence = [MLADSYYWPHMRRDLYKYYVPGCEDCQRNKGRTAKNGKGPLHPLPVPEGRCDSVAMDFIGPLPMDQGYNCILTMTDRL # GSDLKIIPTTIDITAPALAKLVFDHWYCDNGLPLEWVSDRDKLFVSDFWRALNKMTGVKLKMSSSFHPETDGSSERSNKTVNQAVRFYVELDSTKSVA # TKDAAQDARDAREFLQEVELTVREARDNLTLAKVVQAYQADKNRGPCELFEEGDLVMLSTYHRREVFKKAGEKRAAKFFARFDGPYEIIKAFPETSHY # TLDMPNQPNAFPSFYVDQLKRYVPNNPELFPKRERPIPQPTIIDGYEEFDIERILDSRRRGRGWQFLVHWVDQAPSEDRWLSYTSLHDCSALDDWVRN # GGNGPDDLLASVPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g362 ### # start gene g363 Scaffold_17 AUGUSTUS gene 504131 504683 0.86 + . g363 Scaffold_17 AUGUSTUS transcript 504131 504683 0.86 + . g363.t1 Scaffold_17 AUGUSTUS start_codon 504131 504133 . + 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_17 AUGUSTUS CDS 504131 504293 0.94 + 0 transcript_id "g363.t1"; gene_id "g363"; Scaffold_17 AUGUSTUS CDS 504349 504683 0.91 + 2 transcript_id "g363.t1"; gene_id "g363"; Scaffold_17 AUGUSTUS stop_codon 504681 504683 . + 0 transcript_id "g363.t1"; gene_id "g363"; # protein sequence = [MISLTLNVQNITFDILVIRFEFYFQHLASALNDALSEPLEAELARQVEYDMDEQDKEWLDNLNAERRKEQMDKISYET # FEIIMDRLEKEWFDLVRFQPSSDQYVGADSSYICQTKNIPKADFAMPSEDSTCAICDDSEGENSNAIVFCDGCNLAVHQGVFCAIQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g363 ### # start gene g364 Scaffold_17 AUGUSTUS gene 506512 508387 0.36 + . g364 Scaffold_17 AUGUSTUS transcript 506512 508387 0.36 + . g364.t1 Scaffold_17 AUGUSTUS start_codon 506512 506514 . + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_17 AUGUSTUS CDS 506512 507239 0.37 + 0 transcript_id "g364.t1"; gene_id "g364"; Scaffold_17 AUGUSTUS CDS 507325 508387 0.72 + 1 transcript_id "g364.t1"; gene_id "g364"; Scaffold_17 AUGUSTUS stop_codon 508385 508387 . + 0 transcript_id "g364.t1"; gene_id "g364"; # protein sequence = [MEMENTPISPSTSPIGNLEPPLELVELLLSLEAIRAESSLVLSVDPISSLINIELPVLKPPPPPQTRKAPNKGPKAPK # LKRQRPDRSEEYKRYKAKKAEERAHRAEVEAAMAAAGLADERLVIRTRRSRAAAAMASTVGASVESTLSMSRGEGAEGEVYTAMTGEEEGLSNADLPY # SSFAGPSRSRLPVETPSVPEFRDHVDNQASFKLFNSGWILPSDQKRRTRAPTVPPPVPAPHPASAFVTAEEDNQTLNSRSGSAFFNPGQTSSAPHSTR # SDTAGLRALSQAAAAVSDEDNGHKTNIYDTPSVPLIVSAPGENPTDAQSTGVTAVDTILTPVITATTNTYVAEPTIEPSGLPRIGEIIRGANGKVIIE # ELDSPVTRREKHMRRKAERDKLRYASGLEQVATTFASSSLASASTSEPILNLDVGPFSTSGSFPLNYSLETDTENQQKLESSKRESYTNALPGKGKER # MEIESELSSLSEGGEEDAAVITTRKLTPHPPPPVPPVLASKMTGTKSHRSAAARSPVASAPSAVSATIPPISSTSKKASEVESLAKVSEFEPDQQLEG # GTLVWAKAGVYHAIFDLFFLLFLLSLSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g364 ### # start gene g365 Scaffold_17 AUGUSTUS gene 509825 510321 0.63 + . g365 Scaffold_17 AUGUSTUS transcript 509825 510321 0.63 + . g365.t1 Scaffold_17 AUGUSTUS start_codon 509825 509827 . + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_17 AUGUSTUS CDS 509825 509868 0.63 + 0 transcript_id "g365.t1"; gene_id "g365"; Scaffold_17 AUGUSTUS CDS 510012 510321 0.63 + 1 transcript_id "g365.t1"; gene_id "g365"; Scaffold_17 AUGUSTUS stop_codon 510319 510321 . + 0 transcript_id "g365.t1"; gene_id "g365"; # protein sequence = [MELFVTQTTIRWLVPKDAKVSGQHVTVCAAGDQNSVRSLRSFMGARQDTLAEDCWIFGTESSRAPSTTTVVLIGTAKT # DEADPMARATANTERERIMYIMYQTLQDDDHISKEKVTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g365 ### # start gene g366 Scaffold_17 AUGUSTUS gene 514673 515980 0.48 + . g366 Scaffold_17 AUGUSTUS transcript 514673 515980 0.48 + . g366.t1 Scaffold_17 AUGUSTUS start_codon 514673 514675 . + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_17 AUGUSTUS CDS 514673 514688 0.48 + 0 transcript_id "g366.t1"; gene_id "g366"; Scaffold_17 AUGUSTUS CDS 514860 514883 0.89 + 2 transcript_id "g366.t1"; gene_id "g366"; Scaffold_17 AUGUSTUS CDS 515001 515980 0.9 + 2 transcript_id "g366.t1"; gene_id "g366"; Scaffold_17 AUGUSTUS stop_codon 515978 515980 . + 0 transcript_id "g366.t1"; gene_id "g366"; # protein sequence = [MDATTLQPFAVTNRPTTNPTNQVNTTIVNEVQESLQGLSVAEAADQGAAVKDGAVHKNLTPATSPNPWSDGERHFTST # ARERELVLVPTDVEDEESEPRADDEAEARHILHTPDPSTFDRYVTGGFATDPQASAPLVAPPPATEILQEFDPLADQEEEHAKKAWEESEGHPAPPVP # RDRISSPPPPVPLKDLPSPSPISIPSAQSSGGFQSSLVALARSFSIPSLTRSPKSKGRPLSMDVAKPVPSPDTISSFATQQAKQPESNERKPESPDRQ # EEEDFEGSDTGSEDSRPGDPPFDFQKFLDQMKMRSADPVSKYLKSYVPNSSVFDLKVQPDFPSGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g366 ### # start gene g367 Scaffold_17 AUGUSTUS gene 516715 517503 0.93 - . g367 Scaffold_17 AUGUSTUS transcript 516715 517503 0.93 - . g367.t1 Scaffold_17 AUGUSTUS stop_codon 516715 516717 . - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_17 AUGUSTUS CDS 516715 517503 0.93 - 0 transcript_id "g367.t1"; gene_id "g367"; Scaffold_17 AUGUSTUS start_codon 517501 517503 . - 0 transcript_id "g367.t1"; gene_id "g367"; # protein sequence = [MQQTHQFGTGKDGALPEGVPALDVEALAYLSGEPKFSSAKSNASLKILLIAFSGLLTASPVFCRSLRASSESCCAMGA # CEYTFCDNGSESGCADSAPRWGELRCVGVDIEERDEDDEDEDDEDPIDSTRGVPSGLVGSSWIAASTFLVWSYEQQSKLAKITNCSNSSWVIFDKDVW # SIDSINCTAPICERRYTISTSYEVACTHQARQIVSCFAPKLVWISKSIDEPDVDRRFSSASMSDGALYALHIGKEMVRIRFQHHEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g367 ### # start gene g368 Scaffold_17 AUGUSTUS gene 517574 518206 0.91 + . g368 Scaffold_17 AUGUSTUS transcript 517574 518206 0.91 + . g368.t1 Scaffold_17 AUGUSTUS start_codon 517574 517576 . + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_17 AUGUSTUS CDS 517574 518206 0.91 + 0 transcript_id "g368.t1"; gene_id "g368"; Scaffold_17 AUGUSTUS stop_codon 518204 518206 . + 0 transcript_id "g368.t1"; gene_id "g368"; # protein sequence = [MASQSLPDSRSSSPASFMAQGVYQTPAPSTDGGPPVQTPYKPRVRRVPSPGGYLNQAQAPLYGQSVLSPGYSPGYSPG # YSPEDTPSRPRPSGQGPQTHYPLAMGSSQQVQPPARVQSLHPYYDQPGSPNLNLGSPLNYSRASTPGSGDLDIAGMQAEIDTAHSQATEASRNTLFQI # FPGVDREVVEWVLEANEGDLGKSIEQLLEMSEGG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g368 ### # start gene g369 Scaffold_17 AUGUSTUS gene 518372 519196 0.52 + . g369 Scaffold_17 AUGUSTUS transcript 518372 519196 0.52 + . g369.t1 Scaffold_17 AUGUSTUS start_codon 518372 518374 . + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_17 AUGUSTUS CDS 518372 519196 0.52 + 0 transcript_id "g369.t1"; gene_id "g369"; Scaffold_17 AUGUSTUS stop_codon 519194 519196 . + 0 transcript_id "g369.t1"; gene_id "g369"; # protein sequence = [MTNSEVYTFLSVYSHIAMSSSSETTVTPNTPRLEINTSEETLSSSSHPTTHKGETSENEEEHEPDTPTSSSSSSTSSF # TTVTADMSSYTAEIDASISHKPTSLSDSSNSSLNSSMARVSSAGPIVDQPTATSSSKSAPPTPPKTTKRRSRAFVTWAPFPEQGWDDNTPTNGNVLDF # RTEKPVSRRECFQICSRSLGAEPINAGITHTEKLISHSLRVAYEGNWSFSKVFADGSFMASGYIHLPVGGRKSSKSVKDNTYVRFTLRDLYFVLTSRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g369 ### # start gene g370 Scaffold_17 AUGUSTUS gene 525587 525928 0.74 - . g370 Scaffold_17 AUGUSTUS transcript 525587 525928 0.74 - . g370.t1 Scaffold_17 AUGUSTUS stop_codon 525587 525589 . - 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_17 AUGUSTUS CDS 525587 525928 0.74 - 0 transcript_id "g370.t1"; gene_id "g370"; Scaffold_17 AUGUSTUS start_codon 525926 525928 . - 0 transcript_id "g370.t1"; gene_id "g370"; # protein sequence = [MVSVIQVKSKQQQPTTRGAAYATVNRPRALATKKAARRIVTDSRFCLDSKGVGEMEGEGSSGVDRKSFFACKENGCLT # GPADEDGQLKAPPFYSTSYEAYLHSTAHTKSPHHI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g370 ### # start gene g371 Scaffold_17 AUGUSTUS gene 527207 527953 0.59 - . g371 Scaffold_17 AUGUSTUS transcript 527207 527953 0.59 - . g371.t1 Scaffold_17 AUGUSTUS stop_codon 527207 527209 . - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_17 AUGUSTUS CDS 527207 527953 0.59 - 0 transcript_id "g371.t1"; gene_id "g371"; Scaffold_17 AUGUSTUS start_codon 527951 527953 . - 0 transcript_id "g371.t1"; gene_id "g371"; # protein sequence = [MGPSNAGSPSRKHDRDEDREKYRDRVQKPRTHNVDGATTDAYGFHPHYNSNISNYESQSSLFHEQLQSAQVQYPESNS # STVFSSALPSSSCSSQHHSSSYLEIPSSSSTRTAESFNQAMAIESMMELPLHTEDLGRLPVLLGSDHHWDDQSINSPDINTYAGPAQDSRLGLTNELN # VNSAYCFAYADLDSATGGATLNSSASSVVPPEAWDFGETAGYQDHTVLAGVCSSQILNQTAVVKNVCIFRIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g371 ### # start gene g372 Scaffold_17 AUGUSTUS gene 534822 536015 1 + . g372 Scaffold_17 AUGUSTUS transcript 534822 536015 1 + . g372.t1 Scaffold_17 AUGUSTUS start_codon 534822 534824 . + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_17 AUGUSTUS CDS 534822 536015 1 + 0 transcript_id "g372.t1"; gene_id "g372"; Scaffold_17 AUGUSTUS stop_codon 536013 536015 . + 0 transcript_id "g372.t1"; gene_id "g372"; # protein sequence = [MGRALYSQSYAPAIREPSSSQYEKWSISNPFDPDSEEFFEGAQYEAFLPTPTNSSTNNGESAIPTRVPISATRATMTR # DVSQPLRTSRVRISSEDPSVTSASNSLIFDSVPRDFPDMDAPTLPISPPPVTISDFIDADMETTRPTPSPMAADSDSEDPIRILAGFINASRSQGETE # ANINVSEILRQLDERWRREVREAQNLLRDDNGSRPQRYLPPLSYPSSNASSSYSRADSPSSPIFFPSPPSETLPTPPTMSRELAVFPDSESSRHLTFH # LDEDLEQVERELLDFESQSVLDATESLPAPFSESSSAPVVPASQSQTPPRPVRIRHHPSSSVGNEVGLDMSPPPSVSPRLYNWSRTGSESRPRYNSLT # TSSVNFGRHEGLRSVRGVTISEGRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g372 ### # start gene g373 Scaffold_17 AUGUSTUS gene 536725 537246 0.97 + . g373 Scaffold_17 AUGUSTUS transcript 536725 537246 0.97 + . g373.t1 Scaffold_17 AUGUSTUS start_codon 536725 536727 . + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_17 AUGUSTUS CDS 536725 537246 0.97 + 0 transcript_id "g373.t1"; gene_id "g373"; Scaffold_17 AUGUSTUS stop_codon 537244 537246 . + 0 transcript_id "g373.t1"; gene_id "g373"; # protein sequence = [MGQLLHSIQLAAKEEERAVARAAASFNGNKGRLKRMSLHYPVSDLRSTSTNGDEQEMQDSDESEDGVVEVAEFFDSTS # SWVIRGPNDSFYVSSRHRPVGAIANEQAFVRDLATGRLELVEPNDYYYSDEDFEDEEEMKLGHAQEEDTSELEELGEEEEGSELSAEESDDSDPE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g373 ### # start gene g374 Scaffold_17 AUGUSTUS gene 537753 538208 0.94 + . g374 Scaffold_17 AUGUSTUS transcript 537753 538208 0.94 + . g374.t1 Scaffold_17 AUGUSTUS start_codon 537753 537755 . + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_17 AUGUSTUS CDS 537753 538208 0.94 + 0 transcript_id "g374.t1"; gene_id "g374"; Scaffold_17 AUGUSTUS stop_codon 538206 538208 . + 0 transcript_id "g374.t1"; gene_id "g374"; # protein sequence = [MRHTTRPLAPYNDSRYPVFQSFEHDFSEEAGSEDFPENFTIYCSSSSEPEFREMEQRQTRLTASEIERTWSSLAELHE # GLDLSRFTDADEDVSYSDTSEDLASHSESSYPSPPESVREERAYLHQDRTTAPRDLVDQLLDAPNVPLPWGRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g374 ### # start gene g375 Scaffold_17 AUGUSTUS gene 542426 542785 0.71 - . g375 Scaffold_17 AUGUSTUS transcript 542426 542785 0.71 - . g375.t1 Scaffold_17 AUGUSTUS stop_codon 542426 542428 . - 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_17 AUGUSTUS CDS 542426 542785 0.71 - 0 transcript_id "g375.t1"; gene_id "g375"; Scaffold_17 AUGUSTUS start_codon 542783 542785 . - 0 transcript_id "g375.t1"; gene_id "g375"; # protein sequence = [MAEALKALVEIISTETTALLSAYATHEVKFPSIDETSTTSENTDFDVDPTIVRMRQLIVAAAAQLIATVQPPGEFLQD # AAPAMFKSATLGFVIDVDVPEILMEAGPTVRRISCKRSVLI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g375 ### # start gene g376 Scaffold_17 AUGUSTUS gene 543652 545050 0.3 - . g376 Scaffold_17 AUGUSTUS transcript 543652 545050 0.3 - . g376.t1 Scaffold_17 AUGUSTUS stop_codon 543652 543654 . - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_17 AUGUSTUS CDS 543652 544320 0.89 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_17 AUGUSTUS CDS 544553 544744 0.35 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_17 AUGUSTUS CDS 544901 545050 0.89 - 0 transcript_id "g376.t1"; gene_id "g376"; Scaffold_17 AUGUSTUS start_codon 545048 545050 . - 0 transcript_id "g376.t1"; gene_id "g376"; # protein sequence = [MTAKAIEYMIVDGLKLAEPFMHIAQRIRDPEEFLWLTDDLLPEIERSKDPLVTEQRILECARDAYYELPKEQQDEMDE # AWKEAGLTLDDLTINDIKVEQSMLHYGMKEENPLDYAGYHRIQRDTPHSPGDAPETVVVKVAEGGQPIPVSDHTTRSITRGSEALMSPPVTERGLPDD # GPPTSQDLTEPSGSRSISRHESTRSISTIPDAEHSLATAATLDSTSTVPSPEIPNKSPKLSTPGAPASPHVPALGKPLSTKSSWISTVNRFTAVDPGH # GSPGKTTKPASKKRDRSKVDAEDKPVTGTIPTSRRTRSSAATLPGDREISPSPIARKQARLG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g376 ### # start gene g377 Scaffold_17 AUGUSTUS gene 546580 547629 0.98 - . g377 Scaffold_17 AUGUSTUS transcript 546580 547629 0.98 - . g377.t1 Scaffold_17 AUGUSTUS stop_codon 546580 546582 . - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_17 AUGUSTUS CDS 546580 547629 0.98 - 0 transcript_id "g377.t1"; gene_id "g377"; Scaffold_17 AUGUSTUS start_codon 547627 547629 . - 0 transcript_id "g377.t1"; gene_id "g377"; # protein sequence = [MGRPLWSTVYNPRSTEIPTKTPGKWSSTNIFDPDSDAFFYGAELEVPIADAPVMTEPDTTLSSFDWTAASSVERLNSL # AELVAERRRELLDVMVRRRRIEALDSIRRAREAIATQRQTQRGGTLPVARESSTSSGNPSVVIPSAGYSSGTPLSPLSESGLAELQNEPESDEEFIEV # PMRFAPAVNRRSRESSLSSNRRDTSRRLSDHAARQAFINSLREENREVALEIERRRNRLREQAQNQRLEDEGSSVDRTRVSSLSLSRQRRESLYSRLS # SAPGQPGLRSRALSTPTHTAASASEQAATSVELETKPKFGGPWRLLSLFFEGRGTGEIAYLLLIPGFHDPMRWRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g377 ### # start gene g378 Scaffold_17 AUGUSTUS gene 549503 550015 0.35 + . g378 Scaffold_17 AUGUSTUS transcript 549503 550015 0.35 + . g378.t1 Scaffold_17 AUGUSTUS start_codon 549503 549505 . + 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_17 AUGUSTUS CDS 549503 550015 0.35 + 0 transcript_id "g378.t1"; gene_id "g378"; Scaffold_17 AUGUSTUS stop_codon 550013 550015 . + 0 transcript_id "g378.t1"; gene_id "g378"; # protein sequence = [MTHTSEFSFFASPYDNTWQTNAGVSNFQSYNQCPEVLVQHLQPEHMSYESCAGMDYMTGLDPSTSVVISPEDLEVIFG # SNTHHDQHVEHDAGFPEVSPCFNLPSYDSPAISQNQTLPFESLESLPFESIDTQTLPLEFFEPFPSTSFPSLSSSSTDPLFDLDQFAASLAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g378 ### # start gene g379 Scaffold_17 AUGUSTUS gene 552030 552794 0.52 - . g379 Scaffold_17 AUGUSTUS transcript 552030 552794 0.52 - . g379.t1 Scaffold_17 AUGUSTUS stop_codon 552030 552032 . - 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_17 AUGUSTUS CDS 552030 552794 0.52 - 0 transcript_id "g379.t1"; gene_id "g379"; Scaffold_17 AUGUSTUS start_codon 552792 552794 . - 0 transcript_id "g379.t1"; gene_id "g379"; # protein sequence = [MMTVRVTVVLLPPRLQLPPHREGGGGGGGGDDGAPRTPRDGDDGEGNRGAPSPRLRVLLPHRGGDDGGRDVPSPQLQL # PRHREGGGGGGDRDRDAPSLPPRPPPHCEGGGGDRDRGVPSLPPRSLSHHEGGGDGGDDDHGALSPQPQLPPHRGGGGGGDDDVRHAPSPRSRVPPHR # GGDGDGRGDALSLQPRFPLRHEGGDGGGDGGAPRPPPRSVPPHHEGGGGDDDDGDGGDVQHQNARRHGDATTTIVSNM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g379 ### # start gene g380 Scaffold_17 AUGUSTUS gene 553048 553646 0.4 + . g380 Scaffold_17 AUGUSTUS transcript 553048 553646 0.4 + . g380.t1 Scaffold_17 AUGUSTUS start_codon 553048 553050 . + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_17 AUGUSTUS CDS 553048 553191 0.4 + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_17 AUGUSTUS CDS 553269 553646 0.98 + 0 transcript_id "g380.t1"; gene_id "g380"; Scaffold_17 AUGUSTUS stop_codon 553644 553646 . + 0 transcript_id "g380.t1"; gene_id "g380"; # protein sequence = [MFAILTNHKHFLFVQHHAEHEHEHEVEIIPVPIPVPVHAPVNEHKVSTFQAKKEEVTIVVGMENGPAIGGRPLQRMER # RRVDEGSSTTPGSGSGSASGPGSGSLKTPPSTGSSLTPITEEVPSPTAPGVAGATKSARPTLQRGIPFSTALPLPTQGSLGSRSTPFGDFGDDLD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g380 ### # start gene g381 Scaffold_17 AUGUSTUS gene 564138 565127 0.73 - . g381 Scaffold_17 AUGUSTUS transcript 564138 565127 0.73 - . g381.t1 Scaffold_17 AUGUSTUS stop_codon 564138 564140 . - 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_17 AUGUSTUS CDS 564138 565127 0.73 - 0 transcript_id "g381.t1"; gene_id "g381"; Scaffold_17 AUGUSTUS start_codon 565125 565127 . - 0 transcript_id "g381.t1"; gene_id "g381"; # protein sequence = [MTYLLIFGHGNGGGLVREIWRGWVRGGGLGSNLVSLDPKASGDMDVDNNASSNVATSRSSHLEPLKPTITSSARLRGM # TAPNADEDPWAPLLLLADLYSHGLITMGDDEFFSSDSTVIGTRPSAAHRNPLTLDEISTFTRQLLNIAWSLWMYGGDLEIEPLPSILTSAVPNPRVRL # TWLEIRGKVTKCLLAINARDARKPFMPKGGWLVLNDAESNGAPHGEGMHLTPEMAGFVEAAIFEAQELMDDSEASLEDALMDSVSSPRRGPRSHAPSA # SSAYSKRKLNYLSPRLGVLNNIPFAIPFHVRVAIFRNFIHMDLAGRRTSRSVSAQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g381 ### # start gene g382 Scaffold_17 AUGUSTUS gene 570515 571761 0.5 - . g382 Scaffold_17 AUGUSTUS transcript 570515 571761 0.5 - . g382.t1 Scaffold_17 AUGUSTUS stop_codon 570515 570517 . - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_17 AUGUSTUS CDS 570515 571267 0.99 - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_17 AUGUSTUS CDS 571356 571654 0.5 - 2 transcript_id "g382.t1"; gene_id "g382"; Scaffold_17 AUGUSTUS CDS 571713 571761 0.98 - 0 transcript_id "g382.t1"; gene_id "g382"; Scaffold_17 AUGUSTUS start_codon 571759 571761 . - 0 transcript_id "g382.t1"; gene_id "g382"; # protein sequence = [MAWPDDREDINSFALNAVSGLLEKYKIDPKSIGRIDVGTETIIDKSKSVKTHLMDLFTECGNGDIEGIDSKNACYGGT # AALFNAVNWIESTSWDGRNAIVVAGDIAVYAEALLDLLLLIARVAVHGTHMSNTYDFYKPNLTSEYPEVDGPVSVVTYTSALDFAYNAYREKVARFAK # RAGISGQPSFSIDSVDYAIFHSPYGKQAVKGHARMLYNDFLASPTSSKFANIADAEAFRTLSQKASLSDKNLEKAFITAGKASFKAQVDPGMACSKRL # GNMYTASLYGCLASLIANVEPSSFKGKRVSLYSFGSGCAASFFTIKVKGDTTEMREKMDLTNRLAAMKVVPCQDFVDALNVSLIDISYFFLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g382 ### # start gene g383 Scaffold_17 AUGUSTUS gene 574973 576016 0.87 + . g383 Scaffold_17 AUGUSTUS transcript 574973 576016 0.87 + . g383.t1 Scaffold_17 AUGUSTUS start_codon 574973 574975 . + 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_17 AUGUSTUS CDS 574973 576016 0.87 + 0 transcript_id "g383.t1"; gene_id "g383"; Scaffold_17 AUGUSTUS stop_codon 576014 576016 . + 0 transcript_id "g383.t1"; gene_id "g383"; # protein sequence = [MGRLLIRDHSKIQFRHTLSYAVSFGCFSSYAIVLISIYSLQDKSRACPSCNFKTCDPGSLTRHRKRIHGYVPKPRKAR # ATKKQQDTSSDRSISPSLTSVSSESISGLSSPWSSSSPSSESTIDFSSLTLASEVEPTTTLHIDEEICKPFFPEVLPTDVDLFYEPDSVSGFGYSTFD # DLRPRPLFPAVESTPSLELFQPLHSNYSPNFSLLLAATHKTLPFPTINHVDDQALYNIPCGVFLENVCDESLHQPLPTPYDSFIQQMAEMDPSIFVTI # SDHDFRVVFGCDYEHFVAARARSPSPWSSTLGSSINPVTSSIPGSSIDPITSTTSSPTPKPFTGSLLAELYAP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g383 ### # start gene g384 Scaffold_17 AUGUSTUS gene 581876 584571 0.4 - . g384 Scaffold_17 AUGUSTUS transcript 581876 584571 0.4 - . g384.t1 Scaffold_17 AUGUSTUS stop_codon 581876 581878 . - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_17 AUGUSTUS CDS 581876 583128 0.97 - 2 transcript_id "g384.t1"; gene_id "g384"; Scaffold_17 AUGUSTUS CDS 583212 583535 0.81 - 2 transcript_id "g384.t1"; gene_id "g384"; Scaffold_17 AUGUSTUS CDS 583635 583933 0.48 - 1 transcript_id "g384.t1"; gene_id "g384"; Scaffold_17 AUGUSTUS CDS 583982 584571 0.65 - 0 transcript_id "g384.t1"; gene_id "g384"; Scaffold_17 AUGUSTUS start_codon 584569 584571 . - 0 transcript_id "g384.t1"; gene_id "g384"; # protein sequence = [MLTGDLPSPLFSPAESDNESDGNEELSREASDPDASIHPTRPSLSQTKSDTHITRWGPNRAFRKDSPPRIEPTGAANV # VPTSNTNASQSHTSPHHVYSATNLSGYFASHIQGQSQQAELSSSSSSPRGGSAEVTPSGGIHSNGHKKKHITFNTFVEQCIAIDQPKPKETTFAAILG # DVEEDWYAKTHDSVKASYDDGYDEDAEDGFDGDWGLNECAISTDSESDADQVLGESACDDDEEEEEEEGIIQMRSRRDSFDNKNSARLRSTSKVSTSS # SSSSASSASASSNHKNIPPNIRHKEMVSIAPIAPTMLKTGSQTSWDGFGVHGVQSPYGLPASGGWSEGFGDDFSDDGSNIHVGPGGAKLYIGSSNNES # EGSTPVGLVYMPPATTRYGNSIIPRVNSNTSLIEERTSENGDKVYRHHEAYFSIGSDKDGVLGVRSSSVPIVVRTPAVNVHGNRDDDDDDVAEEDAYD # YFGGPDLGEDFAHRKTKFSARRKPQRSSEAVSSPVTIKGNSNAQAVDEERQSRSRSRSRSRTPSPSYVSQSSTPAISVPGRAEHVSSPPPSSSSLLSP # PLRGREFVPAEQPSTSRGRASRTSSSFPDRSRSRSNHSSPLGSLSPEGIGSAYSANGRGGGDRERERERSNRNGGRGRERTERHLSHSLSPDAVECVS # SLGPDAASSVSSSSSGSQTVVPQYDHADTFESSVDNPSVKVQVRTSQSTPTNSPVISMSGAAHAIARMNGKSPITIPDPHVSSPRLTYPSHSTSEPSN # TNTSSSPPVSPKGSTLSGTSISTKDSDNDDTGVVGKAVGIVSSAGSYFSFWNNGAGV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g384 ### # start gene g385 Scaffold_17 AUGUSTUS gene 588975 589496 1 - . g385 Scaffold_17 AUGUSTUS transcript 588975 589496 1 - . g385.t1 Scaffold_17 AUGUSTUS stop_codon 588975 588977 . - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_17 AUGUSTUS CDS 588975 589496 1 - 0 transcript_id "g385.t1"; gene_id "g385"; Scaffold_17 AUGUSTUS start_codon 589494 589496 . - 0 transcript_id "g385.t1"; gene_id "g385"; # protein sequence = [MAATTTKKRAAKSQSGPAPKKVKKTDTATGKLDTNTTKKAKRSIPVTLTTSPPNDSENTDDEDDWEDAEDDVDFDGQA # VDDDNAMQVDSGEGKTSARESHIAQKVLQQSRKAAKPHSDLISEAKRVWALARSQSISASERKKHITDLMNVVRGKVRQVGFGSLYQFWTKFFDR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g385 ### # start gene g386 Scaffold_17 AUGUSTUS gene 591190 591633 0.97 - . g386 Scaffold_17 AUGUSTUS transcript 591190 591633 0.97 - . g386.t1 Scaffold_17 AUGUSTUS stop_codon 591190 591192 . - 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_17 AUGUSTUS CDS 591190 591633 0.97 - 0 transcript_id "g386.t1"; gene_id "g386"; Scaffold_17 AUGUSTUS start_codon 591631 591633 . - 0 transcript_id "g386.t1"; gene_id "g386"; # protein sequence = [MNGAKYKKQLYDELGNFFVCFSCSISLNIFEASKNPNVTLLHYADATRYEHRLVAAFDLSQLPPLAGAGVPPAPARAH # ISFFKILLPYGLTHSVTAAAPLVAGIAELLAGQQNILNILEGMQTQIAQIDRRSAFVKSTASQHKKLKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g386 ### # start gene g387 Scaffold_17 AUGUSTUS gene 593403 594179 0.86 - . g387 Scaffold_17 AUGUSTUS transcript 593403 594179 0.86 - . g387.t1 Scaffold_17 AUGUSTUS stop_codon 593403 593405 . - 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_17 AUGUSTUS CDS 593403 594179 0.86 - 0 transcript_id "g387.t1"; gene_id "g387"; Scaffold_17 AUGUSTUS start_codon 594177 594179 . - 0 transcript_id "g387.t1"; gene_id "g387"; # protein sequence = [MCQVNQPECNRRLNAQHNIITNAFGGKLSVAPTNLATGDRVLESAAGSGKPIYLLSVVLFYDPQLTHRSPGIWALEFF # ETNRADGITLDIECIDISSEQFPTTHPPEIKFSVNSVVNLPNPEWTERFSFAHQRLLVAAMNDALWHLAVAELFRVVKPGAWVELVEIEAQGFGSWSV # GPHSTKLAFLINTMYDKRGVIGDLSVYLPLILKEAGFVDIKCQARHAPIGGEADAAAPHKFTQVKGFDSEMWRELWMGMKVP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g387 ### # start gene g388 Scaffold_17 AUGUSTUS gene 599398 601128 0.62 - . g388 Scaffold_17 AUGUSTUS transcript 599398 601128 0.62 - . g388.t1 Scaffold_17 AUGUSTUS stop_codon 599398 599400 . - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_17 AUGUSTUS CDS 599398 601128 0.62 - 0 transcript_id "g388.t1"; gene_id "g388"; Scaffold_17 AUGUSTUS start_codon 601126 601128 . - 0 transcript_id "g388.t1"; gene_id "g388"; # protein sequence = [MDRSTSVSPIQGLSIPLPPSHANSPAPQSPKPNISLNQSEPNTSTNTQSMDITDAHDSPIRYLAESGSEAIEGRDESV # ERSVAGKEDTSEHTFSTDDGPTPYAVIKNENSRSPEGLASAFSSPATSMATPTPAFTRPRARFNLPEGSSSDESHEAHREDHAIHDEEMSLEEPMTPQ # TRRRSFFLSVINSTTRPRMKFPTPHPRDRIVPDTPSMMDVIPGPASRSIVQHTPIAFPSAFAGATPRPRFKPSSRLSHPLAQAHTLTSSSSTSESEPG # EETDGTVRPENNDEINNEHLPWSTPAPVASVAHLSPYDEAALNGASFVSTASSHDLTTHPRANTSFDPAMGFGGNAPGHGVGRFNANKLNTYLHGLNR # KLQEENEALMERNRILEENQGKSSSASIPPTPVASAMGSRRQSGGSRRLSAVSNLGDLQEEANEAWMEEKAELEEMVDAFKNEAEQCMKEKEEVENAL # ERETRERAKDKERWKERMSEVQKGVEDIVRDLENKLHAAQENAQNAEKDALGQAKDLEKKLAEAQAQRDDAAARAEKAEGALANNQDLGGELRNANDR # VSCLIGGD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g388 ### # start gene g389 Scaffold_17 AUGUSTUS gene 601307 601990 0.62 - . g389 Scaffold_17 AUGUSTUS transcript 601307 601990 0.62 - . g389.t1 Scaffold_17 AUGUSTUS stop_codon 601307 601309 . - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_17 AUGUSTUS CDS 601307 601990 0.62 - 0 transcript_id "g389.t1"; gene_id "g389"; Scaffold_17 AUGUSTUS start_codon 601988 601990 . - 0 transcript_id "g389.t1"; gene_id "g389"; # protein sequence = [MASMLETPSRIWRRIEAEGSRDMPSLPSVPGFDDSAEISISSDDPRPYHGEYEVNEEPSFGHIASPIHSTPAASSHHA # STIRATSSTSSTTRFAHSLARSGRSSLAHSSISRALSARRNYPDSFEISAIPSLPDDDIGRRSDCSSGEIDDDLVGSRESAPEGYTYTSDRIRMPMDE # DANFDVSLTDALESISSPYQSEPERGRTPKEQSYIDYEVSLKSSPKVRVGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g389 ### # start gene g390 Scaffold_17 AUGUSTUS gene 602541 603638 0.36 + . g390 Scaffold_17 AUGUSTUS transcript 602541 603638 0.36 + . g390.t1 Scaffold_17 AUGUSTUS start_codon 602541 602543 . + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_17 AUGUSTUS CDS 602541 602737 0.37 + 0 transcript_id "g390.t1"; gene_id "g390"; Scaffold_17 AUGUSTUS CDS 603086 603638 0.82 + 1 transcript_id "g390.t1"; gene_id "g390"; Scaffold_17 AUGUSTUS stop_codon 603636 603638 . + 0 transcript_id "g390.t1"; gene_id "g390"; # protein sequence = [MSLEERMLERFTKERQRASKGVAFNLEDEDELTHYGQSLSKLDDFDDIGLEEEDEDDETGNQSKQALLYAPDPSATGS # NSTPLGAPGPSLSVATPETALVATEKTANYDQAVRELAFDKRAKPKDRTKTEEELAVEEKEALEQAEKRRRKRMLGLEDSDSENEGRSKKRQRGGDDL # EDDFNNEELGWNGLGTGLEGAHSGEEESDDDGTGDSGESAQGADEDDSEEGDDHEDQDDEELVRTSQKRVCRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g390 ### # start gene g391 Scaffold_17 AUGUSTUS gene 604424 605012 0.67 + . g391 Scaffold_17 AUGUSTUS transcript 604424 605012 0.67 + . g391.t1 Scaffold_17 AUGUSTUS start_codon 604424 604426 . + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_17 AUGUSTUS CDS 604424 604645 0.7 + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_17 AUGUSTUS CDS 604698 605012 0.87 + 0 transcript_id "g391.t1"; gene_id "g391"; Scaffold_17 AUGUSTUS stop_codon 605010 605012 . + 0 transcript_id "g391.t1"; gene_id "g391"; # protein sequence = [MAKGLKIQQPDLNDLLTNQNHDAASKLNLLALSLDLLGRYANISKGLEAFVEVFDPINQILQNLKLEKFEDDLQARAT # STKEIIERLLKFTRQSRRPLMLQAHKAIPIPSYVPKFDSTSSSYLRHQDPDKERNEAAKLRNEYKKERKGAIRELRKDARFLAGYSRLNRRRRTKVTA # NV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g391 ### # start gene g392 Scaffold_17 AUGUSTUS gene 605696 606551 0.51 - . g392 Scaffold_17 AUGUSTUS transcript 605696 606551 0.51 - . g392.t1 Scaffold_17 AUGUSTUS stop_codon 605696 605698 . - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_17 AUGUSTUS CDS 605696 606004 0.99 - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_17 AUGUSTUS CDS 606056 606280 1 - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_17 AUGUSTUS CDS 606369 606551 0.52 - 0 transcript_id "g392.t1"; gene_id "g392"; Scaffold_17 AUGUSTUS start_codon 606549 606551 . - 0 transcript_id "g392.t1"; gene_id "g392"; # protein sequence = [MSEINVQDMRDPNTAATPPPDVAQRGPPSDTSDDRSDDERKKDAELAERLSRLIEDANSRVHIENMEARKDEDRDEGE # LVQQVKPLLQQAEKILNETMGMIKGADPDNRLSDRAKRHAQTHNATPEEQRLAEALKVLLEEVGGTIEWARDKLDSFPKAKKDLGPLLDALGRRYFLF # PVGQAIDDYGRTIDSNCRRSRPFASWCAQPSWKPTERPGTRQSVERNRFGHGRVSTPSMNES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g392 ### # start gene g393 Scaffold_17 AUGUSTUS gene 613480 614172 0.9 - . g393 Scaffold_17 AUGUSTUS transcript 613480 614172 0.9 - . g393.t1 Scaffold_17 AUGUSTUS stop_codon 613480 613482 . - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_17 AUGUSTUS CDS 613480 614172 0.9 - 0 transcript_id "g393.t1"; gene_id "g393"; Scaffold_17 AUGUSTUS start_codon 614170 614172 . - 0 transcript_id "g393.t1"; gene_id "g393"; # protein sequence = [MTSSDVVPNSIESLAPAAAPVGGDLSLMPTITIPGLFAFPVFTPAPIPHNCDIYGMLRPSVSCEKSSELSNLVNDPCS # DGIFWGPLTRSLEPKILLPAYESASPLHTTSVQLSSKHDLDGLIVLAPTSFTNDGIGNSALPELYMAIGSVTVLAYFWLFKRLRSTFENLFGSVTTQV # DYSFDNLHGFLRDSCSVPFAPDVFDNEDAVVVVEQYEEENEHDTVARPNGASVV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g393 ### # start gene g394 Scaffold_17 AUGUSTUS gene 617703 618074 0.91 - . g394 Scaffold_17 AUGUSTUS transcript 617703 618074 0.91 - . g394.t1 Scaffold_17 AUGUSTUS stop_codon 617703 617705 . - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_17 AUGUSTUS CDS 617703 618074 0.91 - 0 transcript_id "g394.t1"; gene_id "g394"; Scaffold_17 AUGUSTUS start_codon 618072 618074 . - 0 transcript_id "g394.t1"; gene_id "g394"; # protein sequence = [MEVALAESTALSQKSEREYITLRESLKHLTESWKSDTERLRDEIRKREEKWKGEAETLGKKYRKLVEEVQASRKGEEV # VKVLKEEDRNKAKEIEDRWMKEIDKMKQVVEQNEKDSKEDSETAR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g394 ### # start gene g395 Scaffold_17 AUGUSTUS gene 621346 622977 0.35 + . g395 Scaffold_17 AUGUSTUS transcript 621346 622977 0.35 + . g395.t1 Scaffold_17 AUGUSTUS start_codon 621346 621348 . + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_17 AUGUSTUS CDS 621346 622977 0.35 + 0 transcript_id "g395.t1"; gene_id "g395"; Scaffold_17 AUGUSTUS stop_codon 622975 622977 . + 0 transcript_id "g395.t1"; gene_id "g395"; # protein sequence = [MKIRRKSLGVLLKHVARFKELHVVADLWEDSSTPIYNLFVEPAPTLVSLTLRTDGKDVTNGSLPPIFAGEMPSLKELT # LEHFTVWPTTYFHNLTSLSLSDQAFNRPTTLSFLDFLQNSPVLEMLALVRAGPTLPANTDMIPATDRVVDLPRMRQLNLGGWPTTSTISRFLSYISLP # PEADVFIWGSVFSNPDTDLTALLPANTNNLHNIQGITKWYLTHYSVAQPGDLLYVPFTAIVGSSNSLHNYGVFRSSQLLATLPRYPLHNVTSFVLRDS # SYQANRFKTSVWVEIFGKLKNLQELRILAYQSTTTTRSVLTALLPASSKSAKKKDISQNGNRREIHEGQKEAGSSTSNAANTESSGTGKSKVPTDEEQ # EPENFHSPPRGDHSRCEVLCPRLTTLSVEHDPDLASIFITKLVKSRKEHGCPIASLIILVFDPQYGVSPSPRPRSTRSDHDVNNQNQNQNQNHQNGHH # TAGVNAADDSSSTVSSRDILNEEYNLRSKEDEELLKRHVKEVRFEYKKPLSQDLVPRGWPTDAYRRTCLSYSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g395 ### # start gene g396 Scaffold_17 AUGUSTUS gene 624030 625198 0.52 + . g396 Scaffold_17 AUGUSTUS transcript 624030 625198 0.52 + . g396.t1 Scaffold_17 AUGUSTUS start_codon 624030 624032 . + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_17 AUGUSTUS CDS 624030 624096 0.84 + 0 transcript_id "g396.t1"; gene_id "g396"; Scaffold_17 AUGUSTUS CDS 624262 624648 0.62 + 2 transcript_id "g396.t1"; gene_id "g396"; Scaffold_17 AUGUSTUS CDS 624699 625198 0.99 + 2 transcript_id "g396.t1"; gene_id "g396"; Scaffold_17 AUGUSTUS stop_codon 625196 625198 . + 0 transcript_id "g396.t1"; gene_id "g396"; # protein sequence = [MSDMKEILVIGGTGAQGSMVVKEGRQDNQLDLHRAFQGVYGAWVNTDGFSLNEKEELFYGIRTYEIARHERVQHFIWA # SLPYTLKNGNWDIKYHAAHSDSKGRVRDFILAQGQGDMKSSILTTVPYMEMLIDGVFVPQKQPDGSFVWLNPATTGKIPLIALDDVGHYSLWLFDNIS # ESAGMDLKVVTDYVNFEDITNTFTKVTGKRGLHKSLPLEEYLPFAEPFPNAPVNWYAGPNAARDESLLSWRDNITAFWRHWDDEVDVVANMDLLNRIH # PNRIKSLEEWMRKVEYDGSMKPIMKGPEDLRRAKIELKRGGKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g396 ### # start gene g397 Scaffold_17 AUGUSTUS gene 626608 630536 0.19 + . g397 Scaffold_17 AUGUSTUS transcript 626608 630536 0.19 + . g397.t1 Scaffold_17 AUGUSTUS start_codon 626608 626610 . + 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_17 AUGUSTUS CDS 626608 627149 0.2 + 0 transcript_id "g397.t1"; gene_id "g397"; Scaffold_17 AUGUSTUS CDS 627332 630536 0.56 + 1 transcript_id "g397.t1"; gene_id "g397"; Scaffold_17 AUGUSTUS stop_codon 630534 630536 . + 0 transcript_id "g397.t1"; gene_id "g397"; # protein sequence = [MSLPFIILFMDSFQVSLNSQSMLVPHWVLPENVVACESDFQKLSLRLFPHHLQSLKKDVAVAELIQSLIEFSHRLFEV # TDYVCSSLYSVVHKTCISLFGADIPELLYYNYHKYNGASERVDDVIAHGDVLSTACNVFEQLSTEDLKSLKSSLRITERHHKGGQIFCCLPKHGQPQL # KSVHFIVKLTAAMDVEYSPQKKYNEQRKDARRKSRIERGNEEYDLLHKSSEFWPQLVPFAVSMSCIAKYRQSIQYIVPSICACCGSEDRKFTGCYLPQ # SQWPVMSFLTVEDPFILSHTPQARFTYICQDLDGLLLDPRGIRALDFDCTVFEMYLCRECLAYMHRSIMPRLALKNHLYRGELPEDLQNVTWVEEMAC # SIYRTSAHVTRIFGSSSECDPFQLHGNTCAHPLNICYTAKRLPWSPADLNDLISIIFVGPKKLAKEDLQKLTPFFVRRSVIRMLLLYLQKHNRLYIEL # PPIDEQVLAMYPDNNLLPGLQDRFIYDHDTSVADVFGIESDGFDDHPADLLSHQSEVLLERSGVYDSESQDVPARFMTASSIHNIAQALPSTGFGTSD # FIIRYGKDPIDEYNNPDLFPGMFPTLYPLGIGGFEDHRQCPAISFEAHVQHLLDQSLRNFRYHHFFSFVALNVIQRRKAHLHTSLSISSNKYHYIASE # LLAVTPNILSNLANKLKNESDNSSFTEDEQHAFRLLKEVNIIAAKIPGSQASKTKIRQQIRSYFAYFGLPHLFVTLNPSAVHSPVFQVMYGDQNVNLS # QRFPAVVQPRSERAYRVAHDPVAAADFFDFMYHVIFEDLFGWDFKNGKSTQQGGLFGHLRAFYGCAELTERGCFHGHYLLFLRGGLNPSEVHKKMHHV # EEYQKQFFSFFEDIIHHHLPGTDYNCAPQYESRSEMPPDVPELDSEGDVSSELLSAWQKLFTDEHKKIGEQLQRHRCRPVCHKGKSANSDCRFGYPHD # VVEHSSFDSNHNSIILSRKESDVNGHNRFLLVYTRHNHDVKCILSGKAAKAAMFYISDYITKVPLNTEALLSTLSKAVASITSEDIDETPVMNAKRLL # HRCLTHFGRKQQIHSQQCARYLRGLTDSMSSHSTIPLPSASLMMFVQNEYRHLLDKYLDQDCSENLDIQVHFSFREGKLVHSNQVIDYWYRDLSLSDM # CFYDFIKYISLQTQSKTKTVHNSDTRTGVLRRHKLLSGHPLQSTHELIQHTNFKQGDVGREFVPMMIGAVPPRKLTNYMHYLFLLISRSFLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g397 ### # start gene g398 Scaffold_17 AUGUSTUS gene 630716 633864 0.33 + . g398 Scaffold_17 AUGUSTUS transcript 630716 633864 0.33 + . g398.t1 Scaffold_17 AUGUSTUS start_codon 630716 630718 . + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_17 AUGUSTUS CDS 630716 633372 0.33 + 0 transcript_id "g398.t1"; gene_id "g398"; Scaffold_17 AUGUSTUS CDS 633489 633864 0.55 + 1 transcript_id "g398.t1"; gene_id "g398"; Scaffold_17 AUGUSTUS stop_codon 633862 633864 . + 0 transcript_id "g398.t1"; gene_id "g398"; # protein sequence = [MESVLDDDEYADYNFVVPKGVKNIESKVFSDMQQMQLLKTDLCSAAWLSSPPSALRLSIQKSAVVSPMLPLLTIQKVD # KWIKEGKSEAERLANIRYKHSNISNQSSSDIHNSDAEVPQSSVSYSFQDIGNSSNPTSKVLTASQLKDKIANEFSLNKKQQFAFDIIASFMIFREIFK # LPEWSAKEPMVMLLTGPGGTGKTHIVQAVQKVMEYYRMDHGYRALAPTGNAASLINGRTIHSGLKIRVREHKNGKSHRPLGELNENIVVSASVKKNNN # LRIEWKDVCLLLIDEISMVDSILLAEVDASLRYAKEKPNDFFGGINVIFCGDPFQYPPVGTPLYAPIRSVSIQTDEEMMRRLGRIAWKSINTVIELDE # QKRMQGDPEYAAAVGRLRTRECIQSDVELFNTRAIRTLSNPQGVMFTTEQQYMASIIVSKNSVRQALNDFKTTAICRGQEGPELIDVVAHDQLQYKKH # TNANLNGKKVYPSVAQQQQLLAMDTSSGKLKDGLPGILKLYIGMPIIMKHENLNTELGVNNGSRGFLRKLDLSVDNNGFTYCKYALVEFPDSKVHLPG # LPLHFFPVKARSWKCSTFIINENEEKILVSVTRTQLPFEPLFALTGQGAQGHTLGAILCMLHLGGFGAYVAASRPRSRDGLFITRKVTLDDLNKPGIP # YDLWFETQRFHVMAHNTMVIWGFCKGELKEVPDAECEKRGNFSKIQYEFGDDRHDIQHNMSLNTESNHINEDQLIDGPRKNERSFQNQSPSSAQFGPL # WDHVNWSCAFDSAFVVLYNCFVSMSLQNQVIQAKSTTKHIFTLFSRLTQIHADDRNQSLWNDLRNQWRDILFKEHGSTCERYGSVLLSVSTLLEWHVP # LYHAVLTTFCSSHQTLHQHKSYIRCVTHCNPSCHSIANITNDISQVIIFELNGVSTIVPSLQLIVPFHNTDIQLKYRLSGIIYFGSSHFTVRIFNESG # IWKYDGQVNNGHYQQDYVISDIDLMELCGRHAHVLLYTFSSSHTNVNANM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g398 ### # start gene g399 Scaffold_17 AUGUSTUS gene 636868 637317 0.63 + . g399 Scaffold_17 AUGUSTUS transcript 636868 637317 0.63 + . g399.t1 Scaffold_17 AUGUSTUS start_codon 636868 636870 . + 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_17 AUGUSTUS CDS 636868 637317 0.63 + 0 transcript_id "g399.t1"; gene_id "g399"; Scaffold_17 AUGUSTUS stop_codon 637315 637317 . + 0 transcript_id "g399.t1"; gene_id "g399"; # protein sequence = [MDTTKVCIFCFAFFVRELLCLRSLRSVQWSEDRFNEIIKEIKKVGYNPKAVAFVPISGWHGDNLLEESVNMPWYKGWT # KETKAGVVKGKTLLDAIDAIETPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMIALCSFKRDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g399 ### # start gene g400 Scaffold_17 AUGUSTUS gene 641370 641814 0.19 + . g400 Scaffold_17 AUGUSTUS transcript 641370 641814 0.19 + . g400.t1 Scaffold_17 AUGUSTUS start_codon 641370 641372 . + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_17 AUGUSTUS CDS 641370 641416 0.28 + 0 transcript_id "g400.t1"; gene_id "g400"; Scaffold_17 AUGUSTUS CDS 641475 641814 0.21 + 1 transcript_id "g400.t1"; gene_id "g400"; Scaffold_17 AUGUSTUS stop_codon 641812 641814 . + 0 transcript_id "g400.t1"; gene_id "g400"; # protein sequence = [MDLESNNNNNDEHVNFNKLVHYHSLDFTADDTLYDQVEEMIAENAKVLDPLSSFMQYYNDVFAASPIPTPSNVSLQRV # SALSEYGGLWMVNESREVVRIGLVVQMSQFRDDSKYGQYMDMNVYNSQVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g400 ### # start gene g401 Scaffold_17 AUGUSTUS gene 642772 643101 0.46 + . g401 Scaffold_17 AUGUSTUS transcript 642772 643101 0.46 + . g401.t1 Scaffold_17 AUGUSTUS start_codon 642772 642774 . + 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_17 AUGUSTUS CDS 642772 643101 0.46 + 0 transcript_id "g401.t1"; gene_id "g401"; Scaffold_17 AUGUSTUS stop_codon 643099 643101 . + 0 transcript_id "g401.t1"; gene_id "g401"; # protein sequence = [MINRLHVLSDDVDDLGLLLHTEALNRANKIKQDIEHKRQAEEAREIAKREEVMRIQQTMTRAKALSDMKKKRLEELRG # QSTLDSMKQGKILSENTLCVFFEKNSVHRRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g401 ### # # ----- prediction on sequence number 10 (length = 498599, name = Scaffold_21) ----- # # Predicted genes for sequence number 10 on both strands # start gene g402 Scaffold_21 AUGUSTUS gene 28968 29349 0.44 + . g402 Scaffold_21 AUGUSTUS transcript 28968 29349 0.44 + . g402.t1 Scaffold_21 AUGUSTUS start_codon 28968 28970 . + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_21 AUGUSTUS CDS 28968 28974 0.59 + 0 transcript_id "g402.t1"; gene_id "g402"; Scaffold_21 AUGUSTUS CDS 29057 29239 0.44 + 2 transcript_id "g402.t1"; gene_id "g402"; Scaffold_21 AUGUSTUS CDS 29333 29349 0.53 + 2 transcript_id "g402.t1"; gene_id "g402"; Scaffold_21 AUGUSTUS stop_codon 29347 29349 . + 0 transcript_id "g402.t1"; gene_id "g402"; # protein sequence = [MAEFIQIPRPVTEPGSGNYWSLDMNMTGDKRVRKRRIHSRQVRSAGSQSEDEAKPYSASPIADDLDIH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g402 ### # start gene g403 Scaffold_21 AUGUSTUS gene 42611 43096 0.39 + . g403 Scaffold_21 AUGUSTUS transcript 42611 43096 0.39 + . g403.t1 Scaffold_21 AUGUSTUS start_codon 42611 42613 . + 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_21 AUGUSTUS CDS 42611 43096 0.39 + 0 transcript_id "g403.t1"; gene_id "g403"; Scaffold_21 AUGUSTUS stop_codon 43094 43096 . + 0 transcript_id "g403.t1"; gene_id "g403"; # protein sequence = [MGDALNAGSVASIRSSSTNISHYSSGTTSTYNFQQYSPSMTSSITSLSSYPNINGGGRKESNYSHVVMGRWLKLIPHP # RKDSKGDARSETHYIYSDNLDTTWLGSKREYQPQPWLFELVCLPNDDHPILLTSVQPSNNFTPILKSQEFQSVQSQPSQAEFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g403 ### # start gene g404 Scaffold_21 AUGUSTUS gene 47165 47719 0.39 - . g404 Scaffold_21 AUGUSTUS transcript 47165 47719 0.39 - . g404.t1 Scaffold_21 AUGUSTUS stop_codon 47165 47167 . - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_21 AUGUSTUS CDS 47165 47719 0.39 - 0 transcript_id "g404.t1"; gene_id "g404"; Scaffold_21 AUGUSTUS start_codon 47717 47719 . - 0 transcript_id "g404.t1"; gene_id "g404"; # protein sequence = [MDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKR # AISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHREPPAATVDVEDIWKQSAKTNLW # DSDLSLRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g404 ### # start gene g405 Scaffold_21 AUGUSTUS gene 47866 48096 0.32 - . g405 Scaffold_21 AUGUSTUS transcript 47866 48096 0.32 - . g405.t1 Scaffold_21 AUGUSTUS stop_codon 47866 47868 . - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_21 AUGUSTUS CDS 47866 48096 0.32 - 0 transcript_id "g405.t1"; gene_id "g405"; Scaffold_21 AUGUSTUS start_codon 48094 48096 . - 0 transcript_id "g405.t1"; gene_id "g405"; # protein sequence = [MSTPIPPAPNTSADDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g405 ### # start gene g406 Scaffold_21 AUGUSTUS gene 59648 60079 0.95 + . g406 Scaffold_21 AUGUSTUS transcript 59648 60079 0.95 + . g406.t1 Scaffold_21 AUGUSTUS start_codon 59648 59650 . + 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_21 AUGUSTUS CDS 59648 60079 0.95 + 0 transcript_id "g406.t1"; gene_id "g406"; Scaffold_21 AUGUSTUS stop_codon 60077 60079 . + 0 transcript_id "g406.t1"; gene_id "g406"; # protein sequence = [MLSTTTDPQLREVLKRSNTQTEIAIEAVNTQLKLWKDTVENEVSSTVTCQILGLDIVNLTFKGYIGENVEEDVAVIKE # GVVSLENADELLKKGLWSWSKLPYPIRRVGSSLPYNFEANGGEQGPTKRTKVLENDELVDDVDEW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g406 ### # start gene g407 Scaffold_21 AUGUSTUS gene 61627 62433 0.58 + . g407 Scaffold_21 AUGUSTUS transcript 61627 62433 0.58 + . g407.t1 Scaffold_21 AUGUSTUS start_codon 61627 61629 . + 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_21 AUGUSTUS CDS 61627 62087 0.58 + 0 transcript_id "g407.t1"; gene_id "g407"; Scaffold_21 AUGUSTUS CDS 62154 62433 0.99 + 1 transcript_id "g407.t1"; gene_id "g407"; Scaffold_21 AUGUSTUS stop_codon 62431 62433 . + 0 transcript_id "g407.t1"; gene_id "g407"; # protein sequence = [MFFSYLNSLTCPFSDDRYEWDENFSVKAFIEAIDSFNHREKDAMQSEWDNIAGIGAEKFEFPEVKRVTYSRSFEEIFS # SNNDMAIPIFTTGGFVHFANDLVTKALQESNLDKISNMKQTPIAVIGKDEDQDVVIALWHLDSILNWQMVDRRIDEVREILWAFHRANERLYHPEPEN # RVNNLKTNISKRAIRISEKDENHAFVRWVGREPYQDTTDVNGIFLVERRSRNREDSEDEDAEGEEDEDEQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g407 ### # start gene g408 Scaffold_21 AUGUSTUS gene 65451 66105 0.58 + . g408 Scaffold_21 AUGUSTUS transcript 65451 66105 0.58 + . g408.t1 Scaffold_21 AUGUSTUS start_codon 65451 65453 . + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_21 AUGUSTUS CDS 65451 65908 0.59 + 0 transcript_id "g408.t1"; gene_id "g408"; Scaffold_21 AUGUSTUS CDS 66003 66105 0.68 + 1 transcript_id "g408.t1"; gene_id "g408"; Scaffold_21 AUGUSTUS stop_codon 66103 66105 . + 0 transcript_id "g408.t1"; gene_id "g408"; # protein sequence = [MLRAIRELNPSFVCISETKFHGVKIGNEISTPDREDRRTQLAIVNSEKGTLAKGFLYEEDRDKWEATAELKALEATSK # RTDVAAGTISDWPVPGARRFVILMKNVGGEDLFESNCYKKAAKDPKKLDKLNKQLYAKLHDVVYQFASGKQILHASLSCNIKSIALIDWGYPGIFTVE # RGLSREDFVR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g408 ### # start gene g409 Scaffold_21 AUGUSTUS gene 72050 72683 0.42 - . g409 Scaffold_21 AUGUSTUS transcript 72050 72683 0.42 - . g409.t1 Scaffold_21 AUGUSTUS stop_codon 72050 72052 . - 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_21 AUGUSTUS CDS 72050 72339 0.73 - 2 transcript_id "g409.t1"; gene_id "g409"; Scaffold_21 AUGUSTUS CDS 72482 72683 0.42 - 0 transcript_id "g409.t1"; gene_id "g409"; Scaffold_21 AUGUSTUS start_codon 72681 72683 . - 0 transcript_id "g409.t1"; gene_id "g409"; # protein sequence = [MLACRWRDSKNGFPPSLYLSLTAGEKLNRKYPDSKFRKAEKNICDSDVKINSISQLIQENDIGPTDQAENVNDWGLFD # PNQCVTVDETHKLRIIDMTKFFQAGREHELEKYRFSDVFNQISSQISSYKGDTPLPMIGMPVQAINLPAPKTKVFETELYLKKKD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g409 ### # start gene g410 Scaffold_21 AUGUSTUS gene 85442 85783 0.68 - . g410 Scaffold_21 AUGUSTUS transcript 85442 85783 0.68 - . g410.t1 Scaffold_21 AUGUSTUS stop_codon 85442 85444 . - 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_21 AUGUSTUS CDS 85442 85783 0.68 - 0 transcript_id "g410.t1"; gene_id "g410"; Scaffold_21 AUGUSTUS start_codon 85781 85783 . - 0 transcript_id "g410.t1"; gene_id "g410"; # protein sequence = [MAGADYVWYIWVVVSCYLFDFPDVNIIHATNLDMVVASGCFIAIGLAYLPKQFNQENKNNLKQETYGEFFEATAFNDH # KRGEERAMGSPSFEMAEEHHAMMVEEAKPTELYND] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g410 ### # start gene g411 Scaffold_21 AUGUSTUS gene 95078 97440 0.76 - . g411 Scaffold_21 AUGUSTUS transcript 95078 97440 0.76 - . g411.t1 Scaffold_21 AUGUSTUS stop_codon 95078 95080 . - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_21 AUGUSTUS CDS 95078 97161 0.9 - 2 transcript_id "g411.t1"; gene_id "g411"; Scaffold_21 AUGUSTUS CDS 97296 97440 0.86 - 0 transcript_id "g411.t1"; gene_id "g411"; Scaffold_21 AUGUSTUS start_codon 97438 97440 . - 0 transcript_id "g411.t1"; gene_id "g411"; # protein sequence = [MDRKWRCATFDRALARYRLKWFISGPEQVEEFYQTVGEDEYSKDAVKFEQFLVGLKQKNVDWYWDTEDHPILNGIDAW # SLRALASSVSPSASELPSTYSQTPPGSKPVEPVTVATTVVESVPTGNTPSSARSLAYITSDFKLTNSIVSSSSSSPFSSQEHKNVSNSNFVPVPNSNG # PVGNSRPSHSTNKQIPSRQPTSSAPVKTNSSQKITSRKRPGSPLEKEMKTASKRVTSKDKTPSSTSTLANGKRAKGALGEKLSHCGSHSINGESGNND # SASSCPPDSIKTSIPSTTPNKSNNMTVDEPSPRVIIPRISGHQGSHQNGTTNGGVDITSENAVPVPPPSSPACSSSQNVFLPPTPMTASSSSSLSYPL # PGPSGYPFVPYSSLLTHSSASPPIPVLISIPTQIPLASDDPPPPDTTLPSKAPPASENLSSSTVIQIIDSIFSSFADSLSRFSDEIKQAKAEGVAEIR # EHLTSTILGDGNKSESALVRDPDLEDAVRNIVQANVRDIVGNAVENVVQKNLQDMVTNEIQTVLQQEPSPAFLNTLTKDIQTMKDDILAATQIEVRDG # VRILVATIRTEVVGSSNDVRIKGETVSRNGRQKRRAPAAQRDHTMNRRPVDMMDVDKDAYKVVSLHRIEHPLQHLLGEPAENKEDGLTEGLSNPDEYD # EDHEEAGLNADPHIREDMDDLYGGGGDSGQGVGGRVFSRTSLNRHDNKNGNECGNESPARVADDGLPFKSRRKFGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g411 ### # start gene g412 Scaffold_21 AUGUSTUS gene 105178 106152 0.53 - . g412 Scaffold_21 AUGUSTUS transcript 105178 106152 0.53 - . g412.t1 Scaffold_21 AUGUSTUS stop_codon 105178 105180 . - 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_21 AUGUSTUS CDS 105178 106152 0.53 - 0 transcript_id "g412.t1"; gene_id "g412"; Scaffold_21 AUGUSTUS start_codon 106150 106152 . - 0 transcript_id "g412.t1"; gene_id "g412"; # protein sequence = [MSLWQSWSEWGRLAVAAALSIPVQGVIPTTNHVESFNAILEWKYLHQYLHSGHRLCFDILIFLLLTEILPQVYSRRQM # QRQHYLWLDSRFREGAGGQNLGELQQKFIAKKQEHSRALISVCWWAVDESRNIQAQHILQSYWLQTPSFGSNHDMFVTTCASMSGSTSYQLTISRFGN # ASCSCPNFYSQGGACKHLRAFRYVINAWTEKPFHYPQTLASAQEIACQTMSSKTSNLMAVVPKSQLSPEPIDWAVIQALGGDSTILGNGLDEQGDTDS # EAIVESPATSLDSDEDPLMDLNLFQHSAIGIQISQRIHQEVTTLLPRLYG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g412 ### # start gene g413 Scaffold_21 AUGUSTUS gene 112184 114659 0.28 + . g413 Scaffold_21 AUGUSTUS transcript 112184 114659 0.28 + . g413.t1 Scaffold_21 AUGUSTUS start_codon 112184 112186 . + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_21 AUGUSTUS CDS 112184 112444 0.34 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_21 AUGUSTUS CDS 112529 112822 0.76 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_21 AUGUSTUS CDS 112906 113240 0.73 + 0 transcript_id "g413.t1"; gene_id "g413"; Scaffold_21 AUGUSTUS CDS 114014 114659 0.69 + 1 transcript_id "g413.t1"; gene_id "g413"; Scaffold_21 AUGUSTUS stop_codon 114657 114659 . + 0 transcript_id "g413.t1"; gene_id "g413"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDHTEGELHPF # LSQWVSQRMDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWK # REETRKREAPSGSSAPFTPKPKPFSGGKPNTMVSPRTLRIPANPAVSAPRSTILADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAA # EVEETPEATVGLKRNRKTSPQLLACKDAGMEPFLLRAIHSEVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGA # SPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYH # LVRIAEGVTNGNHLSDPLRLLRMEGHAVRPYERPCGFPAVC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g413 ### # start gene g414 Scaffold_21 AUGUSTUS gene 118067 118534 0.91 - . g414 Scaffold_21 AUGUSTUS transcript 118067 118534 0.91 - . g414.t1 Scaffold_21 AUGUSTUS stop_codon 118067 118069 . - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_21 AUGUSTUS CDS 118067 118534 0.91 - 0 transcript_id "g414.t1"; gene_id "g414"; Scaffold_21 AUGUSTUS start_codon 118532 118534 . - 0 transcript_id "g414.t1"; gene_id "g414"; # protein sequence = [MSTSRTTTTTTTKSSTAGPSRSQPTLPPPINLTAPDEPREGDDDDMEEDDDEAIRQAEERVRRMKARKAAAAAKKKAE # EEVARKATEEAQRKKEVAARELEERQRRMAEAATARSRCGSSPGGSSVSPQRPVVEIRKDKGKGKGKAQVSNDTLRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g414 ### # start gene g415 Scaffold_21 AUGUSTUS gene 119979 123695 0.93 - . g415 Scaffold_21 AUGUSTUS transcript 119979 123695 0.93 - . g415.t1 Scaffold_21 AUGUSTUS stop_codon 119979 119981 . - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_21 AUGUSTUS CDS 119979 123695 0.93 - 0 transcript_id "g415.t1"; gene_id "g415"; Scaffold_21 AUGUSTUS start_codon 123693 123695 . - 0 transcript_id "g415.t1"; gene_id "g415"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWT # DTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEGLPQPF # DIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRKASERE # AQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCEVCARK # KIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAAKLMRS # LLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVDDRIRI # LREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWK # GNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVWAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g415 ### # start gene g416 Scaffold_21 AUGUSTUS gene 123746 124912 0.86 - . g416 Scaffold_21 AUGUSTUS transcript 123746 124912 0.86 - . g416.t1 Scaffold_21 AUGUSTUS stop_codon 123746 123748 . - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_21 AUGUSTUS CDS 123746 124912 0.86 - 0 transcript_id "g416.t1"; gene_id "g416"; Scaffold_21 AUGUSTUS start_codon 124910 124912 . - 0 transcript_id "g416.t1"; gene_id "g416"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g416 ### # start gene g417 Scaffold_21 AUGUSTUS gene 131334 131642 0.64 + . g417 Scaffold_21 AUGUSTUS transcript 131334 131642 0.64 + . g417.t1 Scaffold_21 AUGUSTUS start_codon 131334 131336 . + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_21 AUGUSTUS CDS 131334 131642 0.64 + 0 transcript_id "g417.t1"; gene_id "g417"; Scaffold_21 AUGUSTUS stop_codon 131640 131642 . + 0 transcript_id "g417.t1"; gene_id "g417"; # protein sequence = [MAESLPGLELAPEAPYKSPLRREREPADVWTSNPKPAATGGSKTGPTGKRDDKGHLQLGGKEKVTIARIERRTKTAVT # AGMEENGLKRSSEQELPIPGEMDS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g417 ### # start gene g418 Scaffold_21 AUGUSTUS gene 132207 132676 0.53 + . g418 Scaffold_21 AUGUSTUS transcript 132207 132676 0.53 + . g418.t1 Scaffold_21 AUGUSTUS start_codon 132207 132209 . + 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_21 AUGUSTUS CDS 132207 132227 0.89 + 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_21 AUGUSTUS CDS 132314 132676 0.53 + 0 transcript_id "g418.t1"; gene_id "g418"; Scaffold_21 AUGUSTUS stop_codon 132674 132676 . + 0 transcript_id "g418.t1"; gene_id "g418"; # protein sequence = [MRHPENLISSADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKELCLTFQDRNVRISAALASEIVQPGAEGGT # EELAKGGNGEEIHEGTLQPPPEAPQPPPEVPQQSLELPSSSKDRGELEK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g418 ### # start gene g419 Scaffold_21 AUGUSTUS gene 140168 141592 0.98 - . g419 Scaffold_21 AUGUSTUS transcript 140168 141592 0.98 - . g419.t1 Scaffold_21 AUGUSTUS stop_codon 140168 140170 . - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_21 AUGUSTUS CDS 140168 141592 0.98 - 0 transcript_id "g419.t1"; gene_id "g419"; Scaffold_21 AUGUSTUS start_codon 141590 141592 . - 0 transcript_id "g419.t1"; gene_id "g419"; # protein sequence = [MEPILLRAIHSEVAARAADCSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRTYDLKIDLEEGASLPLGRIYP # LSEKELVALKDFIDKQLATGAITPSSSPHGAPVLFVLKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDE # WKTTFRTRYGSYEWKVMLFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPEKCEFNMDTVEYLGYIL # SPNGLTMSKEKVQTVLEWPVPRKVKDIQSFLRFANFYHRFIYNYSDIVVPMTRLTRKGAPWIWDSSCQEAFENLKIAFTSVPILAHWEPNRPLIVETD # ASDYAIAAILSIQYADGEIHPLAFLSRTLHAAELNYDTHDKELLAIFEAFKAWRHYLEGSGDPVDVVTDHKNLEYFSTTKVLTRRQVRWSEFLHQFNM # VIRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g419 ### # start gene g420 Scaffold_21 AUGUSTUS gene 142404 142922 1 - . g420 Scaffold_21 AUGUSTUS transcript 142404 142922 1 - . g420.t1 Scaffold_21 AUGUSTUS stop_codon 142404 142406 . - 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_21 AUGUSTUS CDS 142404 142922 1 - 0 transcript_id "g420.t1"; gene_id "g420"; Scaffold_21 AUGUSTUS start_codon 142920 142922 . - 0 transcript_id "g420.t1"; gene_id "g420"; # protein sequence = [MARLPEPATLADYRQEVLRIDNCYWKREETRKREAGKPFVARNPEKGSSDFKTGSTNQQNNSQPSGSLAPFTPKPEPF # SGGKPNNNGKPQNSSNSGQPGGQRPVFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARELKGRAAKVEGTPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g420 ### # start gene g421 Scaffold_21 AUGUSTUS gene 142967 143912 0.17 - . g421 Scaffold_21 AUGUSTUS transcript 142967 143912 0.17 - . g421.t1 Scaffold_21 AUGUSTUS stop_codon 142967 142969 . - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_21 AUGUSTUS CDS 142967 143212 0.6 - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_21 AUGUSTUS CDS 143453 143715 0.37 - 2 transcript_id "g421.t1"; gene_id "g421"; Scaffold_21 AUGUSTUS CDS 143798 143912 0.4 - 0 transcript_id "g421.t1"; gene_id "g421"; Scaffold_21 AUGUSTUS start_codon 143910 143912 . - 0 transcript_id "g421.t1"; gene_id "g421"; # protein sequence = [MEEDQQFEYSTLYTGDRQPVQVLTPRRGQPPWSLRLGAESPHDPPPHFDLDTGDHDDQDPPVDPDDPGADNNHDDLDD # NSGGLPRGEPGDPSGPGGPGGPGSPGGPGGPGGPRSQSLLTSQRATCYWVSQEWFVPDILDLDLDSLPAWTSSFKALVKELQDNFGVYDAQGEVEDSL # GNLKMKETENIRKYTSGSTPWLLVPTGILLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g421 ### # start gene g422 Scaffold_21 AUGUSTUS gene 149188 150862 0.24 - . g422 Scaffold_21 AUGUSTUS transcript 149188 150862 0.24 - . g422.t1 Scaffold_21 AUGUSTUS stop_codon 149188 149190 . - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_21 AUGUSTUS CDS 149188 149886 0.98 - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_21 AUGUSTUS CDS 149967 149988 0.29 - 1 transcript_id "g422.t1"; gene_id "g422"; Scaffold_21 AUGUSTUS CDS 150078 150429 0.28 - 2 transcript_id "g422.t1"; gene_id "g422"; Scaffold_21 AUGUSTUS CDS 150571 150862 0.91 - 0 transcript_id "g422.t1"; gene_id "g422"; Scaffold_21 AUGUSTUS start_codon 150860 150862 . - 0 transcript_id "g422.t1"; gene_id "g422"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGHPPVDPDDPGADNNDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGFKGSI # ETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTGSAKEWFDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAY # GRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDLRLVLLTSKTTLSHLALRRRSRRSLNPSLVSNNGKPQ # NSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRAAEVEETPEATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g422 ### # start gene g423 Scaffold_21 AUGUSTUS gene 155850 156128 0.84 - . g423 Scaffold_21 AUGUSTUS transcript 155850 156128 0.84 - . g423.t1 Scaffold_21 AUGUSTUS stop_codon 155850 155852 . - 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_21 AUGUSTUS CDS 155850 156128 0.84 - 0 transcript_id "g423.t1"; gene_id "g423"; Scaffold_21 AUGUSTUS start_codon 156126 156128 . - 0 transcript_id "g423.t1"; gene_id "g423"; # protein sequence = [MNSLDQKIKKNQLTSEDPGHDDMCSVSRRFIGGDVSKDEPVEFGVPTDLRVYASHRKEDDPRKDPNGKKDDNHHPQVP # HEKYASSPLASLIS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g423 ### # start gene g424 Scaffold_21 AUGUSTUS gene 156582 157247 0.58 + . g424 Scaffold_21 AUGUSTUS transcript 156582 157247 0.58 + . g424.t1 Scaffold_21 AUGUSTUS start_codon 156582 156584 . + 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_21 AUGUSTUS CDS 156582 157247 0.58 + 0 transcript_id "g424.t1"; gene_id "g424"; Scaffold_21 AUGUSTUS stop_codon 157245 157247 . + 0 transcript_id "g424.t1"; gene_id "g424"; # protein sequence = [MLMPWRLDPEAQPSAVVPEDERPTHKLGFLGLFGEKVDSIEWARSEIRVCNELLEAGRAKIPGYNAQTSRLSFHPDFD # DDGDDDFGGQGGIIGTVGKVGNVVKRKNKKTEREPQEARAEEQSVDAAAAIDDPYPVSNSAFITFRKQISAHLAGQSLIHHEPYRMSSRYIEVAPSDV # IWSNLSLNPFEIKIRIAISWAITIALIVFWALPGLHSFSPLSIFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g424 ### # start gene g425 Scaffold_21 AUGUSTUS gene 158442 158816 0.65 + . g425 Scaffold_21 AUGUSTUS transcript 158442 158816 0.65 + . g425.t1 Scaffold_21 AUGUSTUS start_codon 158442 158444 . + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_21 AUGUSTUS CDS 158442 158816 0.65 + 0 transcript_id "g425.t1"; gene_id "g425"; Scaffold_21 AUGUSTUS stop_codon 158814 158816 . + 0 transcript_id "g425.t1"; gene_id "g425"; # protein sequence = [MSEKMYHEEDVTPAVQDESSASAKDQGYPMDRVESKGVRGASVDDDRLKLQASDNDRQSNGEDSTKPTPDRVAPRAEE # SYGFSHPAASRPQRTVWIPKIVWVWPKRRRLRVATRVLILAPKMLR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g425 ### # start gene g426 Scaffold_21 AUGUSTUS gene 159901 160374 0.35 - . g426 Scaffold_21 AUGUSTUS transcript 159901 160374 0.35 - . g426.t1 Scaffold_21 AUGUSTUS stop_codon 159901 159903 . - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_21 AUGUSTUS CDS 159901 160374 0.35 - 0 transcript_id "g426.t1"; gene_id "g426"; Scaffold_21 AUGUSTUS start_codon 160372 160374 . - 0 transcript_id "g426.t1"; gene_id "g426"; # protein sequence = [MWFRRHFLGVHILNLSRRSNDDAHLSTDAGVLDRPLNFTGRLSLDGWHGIVEGGRPEGGSHRMTHGRQSSLYRSQTST # LFNAFEGEEDTSRHEHVGLHQLREEDESDDDDANELTRLRSVPERQVDPRRSASRSHSNSPQPPNHRSLADVRPSPRQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g426 ### # start gene g427 Scaffold_21 AUGUSTUS gene 166471 167379 0.49 - . g427 Scaffold_21 AUGUSTUS transcript 166471 167379 0.49 - . g427.t1 Scaffold_21 AUGUSTUS stop_codon 166471 166473 . - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_21 AUGUSTUS CDS 166471 166969 0.52 - 1 transcript_id "g427.t1"; gene_id "g427"; Scaffold_21 AUGUSTUS CDS 167024 167379 0.56 - 0 transcript_id "g427.t1"; gene_id "g427"; Scaffold_21 AUGUSTUS start_codon 167377 167379 . - 0 transcript_id "g427.t1"; gene_id "g427"; # protein sequence = [MLVAVLNTCTKEELEESDEEEEVVSPMTSAVPAPEESDQRRKVIKNKIMAVGRVARVFALLRYVMPVDVLQTLIDHHH # REDAEKVSELKSISGSSKLPYGTLASGSEGIKNAIKGFEDARKSDIENERLPPDLYDAESEEGKAIIASGSLPSTPAEGQEAPTPITANGVAASLAAA # ISSGAIPSSPSPASPSSASPVSPTSPISGGGAFRRGHGRQASLGTTTMTSPSTRRRSLESTMSLIQGVLDGKDGTIPENDETVEGLAAQLAGSSVNNG # ATAAGFKSNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g427 ### # start gene g428 Scaffold_21 AUGUSTUS gene 181446 182234 0.87 - . g428 Scaffold_21 AUGUSTUS transcript 181446 182234 0.87 - . g428.t1 Scaffold_21 AUGUSTUS stop_codon 181446 181448 . - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_21 AUGUSTUS CDS 181446 182234 0.87 - 0 transcript_id "g428.t1"; gene_id "g428"; Scaffold_21 AUGUSTUS start_codon 182232 182234 . - 0 transcript_id "g428.t1"; gene_id "g428"; # protein sequence = [MVLYFSKPPVLTRLFAFLLLTSYTSWPAGALNPSCAPGGNFDLSPWELQLPIGSTGSPETISSASLQGCSGWENFDYF # FTESGDGALVMKVPGSPASAGCVTTPNSLHCRTELREVDPSTGAAASWSPNAATNRLIVELVVTVADNSARGTVIGQIHIDDSISSKPVCELYYNSNG # DISIGVEQTRSGGDEVFTSLGNIPIGTVFTYELEYYTGLLKVAINGNFQTLDTYELDAPNSYFKVGNYNQGSSASDVHVFSIYLEH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g428 ### # start gene g429 Scaffold_21 AUGUSTUS gene 184078 185002 0.37 - . g429 Scaffold_21 AUGUSTUS transcript 184078 185002 0.37 - . g429.t1 Scaffold_21 AUGUSTUS stop_codon 184078 184080 . - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_21 AUGUSTUS CDS 184078 184605 0.86 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_21 AUGUSTUS CDS 184682 185002 0.4 - 0 transcript_id "g429.t1"; gene_id "g429"; Scaffold_21 AUGUSTUS start_codon 185000 185002 . - 0 transcript_id "g429.t1"; gene_id "g429"; # protein sequence = [MASAQNLSSLKTPMAMVCVNFYETTFKVLSLAPQEHTATMDRFSGSGRTDSTIDDSPFGSTLNTPADEDVREPFEAIG # QRLKELQAHRAVNNLEKQYKQMDNLGTCEQDSADIDVDSERHDLASISPSQDYPQEEIIQSRVQDEHNPITGSLSMVNISRVAAEENFDESFINRSDI # SMISDKLLSSFPTVPFSSPEIPNDNAMASSPVPFSNELSRSLYNIQTQSVRSSPEMTVSSPSIQNSNSPANSLMFFSPDLDQGFSAHSRASVSPLDSR # IVSLTSRT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g429 ### # start gene g430 Scaffold_21 AUGUSTUS gene 186537 188945 0.37 + . g430 Scaffold_21 AUGUSTUS transcript 186537 188945 0.37 + . g430.t1 Scaffold_21 AUGUSTUS start_codon 186537 186539 . + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_21 AUGUSTUS CDS 186537 187169 0.63 + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_21 AUGUSTUS CDS 187342 187906 0.6 + 0 transcript_id "g430.t1"; gene_id "g430"; Scaffold_21 AUGUSTUS CDS 188614 188945 0.9 + 2 transcript_id "g430.t1"; gene_id "g430"; Scaffold_21 AUGUSTUS stop_codon 188943 188945 . + 0 transcript_id "g430.t1"; gene_id "g430"; # protein sequence = [MDDEVLDWDDGEDQAPAVSGPIDDADGVSLGSDSGDENENAAPFVEEGSAPSRITSPLTKEANTASRPASPNSLTSLQ # RKDSYSSSRTTKPMHAVLVDSPKNQHRSQRSKSKPLSSAQMMLHGLPPKPVTSAVSFLPSSQSSLTEATAMVARETAKGKSGGGSNKNTVAKPVYKDE # IDSLPPNWEIRHPRSGGKQVYYYNNRTHESTWIHPSTVQSSRGPPSDSAYLSQDSPSLEDRYYRPADRRNDSPGDLNERSDRHAPPGPATSHRRSPSR # DPSPFAIRRPRSISPERGRVSGRRGRPVQPTSAKESHIANRDRDTIQNVSSDRRWSPPSPQDFEGSKSRPRQRQRMQEHPNEAQSNDSRSQDEQPTYR # TSAPNRWGAREDSVQDLHEPTNHNTIHTQEQVQAPPPLAARSQPPPTLDRDLPPHQRLSKPGPPTNDDSIASSARYRHQSPPARYQERNIVSDSTGFT # KPTDDHLHSPRVDSAASADNITRQGSTVYLDRGQGEMIC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g430 ### # start gene g431 Scaffold_21 AUGUSTUS gene 199757 200305 0.39 + . g431 Scaffold_21 AUGUSTUS transcript 199757 200305 0.39 + . g431.t1 Scaffold_21 AUGUSTUS start_codon 199757 199759 . + 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_21 AUGUSTUS CDS 199757 200305 0.39 + 0 transcript_id "g431.t1"; gene_id "g431"; Scaffold_21 AUGUSTUS stop_codon 200303 200305 . + 0 transcript_id "g431.t1"; gene_id "g431"; # protein sequence = [MHQLLANDNTTRLLVCAPNNSAADLLTQKLSTLGPSVVLRLNSLSRKLSELPKSLHRFAIINDNEVFAMPTAQDIRKY # RVVVSTCITAGVPASLGIERGYYSHIFVDEAGQAMEPTVMVPLKELADDKTNVVLAGDNKQLGPIVHSGLASVLGLKTSYLARIMDREIYDLDGKSSV # GGRGVT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g431 ### # start gene g432 Scaffold_21 AUGUSTUS gene 202054 203796 0.95 - . g432 Scaffold_21 AUGUSTUS transcript 202054 203796 0.95 - . g432.t1 Scaffold_21 AUGUSTUS stop_codon 202054 202056 . - 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_21 AUGUSTUS CDS 202054 203796 0.95 - 0 transcript_id "g432.t1"; gene_id "g432"; Scaffold_21 AUGUSTUS start_codon 203794 203796 . - 0 transcript_id "g432.t1"; gene_id "g432"; # protein sequence = [MSCHIDNIPTGRIPASVLKKPTVVGLYGVSGCGKSFLLKELKEELGEQEFDYHEGAAVISRLVPGGLSAFQKMEYREK # TVWRERAIDQIQEDCTISGRVALVAGHFMFWDEHDKTPQLGWTEHDQTTFTHILYLHVPPDVIAQRRMNDSNRARSSISDEHLRKWQQAECDQLRLVC # LEHKILFSIVPPSRHKIAKLLRNFQRNTEEYNLSCARDRLDEVVREVAGPGKLKTMLVMDGDRTLIAEDTGALFWRLFNKTVKDATENTGGGKNPLKE # LFSGPFGYSYAAFVQAALLYEEVDEKQFDDFCEEVASAVTVHPEFVSLLVQAAECKVGAVIITCGLGLIWEKILKKTGLSETVKVIGGGRIRDHLIIT # GEVKAALVARLRTAHGMYVCAFGDSVLDLPMLKGASQAIVVVGEERHRSHRMDDALLKAIDDEGLQACQVLLPKTASARLDVVKLPLVSITEGRFLDS # LVSRLPCRIHILHATNKNPAKLLMSGMRDARVAGPALREVHRRVGWYLTTEFVSELIGLEEYPIPHVQGPQTQANGHRLRDENRILIVALMRGGEPMA # LGVSEALPLAPL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g432 ### # start gene g433 Scaffold_21 AUGUSTUS gene 205685 207340 0.51 - . g433 Scaffold_21 AUGUSTUS transcript 205685 207340 0.51 - . g433.t1 Scaffold_21 AUGUSTUS stop_codon 205685 205687 . - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_21 AUGUSTUS CDS 205685 206185 0.88 - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_21 AUGUSTUS CDS 206618 207340 0.57 - 0 transcript_id "g433.t1"; gene_id "g433"; Scaffold_21 AUGUSTUS start_codon 207338 207340 . - 0 transcript_id "g433.t1"; gene_id "g433"; # protein sequence = [MDNTRVSGISGFVRHWVLLFVDKTFPQWTWRSKWKGLGAVAHPKGMHLNLEALEGLALESAAMEAGVPLSELLPPGFA # RRWADRHPSTSGEEDTCSTRVSSASSALPPPPTSVARENSNFGPPPSRLETWMTRLQNAQKNYTQGTDDIPLTHARLGRMVAMLGGFALAVNRPGTLK # CSAPRSSAKPMKAANYPSNASPSINETRSLSQQYDAYRIVMEREEVKAFYARLIVVWTLFLVFWLIQNEGKAKALAKSQRKSNALSSAAALSPLPPLP # SISTHISKTPSEEVNADSSPRPQPHAKSDTQLHNKGGGFANTVRHVDKKLEELPRSILAHARLFSEHLQYFVGPGSVGANGGPSSGQEIPPSLKKLMD # DIAGASKFGERIQTEILQDAEARQTLFTLSIESES] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g433 ### # start gene g434 Scaffold_21 AUGUSTUS gene 208076 208759 0.78 - . g434 Scaffold_21 AUGUSTUS transcript 208076 208759 0.78 - . g434.t1 Scaffold_21 AUGUSTUS stop_codon 208076 208078 . - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_21 AUGUSTUS CDS 208076 208759 0.78 - 0 transcript_id "g434.t1"; gene_id "g434"; Scaffold_21 AUGUSTUS start_codon 208757 208759 . - 0 transcript_id "g434.t1"; gene_id "g434"; # protein sequence = [MIKCLPTIRCPLSWKSYTLSRDVEKGPGNNGDYQNEVIGQGSSQDEPVLDDDEVEFEEDDEHEPISAISAVTDYSLQH # RGSLSGLSLFSTASIDLRYRSRSGPPQWWIKLKAFLYPPDPQKDPSGSSFIPNYRYTPIFSAVIIPFSILLEIPGLTGNWYIKTIDNQTVEKRSNPVL # LDVALGISMGCALVANVALIVRFLEKNVKLMTIVCVVFLTLHGESNLFILT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g434 ### # start gene g435 Scaffold_21 AUGUSTUS gene 211594 212432 0.54 - . g435 Scaffold_21 AUGUSTUS transcript 211594 212432 0.54 - . g435.t1 Scaffold_21 AUGUSTUS stop_codon 211594 211596 . - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_21 AUGUSTUS CDS 211594 212024 1 - 2 transcript_id "g435.t1"; gene_id "g435"; Scaffold_21 AUGUSTUS CDS 212081 212432 0.54 - 0 transcript_id "g435.t1"; gene_id "g435"; Scaffold_21 AUGUSTUS start_codon 212430 212432 . - 0 transcript_id "g435.t1"; gene_id "g435"; # protein sequence = [MGFSKKSLDFMNDRTRDTPSDDENTRVISVSDDSDSELSSATRGFEPTQVQLGRRKYLLNTAGIEDEDSETEDEGEEE # IEEQESDDNEPLSGRTTITASPLKIRISRKDKTEVVEKQTFIFSVPVDDANEEFRLTTPFHGLISSMPLPTLGIAPRQVRVAYRFSTTPQSDRSFNHV # RNEAQLRELIKDAEVAQKAYAKSRVKTKKKFVVMLKRTGEQSEKPGKDKDGKGKVKTSKKVCTELSLSMDGDFQSLAFTAQTFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g435 ### # start gene g436 Scaffold_21 AUGUSTUS gene 214368 215406 0.63 + . g436 Scaffold_21 AUGUSTUS transcript 214368 215406 0.63 + . g436.t1 Scaffold_21 AUGUSTUS start_codon 214368 214370 . + 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_21 AUGUSTUS CDS 214368 214921 0.72 + 0 transcript_id "g436.t1"; gene_id "g436"; Scaffold_21 AUGUSTUS CDS 215025 215406 0.88 + 1 transcript_id "g436.t1"; gene_id "g436"; Scaffold_21 AUGUSTUS stop_codon 215404 215406 . + 0 transcript_id "g436.t1"; gene_id "g436"; # protein sequence = [MTKPSDTECHSPDSMSLPILINSRTYSCTGSKLLPPKVEIQGEKMLNHEDVNLVKGTTRVDVQTLPSPADTNTSVQNA # TGMTTLAKIAQTERWSKRPRYARAFMWDSVENPTEKMSLAESSVYMTPLPRPPANVVLDEIALDTIRKNPHLFNITTPINVDRFRALLDSHPNQVFVE # SVCTGFRQGEIKRLRRDVSHLLSARYSRACNVSQWLWSETAFNKFRLAVDHSAEPFALNSLIDRRDVKVKLDDLHDLGALIRVRRVYGRSVNLVVFKS # DVSAAYRRLPMDPRWQLKQVVGFGDGYNIDQCNNFGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g436 ### # start gene g437 Scaffold_21 AUGUSTUS gene 215964 216458 0.44 + . g437 Scaffold_21 AUGUSTUS transcript 215964 216458 0.44 + . g437.t1 Scaffold_21 AUGUSTUS start_codon 215964 215966 . + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_21 AUGUSTUS CDS 215964 216458 0.44 + 0 transcript_id "g437.t1"; gene_id "g437"; Scaffold_21 AUGUSTUS stop_codon 216456 216458 . + 0 transcript_id "g437.t1"; gene_id "g437"; # protein sequence = [MLDSEEWGLEEAELVIYCDACPTGMGYWFCHDSRLLGYQCAVPRPDDSEKPIFYYEALTVVSSILHAIKLSTVRRVFV # FTDNTNTVDMFHALKAKQLYNPLLLTAIDHSICSNLQFRVAHIPGDENDIADALSRFDYARILQLVPSMEIYNFTPPQLVLGAELL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g437 ### # start gene g438 Scaffold_21 AUGUSTUS gene 219054 220193 0.87 + . g438 Scaffold_21 AUGUSTUS transcript 219054 220193 0.87 + . g438.t1 Scaffold_21 AUGUSTUS start_codon 219054 219056 . + 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_21 AUGUSTUS CDS 219054 220193 0.87 + 0 transcript_id "g438.t1"; gene_id "g438"; Scaffold_21 AUGUSTUS stop_codon 220191 220193 . + 0 transcript_id "g438.t1"; gene_id "g438"; # protein sequence = [MAAPSGITYKAKRSNREVLRERLENNSALREHFESSRDVHHYKKLTRPTIHNHENIKGHYRDFAAYTQECFEEGRSKK # LPQPSEIVIGTPLPPLGPSTSDCMLSSHSCFTEYVKDFVCYLASALLGRDASTFIRLETLRGYMYTFLALWPRYANVHPTSEMRYQMRSYLLSEELQA # SVKLSTKIRTLKHIEPQCLQIIMETLHSATNIFRSNRTRLQMAFLILFSAASAARPGSVVESACYRGSNEALTWGDIDFYLIPDDEDPAHPSLVIDIQ # LNLVKGYRDVDHRYQKLLFTLELRKEHRMTCIVLPLLGLAFHDSVFAHFHSIESLLCPEKPPTTRVKIFLRNEVLTLPVLRKEEKGGGGKISKTEAFP # MMDYFIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g438 ### # start gene g439 Scaffold_21 AUGUSTUS gene 227042 229264 0.63 - . g439 Scaffold_21 AUGUSTUS transcript 227042 229264 0.63 - . g439.t1 Scaffold_21 AUGUSTUS stop_codon 227042 227044 . - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_21 AUGUSTUS CDS 227042 229264 0.63 - 0 transcript_id "g439.t1"; gene_id "g439"; Scaffold_21 AUGUSTUS start_codon 229262 229264 . - 0 transcript_id "g439.t1"; gene_id "g439"; # protein sequence = [MTGTHLPINQYAVHHIHARIMSNVVIGPGGQATLVAPTQPESSNAIVSSMSVINIASATQQAVFTSPSTATSDISLTS # IISSSSATPTTSGLVEVSTTVVVTSEVVETSTTSSSSPTTSNASSDSESATPTTFVDLSTTPLATIPPTTSVDSTTASLASTSTSDASTNLLSTVSSS # SSTTASPSSLAAATTSSATNTSATKESTLYIGIVLGTIIVIACFAALIAWWFRLRTHNRRRKKSVAVPWANRPESSLSSFTDSDLLEKGELPDPHRHT # WEPRGDRDAGEPKRTKSYLEDIGSPVKRQSLPILSLPSPPPAIYPFRDHPLPQYPTSCSSLFPSVSLSSVEPLQESVAYPLPNSSGSRFTMNIHPNPS # SVHMQFLTDPEFGTPRESKIKPRYLSLNQGLEVPWNTEAPALALATYPLPVPSENVPSSPASLSEKHPQTQEITPFADVPASVSSSQAGTWSSTFKAN # LVFAFNAVAKAAGGIRSDEEYDKLSPLPSRNASRNCKNIIRRDKSTSAPVPETVWVEYLGGELVGKAPVLITSTTSEASQADEGIGTVHVRTSFSRDG # LLPFPGTVDSALTTLGPAFGTGMGLESYRGNDNAFSSLPSTQRSMTPSRQISNTSYTSTAALVVKKKSRSTGTTRSSANAHSRISGSQRRPRYAYSGE # MTAVSRRGSLASSRAPELPALPSFSHSRSRSMASSLSRISTTRSMKSTRSILTNREERARKALIERQRKGNAMC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g439 ### # start gene g440 Scaffold_21 AUGUSTUS gene 234580 235632 0.51 - . g440 Scaffold_21 AUGUSTUS transcript 234580 235632 0.51 - . g440.t1 Scaffold_21 AUGUSTUS stop_codon 234580 234582 . - 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_21 AUGUSTUS CDS 234580 235632 0.51 - 0 transcript_id "g440.t1"; gene_id "g440"; Scaffold_21 AUGUSTUS start_codon 235630 235632 . - 0 transcript_id "g440.t1"; gene_id "g440"; # protein sequence = [MFTDGRYFLQASQQMDRNWELMKQGLPGVPTWQDYLTNNLPASSRIGIDPTLIAENDSKSLSGSRKQAESKGSQTLVP # LTTNLVDLIWGSDRPPRPKNAVVPLDEKYSGESVTSKLNRLASAVSSNTPAPLAFVLTALDDIAWLFNLRGSDIAYNPVFFSYAVVHFEPSEADGSKN # PTAVLFLQRDAVEHDADLKYALGSQVEIRPYEDIWEYLKDLGNQVRSTFADKGQEKLVLIPDKASLAIVQAVGVVRVFDLLVLSTYQHICRSFLKDIS # NIVPSPITVLKAIKNSTELEGFRQSHIRDGIALARYFSWLEEKLGEEGNELTEWEGAEQLEKFRRCGCSCLVACTN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g440 ### # start gene g441 Scaffold_21 AUGUSTUS gene 236522 237203 0.72 + . g441 Scaffold_21 AUGUSTUS transcript 236522 237203 0.72 + . g441.t1 Scaffold_21 AUGUSTUS start_codon 236522 236524 . + 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_21 AUGUSTUS CDS 236522 236572 0.72 + 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_21 AUGUSTUS CDS 236659 236807 0.98 + 0 transcript_id "g441.t1"; gene_id "g441"; Scaffold_21 AUGUSTUS CDS 236861 237203 0.98 + 1 transcript_id "g441.t1"; gene_id "g441"; Scaffold_21 AUGUSTUS stop_codon 237201 237203 . + 0 transcript_id "g441.t1"; gene_id "g441"; # protein sequence = [MNYSATFRELGPPDLCHLGSYHYISGVDASSSASLAAYINSLTYAIEDNSAWFSKGSSWKVKNGCYCCFNAFSRVDIR # VDVKIPGGVNAYAIDLRGERHEATQELWQETYVSALLRSILYSDDPNYWLDAYRKLDPITSPDSEIRFLQAAEALFMKGSLLSSFNARHLIIETNFRL # ASWF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g441 ### # start gene g442 Scaffold_21 AUGUSTUS gene 237992 238819 0.88 + . g442 Scaffold_21 AUGUSTUS transcript 237992 238819 0.88 + . g442.t1 Scaffold_21 AUGUSTUS start_codon 237992 237994 . + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_21 AUGUSTUS CDS 237992 238819 0.88 + 0 transcript_id "g442.t1"; gene_id "g442"; Scaffold_21 AUGUSTUS stop_codon 238817 238819 . + 0 transcript_id "g442.t1"; gene_id "g442"; # protein sequence = [MEEEYRMQKAHGDISAVANGAGKAIHEDGTVRDSMISSDSATLGDQGIDDDNASTRGMVSPHSPRKSGSLDVSPGAFA # NGSTVSIASSITKVGLGLDPNGGASLTATIPTIRISTESDRDFDEDGNATDASPKGKDVNGDAPKATTNGFDNSRDVSEFGLEKPAQAAAGTEEGGLG # DDKDKESLHESPLPSTQTQSGSESFSFSNKRLCERWLDNLFMVLYEDLRVWTIFRAEVAHFKTQHVAYRKTGLEWEILGDLGMRLHHKEEAKEVSFNR # L] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g442 ### # start gene g443 Scaffold_21 AUGUSTUS gene 242939 243567 0.1 + . g443 Scaffold_21 AUGUSTUS transcript 242939 243567 0.1 + . g443.t1 Scaffold_21 AUGUSTUS start_codon 242939 242941 . + 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_21 AUGUSTUS CDS 242939 243004 0.18 + 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_21 AUGUSTUS CDS 243073 243567 0.59 + 0 transcript_id "g443.t1"; gene_id "g443"; Scaffold_21 AUGUSTUS stop_codon 243565 243567 . + 0 transcript_id "g443.t1"; gene_id "g443"; # protein sequence = [MRFNNSFIVLGLAAVVSAVPVNDPTAQTNSGVGVNAVDASASGSPSLNARDIGVGLRAVDLERREYTVTVTFKQEGGV # NPTEETEKEAQEMVKATLKNAARKLKMGQGSELEVKFTNYWPNSFLGKVEFTFQDPVCGSGGTGTCEGEATAGGKGTIKNGPKKRKDQKVLWTRAVSH # VSCYFQSKRF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g443 ### # start gene g444 Scaffold_21 AUGUSTUS gene 248752 249207 0.58 - . g444 Scaffold_21 AUGUSTUS transcript 248752 249207 0.58 - . g444.t1 Scaffold_21 AUGUSTUS stop_codon 248752 248754 . - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_21 AUGUSTUS CDS 248752 249207 0.58 - 0 transcript_id "g444.t1"; gene_id "g444"; Scaffold_21 AUGUSTUS start_codon 249205 249207 . - 0 transcript_id "g444.t1"; gene_id "g444"; # protein sequence = [MIAKACPEYSLSKPSTLVAISGAGNVSQFTALKVIELGATVVSMSDSKGSLIATTDSGFSKDVIESIGQLKLKGGFLD # SFKQFTDEGKYTYHPGTYSTVYVYAQNSDFLRDFQANAPGLFFPKSILLFPVQLRMKSPPPKQRLWLNPVSEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g444 ### # start gene g445 Scaffold_21 AUGUSTUS gene 256114 256458 0.83 - . g445 Scaffold_21 AUGUSTUS transcript 256114 256458 0.83 - . g445.t1 Scaffold_21 AUGUSTUS stop_codon 256114 256116 . - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_21 AUGUSTUS CDS 256114 256458 0.83 - 0 transcript_id "g445.t1"; gene_id "g445"; Scaffold_21 AUGUSTUS start_codon 256456 256458 . - 0 transcript_id "g445.t1"; gene_id "g445"; # protein sequence = [MNSDSPLSNSAVPSLDQDTTKYTQELISSCLEGLPTFEESRYNTSTSDGPAVKYIQPPNPGWKFGEKVESSDLGRKWM # EGSKLEDDWEHFDADKEDNRYVALLSTQSSSNLERS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g445 ### # start gene g446 Scaffold_21 AUGUSTUS gene 259144 260209 0.65 + . g446 Scaffold_21 AUGUSTUS transcript 259144 260209 0.65 + . g446.t1 Scaffold_21 AUGUSTUS start_codon 259144 259146 . + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_21 AUGUSTUS CDS 259144 259576 0.92 + 0 transcript_id "g446.t1"; gene_id "g446"; Scaffold_21 AUGUSTUS CDS 259755 260209 0.66 + 2 transcript_id "g446.t1"; gene_id "g446"; Scaffold_21 AUGUSTUS stop_codon 260207 260209 . + 0 transcript_id "g446.t1"; gene_id "g446"; # protein sequence = [MPKSSKKTEQSSSYRSADSGPTTHKTKLDGPPKNSKKKKDGGGTNKKQKLSKKELKELEKQQRQKSYIAPTKPQPIKP # DPLDSTGLVYVLPGELVIVLKNLGKKAVKTREKALDDLESGWVNSDKTKESSGQEQILIDMLPVWVKADGSESADVIGVWALASQDIDPAVASSASES # WRKFVGASLSKAQILTYAQRAIVDPGALYAYLNPSPLRTPASAPMPHDKLTGNQKTQIHSKGAKGKTTPVKGKSTSSTPKTSAGNPDVKQLQGFDDPR # LTLLKQTRIAMQDYVSVVWAH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g446 ### # start gene g447 Scaffold_21 AUGUSTUS gene 260671 263826 0.17 + . g447 Scaffold_21 AUGUSTUS transcript 260671 263826 0.17 + . g447.t1 Scaffold_21 AUGUSTUS start_codon 260671 260673 . + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_21 AUGUSTUS CDS 260671 261367 0.58 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_21 AUGUSTUS CDS 261446 261561 0.19 + 2 transcript_id "g447.t1"; gene_id "g447"; Scaffold_21 AUGUSTUS CDS 261627 261649 0.7 + 0 transcript_id "g447.t1"; gene_id "g447"; Scaffold_21 AUGUSTUS CDS 261819 263826 0.88 + 1 transcript_id "g447.t1"; gene_id "g447"; Scaffold_21 AUGUSTUS stop_codon 263824 263826 . + 0 transcript_id "g447.t1"; gene_id "g447"; # protein sequence = [MGYNYTAEINLRMRDVDAGSDAGSDSDSESASSDGEDEDVRKGMEVPPFAASRAFKSFLSFLACGCNGSPIQAYPAVM # VVLSTIPSSILLASYSSESVSSPAMPFTDLFSSFWAAVEPEHHPSSSSSGITVTSTITTPNRIFSGSGADKASKAFVEAVLDCLTFLVRRIVFQSQNA # TSETTADILGLSTLIRTQVKRVWVEVVGTGGATTTVDANGDPPVRKLVLRISPDVLVTQLIQDSAIEVSSTSTSIAAKDLSSFTSGVLKALQPSSRWM # GASGVRKEGFELLTTYLLCRDANSAARSTESSQAALTWLALLEQVVEYFHSQSGSQKAEFPVVLSYLLTLLDSLRSKRGGKVAVAKLRPIMNELDDMI # LEFAQDTVASGFSTLSSKLNLVRDVLLLTHHTKIAETISHPLLVPASLVKLVGMLVARFESGLRSLLGVGSEGRDQRGNQEEEKVSDSLDRMDRLLVL # MEVILQLPPVNVVDSEQSKPGPSSSSYTASLPALPSTSVIPGIFLLAYALPRSSLSPQSVLATTEDETISHSRDNLCAKAQRIWESSIKLSNDVYGGA # RKDQPYHERIYSSVTQSLRTLLSKTNPACLYWCTAEDVVEVFEVLRNSMSLKTISLHSVTLEKNPINALLPSQDSFDFLLDRMSGAPISRSMSVVDEL # AGAASVFDPSSSDATSDMNDVRIYARYALALLYILSNDLGLAKGLFTASPGSWWVLRHLLVLGVYARGTVSVPNAPNALYRNPLYHLAVLESDRAHRC # REIIGKVHRIVAYIFTSAEFAEGATGEEGREWRKDVCRMLSAPNETSLSTIPSLSAFLFSIAHFSAKTDSYRDCCVLREVLSRLFQTGLGSGGRSEIS # EEEADLWLNYARRLSETEKGKSARAPLTGVTIMSTLVANLPSSLSSSTLAASFSFPRLERYRNELASSLLGVSPPGQLQMGFEFF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g447 ### # start gene g448 Scaffold_21 AUGUSTUS gene 264589 264924 0.69 + . g448 Scaffold_21 AUGUSTUS transcript 264589 264924 0.69 + . g448.t1 Scaffold_21 AUGUSTUS start_codon 264589 264591 . + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_21 AUGUSTUS CDS 264589 264924 0.69 + 0 transcript_id "g448.t1"; gene_id "g448"; Scaffold_21 AUGUSTUS stop_codon 264922 264924 . + 0 transcript_id "g448.t1"; gene_id "g448"; # protein sequence = [MCHLLSSSTYSSVLYPPTNSHLSSSLPSFASSIHHDQLAYQILHKAAKKRTEHFVLEAGVDTEGKVKAQLPEELLVLL # QQSVDLDIDVEKADIDGDREHVSPTYIHTTLFL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g448 ### # start gene g449 Scaffold_21 AUGUSTUS gene 266253 267138 0.46 - . g449 Scaffold_21 AUGUSTUS transcript 266253 267138 0.46 - . g449.t1 Scaffold_21 AUGUSTUS stop_codon 266253 266255 . - 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_21 AUGUSTUS CDS 266253 266883 0.5 - 1 transcript_id "g449.t1"; gene_id "g449"; Scaffold_21 AUGUSTUS CDS 267014 267138 0.46 - 0 transcript_id "g449.t1"; gene_id "g449"; Scaffold_21 AUGUSTUS start_codon 267136 267138 . - 0 transcript_id "g449.t1"; gene_id "g449"; # protein sequence = [MSPESLEQTSQSSLKQYQIELIDKAMSCGALKFGSFTLKSGRISPYFFNAGLLSTGPILAVLSEAFAATIVAAQQPTS # SGNTPIPPFDVLFGPAYKGIAFAATTALILHTHHSNSQNSISTSPDAGIGFTYNRKEIKAHGEGGSLVGSSVSGKKVVILDDVMTAGTAVREAIDIVK # KEGGEVVGVIQLLDREEVGQDGVSSTVDEVEGIIGKGRVRSILRMRDLIAWLESKGMGKELEDMNEYRNKYGLKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g449 ### # start gene g450 Scaffold_21 AUGUSTUS gene 276374 277033 0.45 - . g450 Scaffold_21 AUGUSTUS transcript 276374 277033 0.45 - . g450.t1 Scaffold_21 AUGUSTUS stop_codon 276374 276376 . - 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_21 AUGUSTUS CDS 276374 277033 0.45 - 0 transcript_id "g450.t1"; gene_id "g450"; Scaffold_21 AUGUSTUS start_codon 277031 277033 . - 0 transcript_id "g450.t1"; gene_id "g450"; # protein sequence = [MRGRLFKMAIPLIMSLRQTFTKVISPPQNTVASTLTLTWSDFWDLGHEMFKSTPKSFPVPFVQGDIFDTKFLESTKPF # TVESPPTKPVPALNTLTSLNPLRGHLSACFCGAFFHLFGEDGQKQIAEALTGLLSPEPGSMIFGVHGSRAVKGFWHPTGSERYMFCHSPESWKDLWEG # LFGKGNVEVKAQLRKEIGGDDLFGTYPGNKDPYHVMEWSVSRI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g450 ### # start gene g451 Scaffold_21 AUGUSTUS gene 286660 287102 0.75 + . g451 Scaffold_21 AUGUSTUS transcript 286660 287102 0.75 + . g451.t1 Scaffold_21 AUGUSTUS start_codon 286660 286662 . + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_21 AUGUSTUS CDS 286660 286775 0.75 + 0 transcript_id "g451.t1"; gene_id "g451"; Scaffold_21 AUGUSTUS CDS 286826 287102 0.89 + 1 transcript_id "g451.t1"; gene_id "g451"; Scaffold_21 AUGUSTUS stop_codon 287100 287102 . + 0 transcript_id "g451.t1"; gene_id "g451"; # protein sequence = [MDTIEYLGYILSPDRLTMSKEKVQTILEWPVPRKVKDIHDIVVAVTWLTQKGAPWIWDNNCQEAFENLKIAFTSVPIL # AHWEPNHPIIMETKASNYAIAAILSIQTVDSEIHPLAFLSRTFHAAELNYNT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g451 ### # start gene g452 Scaffold_21 AUGUSTUS gene 287878 288330 0.76 + . g452 Scaffold_21 AUGUSTUS transcript 287878 288330 0.76 + . g452.t1 Scaffold_21 AUGUSTUS start_codon 287878 287880 . + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_21 AUGUSTUS CDS 287878 288330 0.76 + 0 transcript_id "g452.t1"; gene_id "g452"; Scaffold_21 AUGUSTUS stop_codon 288328 288330 . + 0 transcript_id "g452.t1"; gene_id "g452"; # protein sequence = [MDFIEQLPMSNGYTAILVIMDQSSKQAIFIPTFNTITSEQLAELFVIHVFSKHGVPNHVTSNRGSEFVLAFFRALGKV # FSMELHYTSGYHPEANGQTERVNQTLEQYIRIYYSYQQDDWSHLLPIAKFALTMLSRSGRGGVTSGARKRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g452 ### # start gene g453 Scaffold_21 AUGUSTUS gene 289150 289395 0.66 + . g453 Scaffold_21 AUGUSTUS transcript 289150 289395 0.66 + . g453.t1 Scaffold_21 AUGUSTUS start_codon 289150 289152 . + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_21 AUGUSTUS CDS 289150 289395 0.66 + 0 transcript_id "g453.t1"; gene_id "g453"; Scaffold_21 AUGUSTUS stop_codon 289393 289395 . + 0 transcript_id "g453.t1"; gene_id "g453"; # protein sequence = [MPNPFPNRTQSPPPPIEVDGEEEYNVAEILNSKLDRRYKCCPLRYYIWWAGYEGTDDEFSWVAADELVPTFHTQYPQK # PGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g453 ### # start gene g454 Scaffold_21 AUGUSTUS gene 293932 295458 0.91 - . g454 Scaffold_21 AUGUSTUS transcript 293932 295458 0.91 - . g454.t1 Scaffold_21 AUGUSTUS stop_codon 293932 293934 . - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_21 AUGUSTUS CDS 293932 295458 0.91 - 0 transcript_id "g454.t1"; gene_id "g454"; Scaffold_21 AUGUSTUS start_codon 295456 295458 . - 0 transcript_id "g454.t1"; gene_id "g454"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTRLEKHDLYLRPKNANLNNNRLNTSDSSSQKGR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g454 ### # start gene g455 Scaffold_21 AUGUSTUS gene 295509 296675 0.88 - . g455 Scaffold_21 AUGUSTUS transcript 295509 296675 0.88 - . g455.t1 Scaffold_21 AUGUSTUS stop_codon 295509 295511 . - 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_21 AUGUSTUS CDS 295509 296675 0.88 - 0 transcript_id "g455.t1"; gene_id "g455"; Scaffold_21 AUGUSTUS start_codon 296673 296675 . - 0 transcript_id "g455.t1"; gene_id "g455"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g455 ### # start gene g456 Scaffold_21 AUGUSTUS gene 299432 300598 0.99 + . g456 Scaffold_21 AUGUSTUS transcript 299432 300598 0.99 + . g456.t1 Scaffold_21 AUGUSTUS start_codon 299432 299434 . + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_21 AUGUSTUS CDS 299432 300598 0.99 + 0 transcript_id "g456.t1"; gene_id "g456"; Scaffold_21 AUGUSTUS stop_codon 300596 300598 . + 0 transcript_id "g456.t1"; gene_id "g456"; # protein sequence = [MSTPVPPAPNTSAEDLMTQLIRQVANLATAMEECSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFSAENPPFGGNWDTFLKEFSQRFEPMDPAMEAHSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g456 ### # start gene g457 Scaffold_21 AUGUSTUS gene 301427 304362 0.28 + . g457 Scaffold_21 AUGUSTUS transcript 301427 304362 0.28 + . g457.t1 Scaffold_21 AUGUSTUS start_codon 301427 301429 . + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_21 AUGUSTUS CDS 301427 301999 0.28 + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_21 AUGUSTUS CDS 302086 304362 0.49 + 0 transcript_id "g457.t1"; gene_id "g457"; Scaffold_21 AUGUSTUS stop_codon 304360 304362 . + 0 transcript_id "g457.t1"; gene_id "g457"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFAKIARPLNDLTKKDT # SFTWTDTRQKAFDTLREAFISAPILALWTPDRPTRIEVDASGFATGGALMQKQDDGQWHPVAFRSASMQPAERNYEIYDREMLAIIEALKDWRNFLEG # LPQPFDIITDHSNLEFWRTAQDLTRRQARWALYLSRFDFHMIHRPGRVNTQADALSRMAVHHVSDSDDNRQQTVLKPGHFVKIAASILQNPLEDRIRK # ASEREAQVLEGLKTVKEHGLQRLANGIAEWEEDNGLVYYRGRVYVPANDDLRTEVLRQCHDHPTAGHPGLHGTLDLVSTHFWWPTLRSFVEKYVEGCE # VCARKKIQRHPRAVTQPLDVPSGLWEEVGVDLITQLPNSQGYDAVLVCTDLYGKQIHAIPCTSSITAEGVADIYYREIFRLHGLPLHFKSDRGPQFAA # KLMRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGYLPLFNIPVGQRSGIPAVD # DRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDK # LYPWKGNSINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAANLSRAPKIVRAFHKKHPTAAKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g457 ### # start gene g458 Scaffold_21 AUGUSTUS gene 346314 346805 0.84 + . g458 Scaffold_21 AUGUSTUS transcript 346314 346805 0.84 + . g458.t1 Scaffold_21 AUGUSTUS start_codon 346314 346316 . + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_21 AUGUSTUS CDS 346314 346805 0.84 + 0 transcript_id "g458.t1"; gene_id "g458"; Scaffold_21 AUGUSTUS stop_codon 346803 346805 . + 0 transcript_id "g458.t1"; gene_id "g458"; # protein sequence = [MESRILASERFRTEKSPASILVTSDVSARGVDYPGVTRVIQVGIPSSTTQYIHRIGRTGRTGGVVGRGDLVLLPWEIG # FITWQLTEVPIKPVTAGEIKLQVEELAKKADSEPNSHKGIRTPFTPRLSDFDSAPDEIMSRFEEEAVRELFVSMLGYYLPKSESG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g458 ### # start gene g459 Scaffold_21 AUGUSTUS gene 348719 350705 0.94 + . g459 Scaffold_21 AUGUSTUS transcript 348719 350705 0.94 + . g459.t1 Scaffold_21 AUGUSTUS start_codon 348719 348721 . + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_21 AUGUSTUS CDS 348719 349835 0.99 + 0 transcript_id "g459.t1"; gene_id "g459"; Scaffold_21 AUGUSTUS CDS 349987 350705 0.96 + 2 transcript_id "g459.t1"; gene_id "g459"; Scaffold_21 AUGUSTUS stop_codon 350703 350705 . + 0 transcript_id "g459.t1"; gene_id "g459"; # protein sequence = [MLVDPVANPSNSSISAPTNISDLEEYLNTELFGPSTSVAAMSPGPSGSSRASSPSSHSDSLSQILSTPPQPVENSFPA # VDPYSFLGGLSGADGNHNFGFGFGGGSGTPSFFNFLDEEMKVDPSTNSIPFETGSPFDFMSALGIGGVSGLTIDPSTSFSPGSGSVAMAIDPQLVDSP # STHVQSDFGDDEDKEQKTEHAVVPIIGDEKKTRSQSKALSPKTSEDAADVTKEAQEKLTVTITPVKVGGHGKARKGTVQSGGVTKRVVIPTTAPATVP # IPLPVLAAPSSLSSTSSYSPSTSAASLLSRNKENVSAASPSSSTTSHLKEVDDRDKDDDDDLPADWRPPPEVFAKMSSKEKRQLRNKISARNFRVRRK # ALRQEVAALKRALLDGRGATSPMSPSSSSSSLIRSASPALIIRGADVNLNSAAVTTGLTIDDLNLPPPAPLPERSAAEELALRAGPLAQHPRRPRLML # PLIFLLLTSRKTSLPPLASTMPLVSGAVFHKLDLALVVWVVALHRSTLCLMPDLNTNMNVDGTNISIGQWVRDVLAANAANLRDGSSSPEASPKLLQE # NMNPVMNVAGAHQEDNMSPSAGIHNGFEGFVDTNPFTMKSLDA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g459 ### # start gene g460 Scaffold_21 AUGUSTUS gene 350785 351582 0.76 + . g460 Scaffold_21 AUGUSTUS transcript 350785 351582 0.76 + . g460.t1 Scaffold_21 AUGUSTUS start_codon 350785 350787 . + 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_21 AUGUSTUS CDS 350785 351582 0.76 + 0 transcript_id "g460.t1"; gene_id "g460"; Scaffold_21 AUGUSTUS stop_codon 351580 351582 . + 0 transcript_id "g460.t1"; gene_id "g460"; # protein sequence = [MAASSSHQASHPNQSPPQQPSQPNIYSSTYAQQRKALERELSYSSPFTLPSHQPGAKSPHSHHHHHNLTTSLKPAYFV # NSNKPNLPSPPPPKMGSTLSALLAGKHSTPNAFGGSFPAIPAHSSLPSSSNLSRPALSKQQQQQQMQQAQNVMYAALASTASQTLVRRLGNAFWDAFS # GSSSGPSASGSGAHSHMKPWDADKVRKVLEGKAVIKVVDVDEPVQRVTKREPSTPMLPSSSLASSDCDKSCSMTALLEDSMRTLSLGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g460 ### # start gene g461 Scaffold_21 AUGUSTUS gene 364138 365303 0.76 + . g461 Scaffold_21 AUGUSTUS transcript 364138 365303 0.76 + . g461.t1 Scaffold_21 AUGUSTUS start_codon 364138 364140 . + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_21 AUGUSTUS CDS 364138 364333 0.76 + 0 transcript_id "g461.t1"; gene_id "g461"; Scaffold_21 AUGUSTUS CDS 364498 365303 0.99 + 2 transcript_id "g461.t1"; gene_id "g461"; Scaffold_21 AUGUSTUS stop_codon 365301 365303 . + 0 transcript_id "g461.t1"; gene_id "g461"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEAVASWLSSKIGPNGLEPMDPGMEA # RSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAH # TTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVKQNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSL # FPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLDRANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g461 ### # start gene g462 Scaffold_21 AUGUSTUS gene 366599 367690 0.88 + . g462 Scaffold_21 AUGUSTUS transcript 366599 367690 0.88 + . g462.t1 Scaffold_21 AUGUSTUS start_codon 366599 366601 . + 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_21 AUGUSTUS CDS 366599 367690 0.88 + 0 transcript_id "g462.t1"; gene_id "g462"; Scaffold_21 AUGUSTUS stop_codon 367688 367690 . + 0 transcript_id "g462.t1"; gene_id "g462"; # protein sequence = [MVPEQYRDFKKVFSESASERLPAHQPWDHAIDLIPGALATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISS # PVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFMKFDLHWGYNNIWIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQAL # MNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRMVREVLTRLEKHNLYLRPKKCEFEQQQIEYLGLIISEGEVRMDPIKVAAVRDWPVPTNLWELQGF # LGFANFYRRFIRNFAKIARPLNDLTKKDTSFTWTDTQQKAFDTLREAFISAPILALWTPDRPTQIEVDASGLPREAPLCRSKTMANGIW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g462 ### # start gene g463 Scaffold_21 AUGUSTUS gene 368688 369579 0.56 + . g463 Scaffold_21 AUGUSTUS transcript 368688 369579 0.56 + . g463.t1 Scaffold_21 AUGUSTUS start_codon 368688 368690 . + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_21 AUGUSTUS CDS 368688 368803 0.56 + 0 transcript_id "g463.t1"; gene_id "g463"; Scaffold_21 AUGUSTUS CDS 368886 369579 0.98 + 1 transcript_id "g463.t1"; gene_id "g463"; Scaffold_21 AUGUSTUS stop_codon 369577 369579 . + 0 transcript_id "g463.t1"; gene_id "g463"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYASMHVPVRANLRLSSPVQYPSGQRSSIPAVDDRIRILREARQ # DAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKIGPLDYRLDLPLSLDRLHPVFHVDKLYPWKGNSING # EIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPANELASFLCERERKESNGTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g463 ### # start gene g464 Scaffold_21 AUGUSTUS gene 371864 372148 0.68 - . g464 Scaffold_21 AUGUSTUS transcript 371864 372148 0.68 - . g464.t1 Scaffold_21 AUGUSTUS stop_codon 371864 371866 . - 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_21 AUGUSTUS CDS 371864 372148 0.68 - 0 transcript_id "g464.t1"; gene_id "g464"; Scaffold_21 AUGUSTUS start_codon 372146 372148 . - 0 transcript_id "g464.t1"; gene_id "g464"; # protein sequence = [MSDIDLKKPFYSALLPGIQQNLITVNIGQGVAQTLKEAITQAVSVDVYLHDPILTGQNLRPTRFHATPADPHAMDIDA # THTSNGNTRETFLARM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g464 ### # start gene g465 Scaffold_21 AUGUSTUS gene 377509 377991 0.46 + . g465 Scaffold_21 AUGUSTUS transcript 377509 377991 0.46 + . g465.t1 Scaffold_21 AUGUSTUS start_codon 377509 377511 . + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_21 AUGUSTUS CDS 377509 377991 0.46 + 0 transcript_id "g465.t1"; gene_id "g465"; Scaffold_21 AUGUSTUS stop_codon 377989 377991 . + 0 transcript_id "g465.t1"; gene_id "g465"; # protein sequence = [MSSVSAMSSDSDSEMIQKNRNMFETFTTFIIIFIIAFARALSDVPEELELMDEAMFDVVCGFRGEDFDSVVWRDVHRY # QHRELNNGEESGRKEGEEPQAAGVMNKPSRRRRTASEFSDNGVAVIMEWRIQKAVGNGGGTVCWWSCLRRERVNGGKELVQI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g465 ### # start gene g466 Scaffold_21 AUGUSTUS gene 378288 379190 0.42 + . g466 Scaffold_21 AUGUSTUS transcript 378288 379190 0.42 + . g466.t1 Scaffold_21 AUGUSTUS start_codon 378288 378290 . + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_21 AUGUSTUS CDS 378288 379190 0.42 + 0 transcript_id "g466.t1"; gene_id "g466"; Scaffold_21 AUGUSTUS stop_codon 379188 379190 . + 0 transcript_id "g466.t1"; gene_id "g466"; # protein sequence = [MGGMGSTAEVYDAEMAGLAHGAAKAVQYAIISPAVHHILIFADNSSAVTTIYDQKPVAACQGYAQRFRRSIETFLESD # PQNTVEIAWCPGHEGIEGNEKADELAKEAGKLWAPTFHTFTHAKRRSKTNALESWKKEHNRRPFRGGFALSDGLPPRWKPRDYFHNTPREVYGRLIQC # RTRHAFLGEYYAKFVPTEPTQCPCGARTQTRDHIIQSCEIYNDYREILRDVSDELDMGEILGSEEGIEALANFIEKSGAFKKTGQPAADVAEPRLEEG # HMEGGDEADWEEEDGRIAEEASDDED] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g466 ### # start gene g467 Scaffold_21 AUGUSTUS gene 381046 381546 0.31 - . g467 Scaffold_21 AUGUSTUS transcript 381046 381546 0.31 - . g467.t1 Scaffold_21 AUGUSTUS stop_codon 381046 381048 . - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_21 AUGUSTUS CDS 381046 381546 0.31 - 0 transcript_id "g467.t1"; gene_id "g467"; Scaffold_21 AUGUSTUS start_codon 381544 381546 . - 0 transcript_id "g467.t1"; gene_id "g467"; # protein sequence = [MDLSLDMDMDGMGFGREPAVGGGMGMDRNIDKDEFNDAKTAETLPALKKTTIGQGKGEREGEREVVVIPDSPASLTDG # QGGKGGGGETDDERSGKSQRLKKVKKSKAVKSKFGSEQDRSSKTGAASEREGHGKDKDSKERSGSKIKLSKPEVERERDSGLVQEGKS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g467 ### # start gene g468 Scaffold_21 AUGUSTUS gene 382194 383887 0.43 - . g468 Scaffold_21 AUGUSTUS transcript 382194 383887 0.43 - . g468.t1 Scaffold_21 AUGUSTUS stop_codon 382194 382196 . - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_21 AUGUSTUS CDS 382194 383735 0.77 - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_21 AUGUSTUS CDS 383879 383887 0.43 - 0 transcript_id "g468.t1"; gene_id "g468"; Scaffold_21 AUGUSTUS start_codon 383885 383887 . - 0 transcript_id "g468.t1"; gene_id "g468"; # protein sequence = [MYDFSGEKDCRTPHDFSGASATKLDDIGEGDGDDDEEEEEPSSSKSKETNSKASTSRGVPIPAPSPPLHFHGRPRSPG # PDKDTSTKDQTSRGRSSHHPNSRKRSHSHLAGRESRSRSHSPSFSGHVQPSLLQQQRAAHTLSGGYTSISNPHTNSNPNFDLFGIASIGARAGASSSS # PSSPPPSHMEFGGRNSLAFNALGGLSNMRDIRDLGFNGHSLRDLHGISDLRELRGLGMGNLNFDSIRDSRTFNGVNDFNGFNAFGGGGGSIDLTTLRG # MNRVDAINALRSLGVDLGVEGNRDMRDPRDPRNFDPRSPDLDNPNMNPNMNPSLNPAISTRMMYQQMMLHQQHQQQLIQRRERLAALQAAHAHGEPLS # PHIHHPSHPTHSHNSIHRHSRSSLPRDPRDLPISSDAFSSRDHDRHDMRRRSSSSTAVGLAGRPITEGLEKDKEKEKAKDDKDKDKNKSKDSDIGDLV # AFLDAVENPPSGSRAQDTPGLLRRSSSQSGSTLEWPTTTAREGSGK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g468 ### # start gene g469 Scaffold_21 AUGUSTUS gene 386554 386769 0.54 - . g469 Scaffold_21 AUGUSTUS transcript 386554 386769 0.54 - . g469.t1 Scaffold_21 AUGUSTUS stop_codon 386554 386556 . - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_21 AUGUSTUS CDS 386554 386769 0.54 - 0 transcript_id "g469.t1"; gene_id "g469"; Scaffold_21 AUGUSTUS start_codon 386767 386769 . - 0 transcript_id "g469.t1"; gene_id "g469"; # protein sequence = [MKEVRRIIIPWLLSSQQTACAELYTSVNNVFLPYMSRSLPAATRSTDDSNGGTGETDQHVQILENNAEEAK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g469 ### # start gene g470 Scaffold_21 AUGUSTUS gene 396472 397404 0.99 + . g470 Scaffold_21 AUGUSTUS transcript 396472 397404 0.99 + . g470.t1 Scaffold_21 AUGUSTUS start_codon 396472 396474 . + 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_21 AUGUSTUS CDS 396472 397404 0.99 + 0 transcript_id "g470.t1"; gene_id "g470"; Scaffold_21 AUGUSTUS stop_codon 397402 397404 . + 0 transcript_id "g470.t1"; gene_id "g470"; # protein sequence = [MASKGLVRQEGFHPDTSSSGSDLSWRPSSALSGIGSSPHDLGGGGGGDFDQELATLISSERSTASTSSSSGSTTNDYV # QRTHNIFDMGVRPPSSSSLHTAHNNSHNQHTPSNSQRADSPPHPTSIPAHFNSTLPALNSSMRYEPLPDLPTSSMTPVPPTGDSPGLGGWTRHTPSPR # PTGTNNNNTNPNNNNGNASAGHPYAVSRSRSRSRPPSAYPGHPGPSASPSILPSSLGSSGIGPQRTTRARRGNSVSSMSSMTSSTSPPPLLQQSAQAI # IIPRTGHHHTQSGHGNGGGDGWYGPGSQGSLGSSTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g470 ### # start gene g471 Scaffold_21 AUGUSTUS gene 397791 398639 0.86 + . g471 Scaffold_21 AUGUSTUS transcript 397791 398639 0.86 + . g471.t1 Scaffold_21 AUGUSTUS start_codon 397791 397793 . + 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_21 AUGUSTUS CDS 397791 398639 0.86 + 0 transcript_id "g471.t1"; gene_id "g471"; Scaffold_21 AUGUSTUS stop_codon 398637 398639 . + 0 transcript_id "g471.t1"; gene_id "g471"; # protein sequence = [MSISGGIGNINNGINSINNGMPNSTSSFNANGHWPSSPGAGDQQHFGSPFGNSSSPHLHTGPHPHQHQGQHPHQHHQG # HHEQHGHGHAQMHFGGTTPPTHTSFNSSLDRIDRLDRFDKLERFDRLDRLDGWGFPESRSHSGHSSSNGGTGGGMTPLSSSLPTTSTILPPPPPSSSS # GRGHGHSASISGATSTSSTTTSSSNRRSTKAEKAERAAALDSNTNNNKHLTPAEKQALVANEKRRRRRESHNAVERRRRDNINEKIGELATLIPDVMF # GGEGGGGE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g471 ### # start gene g472 Scaffold_21 AUGUSTUS gene 398881 399483 0.41 + . g472 Scaffold_21 AUGUSTUS transcript 398881 399483 0.41 + . g472.t1 Scaffold_21 AUGUSTUS start_codon 398881 398883 . + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_21 AUGUSTUS CDS 398881 399483 0.41 + 0 transcript_id "g472.t1"; gene_id "g472"; Scaffold_21 AUGUSTUS stop_codon 399481 399483 . + 0 transcript_id "g472.t1"; gene_id "g472"; # protein sequence = [MGLPVPDEYFHNNPGAAAGGPGSGSGSGVALKTEPMDSDTVVGDEEALTAKGGDGRGSSGGKDGKDKDGGKDGDEAGG # VVKANKGMILRKSVEYIRSVFGQTVQFLLLDVFFRINSESSISFNHLNCSNSKYLQVSPTTSHGARCSEQGTREGIEDVSRRTCESQPQLLVVQYSEC # YEHSQPHEHDRSGFGREHGRNGVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g472 ### # start gene g473 Scaffold_21 AUGUSTUS gene 399908 400965 0.32 + . g473 Scaffold_21 AUGUSTUS transcript 399908 400965 0.32 + . g473.t1 Scaffold_21 AUGUSTUS start_codon 399908 399910 . + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_21 AUGUSTUS CDS 399908 400208 0.32 + 0 transcript_id "g473.t1"; gene_id "g473"; Scaffold_21 AUGUSTUS CDS 400286 400965 0.72 + 2 transcript_id "g473.t1"; gene_id "g473"; Scaffold_21 AUGUSTUS stop_codon 400963 400965 . + 0 transcript_id "g473.t1"; gene_id "g473"; # protein sequence = [MSGLSGMGSLNSMGSMNSIGMGLSMGSPLSDVDEDEDEHKEVKEEKGFKGFKEHTERRDSRKTKLNTSNSKDSVHPGD # ADASTTISGVSSLSKEKDTNNNGTTLPMGKSTRTTRLRANSVKNNISSSASAVNASASHSNPNLSSPSSTSTSMPKDILSGENNRGRTRRARRGSDVT # GGKVGGKAEVLGNVSTSPVARRRRAAVAATHKSKLKPDSEDPDVDMDTASVVDSAVVDDDDYEDDDPEAVDDADDGGDDDRDEDYRDEDHSPNSVTSR # PGSGSPRNAGGNDDDDSPSAMAMEMDDEPIGRRNGRNGRRNRVALGGGGMEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g473 ### # start gene g474 Scaffold_21 AUGUSTUS gene 407170 407469 0.64 + . g474 Scaffold_21 AUGUSTUS transcript 407170 407469 0.64 + . g474.t1 Scaffold_21 AUGUSTUS start_codon 407170 407172 . + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_21 AUGUSTUS CDS 407170 407469 0.64 + 0 transcript_id "g474.t1"; gene_id "g474"; Scaffold_21 AUGUSTUS stop_codon 407467 407469 . + 0 transcript_id "g474.t1"; gene_id "g474"; # protein sequence = [MVIILICTFLTVPSPSLPHTARSTPQVIGSPDMSQSAGHFAEVEAAASDADCSDGVYDTNANDCETDSVVVGKQVRDQ # SPIEWSPTPPRGQALYVLLQF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g474 ### # start gene g475 Scaffold_21 AUGUSTUS gene 408134 410356 0.31 + . g475 Scaffold_21 AUGUSTUS transcript 408134 410356 0.31 + . g475.t1 Scaffold_21 AUGUSTUS start_codon 408134 408136 . + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_21 AUGUSTUS CDS 408134 409009 0.31 + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_21 AUGUSTUS CDS 409160 409164 0.45 + 0 transcript_id "g475.t1"; gene_id "g475"; Scaffold_21 AUGUSTUS CDS 409219 410356 0.63 + 1 transcript_id "g475.t1"; gene_id "g475"; Scaffold_21 AUGUSTUS stop_codon 410354 410356 . + 0 transcript_id "g475.t1"; gene_id "g475"; # protein sequence = [MSALVFRWNDDSFDLCYPPEDPEVSTPVETSSRGLSVDEYDDLDIDLPADFRSIRALRTPSPDLPSNPLDGWSPTPRA # QSTLGSLARRGLFPNSSTNPHILPSKLRRDTSPLKVLSGSSPSPPRSLLSLPSHSYSGTSTANMSPSKASAQGSPKSRGKDRVRFHPFKQSTHNHHVP # SSLIVGTSPVKSPSKSSAAGKRLCNDLIRHALCDGQPSPSTTSTREIRNALIREALGESDLTNDVSSSGTAVVQEHDPQEVPPFVDNNLGDTGVLNSA # WIDRRFAVSFRSVTNLPLEKCIRQVVNFIRCANVFNGARFDPTSPSAIACPTINNKIHLVLAEDHFFNAVFLTVGRVNESYIFNPKSFLAKDKAVRYI # RGLRVHGLMQESQRLFACFGSLIGASKFGCPVSKGIIDFRSNQRFDSDIWKDDPDNLSPLEPGLSSPFLFDLSSQVVFLHLVTPGKKREVSNVPKNIH # CKDPLPFCRAGELRMRFVHFPILILATVPIFDGRGSFVASAAQLNQIASRAYPLYLDSQEEVPPDSIVCVGYTAHIWQSSGSSKAPPLCLSLGLQFVV # VLALPPGYDGPPLPSSGSSRPFPKPLYNTPTRTKDFPGPPRRTHSRLQASSSRVSPDAARPSRVTHRSQADSDDDSPYLYSGGLKDGYEYHEDLIETK # LISKRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g475 ### # start gene g476 Scaffold_21 AUGUSTUS gene 412395 413114 0.66 + . g476 Scaffold_21 AUGUSTUS transcript 412395 413114 0.66 + . g476.t1 Scaffold_21 AUGUSTUS start_codon 412395 412397 . + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_21 AUGUSTUS CDS 412395 413114 0.66 + 0 transcript_id "g476.t1"; gene_id "g476"; Scaffold_21 AUGUSTUS stop_codon 413112 413114 . + 0 transcript_id "g476.t1"; gene_id "g476"; # protein sequence = [MVHCLFSVKLIILCFFVTFKVEYCILKIVYLRPLSKQRHFGGGRPPHNKSESGIVSTLITEAFTFKCPIPKTSTVPPN # TVDNITFNFPPPPITRSHMALVIDKWCKSSSPVNFEEAGCAVCGQLTLCTDLSALKNMKNYLHVLEAQSVTRAFRSSPDESISEIEGPVLDKSAGDNI # CNNCCSSLRAGNVPKLALCRGLWLGVIPDELKGLTFYEKMLIARVRHTKCFVQYRKVQLIILN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g476 ### # start gene g477 Scaffold_21 AUGUSTUS gene 414400 414841 0.23 + . g477 Scaffold_21 AUGUSTUS transcript 414400 414841 0.23 + . g477.t1 Scaffold_21 AUGUSTUS start_codon 414400 414402 . + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_21 AUGUSTUS CDS 414400 414404 0.23 + 0 transcript_id "g477.t1"; gene_id "g477"; Scaffold_21 AUGUSTUS CDS 414490 414841 0.85 + 1 transcript_id "g477.t1"; gene_id "g477"; Scaffold_21 AUGUSTUS stop_codon 414839 414841 . + 0 transcript_id "g477.t1"; gene_id "g477"; # protein sequence = [MINAEGISVHDDLNDDGTEEGDCVFTVHGIVGPSIKNMTRDQMIGIAAMHLDNEGKFMRTSHAENPESLWNNPQLYPK # MFPWLFPFGLGGIGAQIKAFSESSHIKFLLLYMTNAFNLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g477 ### # start gene g478 Scaffold_21 AUGUSTUS gene 416592 418523 0.77 + . g478 Scaffold_21 AUGUSTUS transcript 416592 418523 0.77 + . g478.t1 Scaffold_21 AUGUSTUS start_codon 416592 416594 . + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_21 AUGUSTUS CDS 416592 418523 0.77 + 0 transcript_id "g478.t1"; gene_id "g478"; Scaffold_21 AUGUSTUS stop_codon 418521 418523 . + 0 transcript_id "g478.t1"; gene_id "g478"; # protein sequence = [MTVPNFVGSLPRPDKDDREYYCCTMLTLFKPWRSGEDLKNKNQSWHEAFEAYVFSDQSLLYMKNMNIRFECLDARDDF # RAQLKSGKLDVTKLPSSIPVQLHEDLVNKLDGSQLDVNSSVIEDTDYSYDQYTQDKKGSFFLKRESAMKAMKDILFNSGWVTPLTSNIQPKPIPICSP # IPLPKEKPQHWDLILKGMRDHVLAARDKSRGLPPADNDTNKNNEPGKYRPNIVEICDKYYFDKLGLEYGSIKELTLNIVKCHNLNNEQERAFRIIAQH # SACLVSEPLQMYIGGMGGTGKSQVIKALLQFFAERNSSFAIVTSAPTGNAAALLGGSTYHFLLGLNNKVEEVGRGTMAQVCARLEHIQYMILDEVSML # SCLDLYRISVQLCEAKNKHDIAFGGMNMIFAGDFAQLPPVGGESVSLYSYRKPTDANKYNGQCAAMGKSLWHNVTHVVILRKNMRNTGSSKMDISFRL # ALDNMQYKSCTKEDILFLNTLVSSKLPDRPFVGKSPWRDAAIIVGENKYKDEINRLGCLRFAADTKQKLTNFYSDDLVSGNAYQGAPAKSKNKKRSIS # SISKDLQQHLWELPTCAHEYHAPPVLSLCIGLPIIIRHNIATELSITKGQRGTVYAWHESTGAFGQCTLDVCLFS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g478 ### # start gene g479 Scaffold_21 AUGUSTUS gene 419099 419575 0.69 + . g479 Scaffold_21 AUGUSTUS transcript 419099 419575 0.69 + . g479.t1 Scaffold_21 AUGUSTUS start_codon 419099 419101 . + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_21 AUGUSTUS CDS 419099 419575 0.69 + 0 transcript_id "g479.t1"; gene_id "g479"; Scaffold_21 AUGUSTUS stop_codon 419573 419575 . + 0 transcript_id "g479.t1"; gene_id "g479"; # protein sequence = [MKQNKKSNTSENTTTSPAPLVPPDISRFEVKSKKRNLSDVYGSTDIPLPSAVRQRTTNQHIVPLSNELRRSSAARQAS # QKRAQKNRITSGNQRQLAILPTGLTWSNNSCAFDSVLLILLYIWMELNITGDEYSNLPQLIKGFSEYKQGKHTLETVLMI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g479 ### # start gene g480 Scaffold_21 AUGUSTUS gene 419677 420180 0.32 + . g480 Scaffold_21 AUGUSTUS transcript 419677 420180 0.32 + . g480.t1 Scaffold_21 AUGUSTUS start_codon 419677 419679 . + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_21 AUGUSTUS CDS 419677 420180 0.32 + 0 transcript_id "g480.t1"; gene_id "g480"; Scaffold_21 AUGUSTUS stop_codon 420178 420180 . + 0 transcript_id "g480.t1"; gene_id "g480"; # protein sequence = [MTTKLQCEQGHLSRRRPHNVKVSLLEEPRLVLPSSTNEWISVNGPASSSIMCNVCNLPLRKLFHIKCAPNILAFACDG # RPQLKIDYSVHLQCNNEDVHYVLKGVIYYIPMREHFISRIVASDNMVYVYDGMFNNGVPILESSDYSVLDWAQCQSGSASAVIYSRTDN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g480 ### # start gene g481 Scaffold_21 AUGUSTUS gene 427682 428280 0.59 + . g481 Scaffold_21 AUGUSTUS transcript 427682 428280 0.59 + . g481.t1 Scaffold_21 AUGUSTUS start_codon 427682 427684 . + 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_21 AUGUSTUS CDS 427682 427789 0.72 + 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_21 AUGUSTUS CDS 427927 428280 0.64 + 0 transcript_id "g481.t1"; gene_id "g481"; Scaffold_21 AUGUSTUS stop_codon 428278 428280 . + 0 transcript_id "g481.t1"; gene_id "g481"; # protein sequence = [MTEGIDPILLPSSYSSPSTSPSSIPINPFGTGPLYSTPDEDKGDSKENFGKGNNGEKGIIFESSVNGYPNGFVIIVNV # YDVPSGAQHGFGSTQTFDKVVQVEVGSRPPAKEGTENDCTRCYSVFEARTIINWLRVLVDEKEEESCQKKWWRDW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g481 ### # start gene g482 Scaffold_21 AUGUSTUS gene 430416 430802 0.86 + . g482 Scaffold_21 AUGUSTUS transcript 430416 430802 0.86 + . g482.t1 Scaffold_21 AUGUSTUS start_codon 430416 430418 . + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_21 AUGUSTUS CDS 430416 430802 0.86 + 0 transcript_id "g482.t1"; gene_id "g482"; Scaffold_21 AUGUSTUS stop_codon 430800 430802 . + 0 transcript_id "g482.t1"; gene_id "g482"; # protein sequence = [MKKASKRHDHTVTVILTADGLCRAIHIIIKCSTIHEYTRSLPAAAGSTDDSDGRAGKTDVHVHILENNAEEAKKNRDR # AARGRLNAVTALDRSSRAAACRLISRSRCGDRKSSESGGDEGEFKLHDEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g482 ### # start gene g483 Scaffold_21 AUGUSTUS gene 433101 434355 0.76 - . g483 Scaffold_21 AUGUSTUS transcript 433101 434355 0.76 - . g483.t1 Scaffold_21 AUGUSTUS stop_codon 433101 433103 . - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_21 AUGUSTUS CDS 433101 433976 0.91 - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_21 AUGUSTUS CDS 434066 434205 0.77 - 2 transcript_id "g483.t1"; gene_id "g483"; Scaffold_21 AUGUSTUS CDS 434331 434355 0.93 - 0 transcript_id "g483.t1"; gene_id "g483"; Scaffold_21 AUGUSTUS start_codon 434353 434355 . - 0 transcript_id "g483.t1"; gene_id "g483"; # protein sequence = [MTSKLCRELRDIFHPATEDHLAPADIEKALLKIDEVASNQEGIAAEEALILRGCVRLNASIAFKASDQDSLDTARLVE # TGAKKLAQLYTKLVAEGSSGNTPAPGVEIVKAPFPSQLRTTLQPIVAFLRTLPVPSTHPSHPAAATILTTLKDAQRGYADMRGAWGKKCLEAHGKRVV # DRADTVEPIATGRELGAWVQSVLSVAREEYDLLIEMSTLVSPSQLASHFGNLLNPLVLLMSTTITALVAFSKRSLQKYGFLILSAYEALLELQPMWEE # ISALKVSPESRNDNRKETNEYKDVLHVVRMVCIRMFPEALADIKLSTAGRTGDTSTALLDAAVEVRFSSISY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g483 ### # start gene g484 Scaffold_21 AUGUSTUS gene 438823 439119 0.54 + . g484 Scaffold_21 AUGUSTUS transcript 438823 439119 0.54 + . g484.t1 Scaffold_21 AUGUSTUS start_codon 438823 438825 . + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_21 AUGUSTUS CDS 438823 439119 0.54 + 0 transcript_id "g484.t1"; gene_id "g484"; Scaffold_21 AUGUSTUS stop_codon 439117 439119 . + 0 transcript_id "g484.t1"; gene_id "g484"; # protein sequence = [MRKHKSLPTAARSANDSNRAASKTDEDVQILEDNAKEPKNRSSAGATGRLGAIAALDRASTATAGRLIARSRRGDRKG # SESGGDKSEFELHAEYREST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g484 ### # start gene g485 Scaffold_21 AUGUSTUS gene 440413 441933 0.55 - . g485 Scaffold_21 AUGUSTUS transcript 440413 441933 0.55 - . g485.t1 Scaffold_21 AUGUSTUS stop_codon 440413 440415 . - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_21 AUGUSTUS CDS 440413 441394 0.96 - 1 transcript_id "g485.t1"; gene_id "g485"; Scaffold_21 AUGUSTUS CDS 441515 441807 0.88 - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_21 AUGUSTUS CDS 441907 441933 0.6 - 0 transcript_id "g485.t1"; gene_id "g485"; Scaffold_21 AUGUSTUS start_codon 441931 441933 . - 0 transcript_id "g485.t1"; gene_id "g485"; # protein sequence = [MKRPETRLYWLEAEKGKKGIRSDGGRLDAEDLGSETEQKGQMKPEFGKTVIVPIAIPGCGELDVIRHAVLSDERWLQV # KPLLQSLSPTFSVLDIRKVMMCTLRNPRPNNHLRQHRTQLRELTQKMIPPVRLLALNWSLASYPQSTVHRICGDRVLVRGDNHQTLRADASKFRAHED # VIWMFITQTEELAPAEVDAIIDMDLEEDFVSAVNRAVDGICKELDLPRPTPENIAKGIEKATGYRPATKKADEESKQKPKEKEPRYFGIVPEIHLEQV # LTKVLGENPTTYTMWMHLKKNQRVTQRPHITVIHKKSLPGEIELWERCMDLHSSKNPPMFEFKLKNVIWNDRVMAVVVSDLKVLPGSDSEQKGAEFIG # KLSEKIRTRLHITVGTKNHNIPPVEAKALVEEWRQGNTGGVQTIEFSEDVLVQGRIKGLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g485 ### # start gene g486 Scaffold_21 AUGUSTUS gene 449417 450121 0.39 - . g486 Scaffold_21 AUGUSTUS transcript 449417 450121 0.39 - . g486.t1 Scaffold_21 AUGUSTUS stop_codon 449417 449419 . - 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_21 AUGUSTUS CDS 449417 450121 0.39 - 0 transcript_id "g486.t1"; gene_id "g486"; Scaffold_21 AUGUSTUS start_codon 450119 450121 . - 0 transcript_id "g486.t1"; gene_id "g486"; # protein sequence = [MILHVLVIEGKSRKNPSHGIMNYTVFPASICMQRVTPADIFQLHRIFPTPHARTLPTTPQPSYLPVTVVTFQLQGSQV # KASVIYYELPHAPLCLSSAPFNFKNVRQPTHNNCSSNKLSQMPASRPGKRGGASLHAFANTVGAGASGGRGRGGAGNGGGARRGGNGGGRGGRSQAPP # PQPKTFRTVVADYSNVHYRSSYQPNSTEWDQSRLDAPGIDCVKFGREFSIDECVSILT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g486 ### # start gene g487 Scaffold_21 AUGUSTUS gene 452927 453766 0.96 - . g487 Scaffold_21 AUGUSTUS transcript 452927 453766 0.96 - . g487.t1 Scaffold_21 AUGUSTUS stop_codon 452927 452929 . - 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_21 AUGUSTUS CDS 452927 453360 0.97 - 2 transcript_id "g487.t1"; gene_id "g487"; Scaffold_21 AUGUSTUS CDS 453505 453667 0.97 - 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_21 AUGUSTUS CDS 453746 453766 0.96 - 0 transcript_id "g487.t1"; gene_id "g487"; Scaffold_21 AUGUSTUS start_codon 453764 453766 . - 0 transcript_id "g487.t1"; gene_id "g487"; # protein sequence = [MALAEPLICPFAHRVELALAETGLKSNKDFVRYEIDLKNKPEWYQPKINPASKVRTASRLIILYFQRPCPQSQNPIFH # RYLRNKFGPALFTFQSGKAPNGAEGIFSAIEQLQDLMAPEGLAIGDGTEFTLADAAVIPFFGRMEVSLKNDFGAFPEGEGKSTWEALQTDKRFARWKK # YWDTAKARESFKTTFDEVTKIFFSPMTLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g487 ### # start gene g488 Scaffold_21 AUGUSTUS gene 455544 456197 0.54 + . g488 Scaffold_21 AUGUSTUS transcript 455544 456197 0.54 + . g488.t1 Scaffold_21 AUGUSTUS start_codon 455544 455546 . + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_21 AUGUSTUS CDS 455544 456197 0.54 + 0 transcript_id "g488.t1"; gene_id "g488"; Scaffold_21 AUGUSTUS stop_codon 456195 456197 . + 0 transcript_id "g488.t1"; gene_id "g488"; # protein sequence = [MTATSAVAILLFVASLAIQVYAAAIPSASSPPGKFSDDLDIPSASATPHIQGLPSVSVRNTPSTAVSSYVFSFFNHNK # NRNRELTKNNKLGYFFRIPDSTSPMHVNSMIETRTREHDYLTPRRLDGQKKNSSMNMPLDPSETEKKEEEGKEKGDLKGAPPPKKQSKQQKVETERLA # QEQLAERKKIKAANPPVKKTTKTTKTTPNVTKVPEKKEESE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g488 ### # start gene g489 Scaffold_21 AUGUSTUS gene 457756 458679 0.9 + . g489 Scaffold_21 AUGUSTUS transcript 457756 458679 0.9 + . g489.t1 Scaffold_21 AUGUSTUS start_codon 457756 457758 . + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_21 AUGUSTUS CDS 457756 458679 0.9 + 0 transcript_id "g489.t1"; gene_id "g489"; Scaffold_21 AUGUSTUS stop_codon 458677 458679 . + 0 transcript_id "g489.t1"; gene_id "g489"; # protein sequence = [MNPTSKSKDSDSIRAADTPSRSSLNGGNETLIPSGAADSTTPGKHRGGRKMGPQPTSEEEDHSKGKEPALANSSPFND # TSQIMEGSNATTSQTKHHHHHHHHHHRTSNATANKHDDDGDDTSTLKPPRRHRGSTVTPNVKPDLKRVNSSMSSGSDYAVTLSSEDGNTRQSTKDTRP # ERLRSPGHHRTGSSASKHNSFDTGVVRTGSSASRGPGGPNRGRPRTGSMNNSMDRSSTREREREREREREREKEREREKAENRASALYAATQNTQNMQ # TTQSAAFNANTFATNFGNAAAPVPGMTKPPGTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g489 ### # start gene g490 Scaffold_21 AUGUSTUS gene 459014 459625 0.33 + . g490 Scaffold_21 AUGUSTUS transcript 459014 459625 0.33 + . g490.t1 Scaffold_21 AUGUSTUS start_codon 459014 459016 . + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_21 AUGUSTUS CDS 459014 459078 0.43 + 0 transcript_id "g490.t1"; gene_id "g490"; Scaffold_21 AUGUSTUS CDS 459127 459625 0.79 + 1 transcript_id "g490.t1"; gene_id "g490"; Scaffold_21 AUGUSTUS stop_codon 459623 459625 . + 0 transcript_id "g490.t1"; gene_id "g490"; # protein sequence = [MHRRHFDFENDQLGSDDPAVMFSKNSCKEQAKTLTLTLLRIMTLIKSTITLSSPQNLLLFIPTITRITKNSSDFNSYD # EYIAWERQDAEHIAKIRRDIASTREQLEMQEAALAALEKEHREKKERHHASLNRDNFSNAVGNSKKKDRAGFIDYENDQFLWDASLKDNMKKVFGIND # FRLCQRGCVAF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g490 ### # start gene g491 Scaffold_21 AUGUSTUS gene 462056 462466 0.54 + . g491 Scaffold_21 AUGUSTUS transcript 462056 462466 0.54 + . g491.t1 Scaffold_21 AUGUSTUS start_codon 462056 462058 . + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_21 AUGUSTUS CDS 462056 462466 0.54 + 0 transcript_id "g491.t1"; gene_id "g491"; Scaffold_21 AUGUSTUS stop_codon 462464 462466 . + 0 transcript_id "g491.t1"; gene_id "g491"; # protein sequence = [MLTRFPTKEGLATLSMKLSFSFRVMKRNAKGRPKLTTSSSKKGKAAASAAGSTSILNDEHGDPDVPGFDIDDHNDEDV # EEDAKLFKSKMTRLNGISGLPHRCKIVPDLSYIKSGRCDKISDDEDDDASKGEDEEIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g491 ### # start gene g492 Scaffold_21 AUGUSTUS gene 463605 465679 0.43 - . g492 Scaffold_21 AUGUSTUS transcript 463605 465679 0.43 - . g492.t1 Scaffold_21 AUGUSTUS stop_codon 463605 463607 . - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_21 AUGUSTUS CDS 463605 463740 0.52 - 1 transcript_id "g492.t1"; gene_id "g492"; Scaffold_21 AUGUSTUS CDS 463845 465679 0.73 - 0 transcript_id "g492.t1"; gene_id "g492"; Scaffold_21 AUGUSTUS start_codon 465677 465679 . - 0 transcript_id "g492.t1"; gene_id "g492"; # protein sequence = [MQGPSKGFSGVRVFKGPTLSSFNLNPFSTVSAHFDSFDVGYRPSQPDLPQRHGGHPPRNQQQPARNWQAHNNMYTPSN # APPPPPSHTYQQNPMAHFGVRTASQSSGSRSQEPPRHRDVQPQPQPTPLNHNYFIHPGKSTDMYIYEASDAFSEYSPSTFSPTLSTDSTTTLQSPSPL # PLGQSGLSWDHVRSATPSVRPNTPAPPSGQSRAQSPQSYPSNSYPSNSGNGSISFPSGLPGIRQAQTALRGFFGSNGQVGQPGERQSGESTQTQGATN # GRIHARTLSESSSTANALPNSETEFDDLARMNTALNAGYSYYYPETPALVRPRSGSTSIPNSSSQRSPRDSLMFYSDVQRVEQSPETDLNFPYSQTAA # TVNIRATSDQVPSSTLEMSGAAVENSEASNTLNHGTSSLVPALERSISSSSQSSELSILRTPSPTSYPPSQLPSWLQSQPQTFPYPPVQSKPVEQAST # TVPPAYTTYLSASPEPQTSPSSLVQVQSSAPLLSSSRSQSQSSSTSSSASDTLNGSHSEVYSSFNRDRVVAHPATGEGIASNSTSAVTNTSPNQSYPM # PHAALTETRSSNNTTLAPLADPLNISQSGRTRSPTTGRHGTHGTPNSSSPRIHGQPTTDSQRAMLRPVLLPASTTPAPPQQFKLVSER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g492 ### # start gene g493 Scaffold_21 AUGUSTUS gene 481727 482068 0.78 + . g493 Scaffold_21 AUGUSTUS transcript 481727 482068 0.78 + . g493.t1 Scaffold_21 AUGUSTUS start_codon 481727 481729 . + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_21 AUGUSTUS CDS 481727 482068 0.78 + 0 transcript_id "g493.t1"; gene_id "g493"; Scaffold_21 AUGUSTUS stop_codon 482066 482068 . + 0 transcript_id "g493.t1"; gene_id "g493"; # protein sequence = [MSSTGPVPESSDETNVEQSLEAPIVQVSSPSGGSHPPVPLFLSEQESPTSPSPPPRSPVPPLLFGSVASLSIDLTGDD # DELYETEEAYASRIDVAMEGTELAVGQGIVKEESL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g493 ### # start gene g494 Scaffold_21 AUGUSTUS gene 484765 485439 0.58 - . g494 Scaffold_21 AUGUSTUS transcript 484765 485439 0.58 - . g494.t1 Scaffold_21 AUGUSTUS stop_codon 484765 484767 . - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_21 AUGUSTUS CDS 484765 485439 0.58 - 0 transcript_id "g494.t1"; gene_id "g494"; Scaffold_21 AUGUSTUS start_codon 485437 485439 . - 0 transcript_id "g494.t1"; gene_id "g494"; # protein sequence = [MLRASDSSATEGVQQPKDPESGDPSSEQGGVVKELDKESKRQETEELKKSIPVQYQDYLDVFSPGEARTLPPHRPYDI # KIETEGDAIPPIGKLYNMSEKELKSLKEYIDEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNKITKKNRYPLPLIGTLVDQLRKAKIFTK # IDLRAGYNNVRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSRFNSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g494 ### # start gene g495 Scaffold_21 AUGUSTUS gene 485844 486521 0.36 - . g495 Scaffold_21 AUGUSTUS transcript 485844 486521 0.36 - . g495.t1 Scaffold_21 AUGUSTUS stop_codon 485844 485846 . - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_21 AUGUSTUS CDS 485844 486521 0.36 - 0 transcript_id "g495.t1"; gene_id "g495"; Scaffold_21 AUGUSTUS start_codon 486519 486521 . - 0 transcript_id "g495.t1"; gene_id "g495"; # protein sequence = [MRHPENLVDLTNSIPLELFDGKPTSAGLITQTYTDQISFADGTIHKVEFLVTRLHPTAPIVLGLPWLRMHNPVIDWKE # LCLTFQDRNVRISAALASEIVQPGAEGGTEELGRGVNGEEIHAGTLQSPPEAPQRPPEAPQPPPEVPQQTPEAPLRAPRTRVKLEEVKDEEYEASQPG # PHKLFPSDKDLGPDDPILMGINEWLAFASESTEEEVEEILEAGRSAWRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g495 ### # start gene g496 Scaffold_21 AUGUSTUS gene 487783 488448 0.88 - . g496 Scaffold_21 AUGUSTUS transcript 487783 488448 0.88 - . g496.t1 Scaffold_21 AUGUSTUS stop_codon 487783 487785 . - 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_21 AUGUSTUS CDS 487783 488448 0.88 - 0 transcript_id "g496.t1"; gene_id "g496"; Scaffold_21 AUGUSTUS start_codon 488446 488448 . - 0 transcript_id "g496.t1"; gene_id "g496"; # protein sequence = [MGDQKEERTRWKTREEAKAVLTPLLPRVPPPHFSSQSRDRERPLSQGGQGQREQGGRSGGGAPPPPPPPPPPSGGPGD # SNSEGSNEGEQNQSSRNGGRREEDRGELPTGAPDVPPTRYDPDQPWYYDPRQGWHRKAAPRPPNEGRSTWESNEEKNRITIESKLDVGKIESFAGDDR # SAWKTWVLSLERMFGVRLPSMLGKRTSALPQLVISLVQHSPTSTR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g496 ### # start gene g497 Scaffold_21 AUGUSTUS gene 489448 491032 0.45 - . g497 Scaffold_21 AUGUSTUS transcript 489448 491032 0.45 - . g497.t1 Scaffold_21 AUGUSTUS stop_codon 489448 489450 . - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_21 AUGUSTUS CDS 489448 489563 0.68 - 2 transcript_id "g497.t1"; gene_id "g497"; Scaffold_21 AUGUSTUS CDS 489727 491032 0.47 - 0 transcript_id "g497.t1"; gene_id "g497"; Scaffold_21 AUGUSTUS start_codon 491030 491032 . - 0 transcript_id "g497.t1"; gene_id "g497"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTWGTRGPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGVLTLSQYDNRRNFQRGGYPLPY # PNNLGRHPGGYQHLQYSPLTFLPRDEEVPLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGSRILRPTSTVPNSGNSTGDRPPREGPAVADDPRESIRFSLAVQRPVGPREDVGTVRGRGTLRRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKINDEESNEDANAIAAKNRRRRRDPTPDATSGIRHSDAVGGTFWIESRKSFGIPSQT # GRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g497 ### # # ----- prediction on sequence number 11 (length = 176572, name = Scaffold_25) ----- # # Predicted genes for sequence number 11 on both strands # start gene g498 Scaffold_25 AUGUSTUS gene 39 694 0.48 - . g498 Scaffold_25 AUGUSTUS transcript 39 694 0.48 - . g498.t1 Scaffold_25 AUGUSTUS stop_codon 39 41 . - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_25 AUGUSTUS CDS 39 343 0.81 - 2 transcript_id "g498.t1"; gene_id "g498"; Scaffold_25 AUGUSTUS CDS 454 694 0.48 - 0 transcript_id "g498.t1"; gene_id "g498"; Scaffold_25 AUGUSTUS start_codon 692 694 . - 0 transcript_id "g498.t1"; gene_id "g498"; # protein sequence = [MDIDNMLLDIDAEVSTISNTNNKQIDINNNKISDNLIYQNGDSIYKIGPICQFVIDTAATVSVISDINYFYAKKPTKQ # TVRMNILSTTKLNSIAIFKANSVSLFRDTRCTIRGYKTNLYYTNTKILYPISNNPNNAINTIPNKLLLLDNNNNNNNNIGNNTDIKDWHNKLGHLGLS # HYPIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g498 ### # start gene g499 Scaffold_25 AUGUSTUS gene 2680 3180 0.87 - . g499 Scaffold_25 AUGUSTUS transcript 2680 3180 0.87 - . g499.t1 Scaffold_25 AUGUSTUS stop_codon 2680 2682 . - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_25 AUGUSTUS CDS 2680 3180 0.87 - 0 transcript_id "g499.t1"; gene_id "g499"; Scaffold_25 AUGUSTUS start_codon 3178 3180 . - 0 transcript_id "g499.t1"; gene_id "g499"; # protein sequence = [MSNPDSHHFDALANIWCYLLHHSNYGIIYNCSGDNLYIKGYCDADWGNDLNNRRSTTGYLFSLSNDLGITNPISWNSQ # LQTTVALSTCESEYMALKEATKEAIYLNNMLNYFNNILKLGYTTNSIPIILVDNESAKKLAENPEFHKRSKHIVLYYIIIPEMPYKTI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g499 ### # start gene g500 Scaffold_25 AUGUSTUS gene 3536 4276 0.99 - . g500 Scaffold_25 AUGUSTUS transcript 3536 4276 0.99 - . g500.t1 Scaffold_25 AUGUSTUS stop_codon 3536 3538 . - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_25 AUGUSTUS CDS 3536 4276 0.99 - 0 transcript_id "g500.t1"; gene_id "g500"; Scaffold_25 AUGUSTUS start_codon 4274 4276 . - 0 transcript_id "g500.t1"; gene_id "g500"; # protein sequence = [MKSPDWPYWEKACLEENTALVNQHTWDIVDIPSNIKPISGRWIFKMKPIIKRMNNNNNNKSYITNKNNTIRYKARWVI # QGFNQKLGIDFLETFSSTCRTETWHMLLLIAVNKGLYIWQYDVKNAFCHANIDTEIYTILPIGLYNNKQYNNKCAKLNKALYGLKQSPRLWNKYLKNI # LNALQFKVFIYDEGIYINSQDGCIIICHVDDILILHKDLVYIKELANQISNTFQLDEIGQITTFLGNDII] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g500 ### # start gene g501 Scaffold_25 AUGUSTUS gene 27481 28343 0.52 + . g501 Scaffold_25 AUGUSTUS transcript 27481 28343 0.52 + . g501.t1 Scaffold_25 AUGUSTUS start_codon 27481 27483 . + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_25 AUGUSTUS CDS 27481 27508 0.53 + 0 transcript_id "g501.t1"; gene_id "g501"; Scaffold_25 AUGUSTUS CDS 27559 28343 0.98 + 2 transcript_id "g501.t1"; gene_id "g501"; Scaffold_25 AUGUSTUS stop_codon 28341 28343 . + 0 transcript_id "g501.t1"; gene_id "g501"; # protein sequence = [MELSLDILKVSSVYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLN # SLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSIL # TVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLGHPSNIIHSQQRVPQLPNSKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g501 ### # start gene g502 Scaffold_25 AUGUSTUS gene 36781 38078 0.57 + . g502 Scaffold_25 AUGUSTUS transcript 36781 38078 0.57 + . g502.t1 Scaffold_25 AUGUSTUS start_codon 36781 36783 . + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_25 AUGUSTUS CDS 36781 36808 0.57 + 0 transcript_id "g502.t1"; gene_id "g502"; Scaffold_25 AUGUSTUS CDS 36859 38078 0.97 + 2 transcript_id "g502.t1"; gene_id "g502"; Scaffold_25 AUGUSTUS stop_codon 38076 38078 . + 0 transcript_id "g502.t1"; gene_id "g502"; # protein sequence = [MELSLDILKVSSVYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLN # SLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSIL # TVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSL # YSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNI # ISKVSILTVLTEHHQYSLYSLKHPSNIIHSQQRVPQLPNSKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g502 ### # start gene g503 Scaffold_25 AUGUSTUS gene 46509 47371 0.67 + . g503 Scaffold_25 AUGUSTUS transcript 46509 47371 0.67 + . g503.t1 Scaffold_25 AUGUSTUS start_codon 46509 46511 . + 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_25 AUGUSTUS CDS 46509 46536 0.67 + 0 transcript_id "g503.t1"; gene_id "g503"; Scaffold_25 AUGUSTUS CDS 46587 47371 0.99 + 2 transcript_id "g503.t1"; gene_id "g503"; Scaffold_25 AUGUSTUS stop_codon 47369 47371 . + 0 transcript_id "g503.t1"; gene_id "g503"; # protein sequence = [MELSLDILKVSSVYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLN # SLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSIL # TVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLGHPSNIIHSQQRVPQLPNSKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g503 ### # start gene g504 Scaffold_25 AUGUSTUS gene 55806 56668 0.66 + . g504 Scaffold_25 AUGUSTUS transcript 55806 56668 0.66 + . g504.t1 Scaffold_25 AUGUSTUS start_codon 55806 55808 . + 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_25 AUGUSTUS CDS 55806 55833 0.66 + 0 transcript_id "g504.t1"; gene_id "g504"; Scaffold_25 AUGUSTUS CDS 55884 56668 0.95 + 2 transcript_id "g504.t1"; gene_id "g504"; Scaffold_25 AUGUSTUS stop_codon 56666 56668 . + 0 transcript_id "g504.t1"; gene_id "g504"; # protein sequence = [MELSLDILKVSSVYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLN # SLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSIL # TVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLNSLNSLNIISKVSILTVLTEHHQYSLYSLGHPSNIIHSQQRVPQLPNSKSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g504 ### # start gene g505 Scaffold_25 AUGUSTUS gene 65136 66494 0.54 + . g505 Scaffold_25 AUGUSTUS transcript 65136 66494 0.54 + . g505.t1 Scaffold_25 AUGUSTUS start_codon 65136 65138 . + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_25 AUGUSTUS CDS 65136 66494 0.54 + 0 transcript_id "g505.t1"; gene_id "g505"; Scaffold_25 AUGUSTUS stop_codon 66492 66494 . + 0 transcript_id "g505.t1"; gene_id "g505"; # protein sequence = [MLKTVRKYNIGIEALKISPNTKGMMPIWHHIDAQSNMLWSKKAAKCLRRIHKVVTVDDLENVINNTHNYPNACESPNS # CESIANKLRDVLSEKFNPMNITPQKDNLDHTPNRLLNAKKRTREQEEDEVNDMGLDFNPDITEREHPLQMVRIFRKGPPLKKRRIDINYNREPPKYRD # PPHTPSKRKGEKVKIYTDGSSSNSGSLNSKNGAGLWISDNHKDNKSIKVGIKGAHNGTCELVGALYAVRIETPSGKIILSDSRLVVDGMTKWLKHWED # IAWLNVDNKELWMNIANDIRKQPYSTAFKWIKGHVGIHGNEEADKLADEGANKPGPADNLNLQQIHELKYVHKSARLQALTQKYAYELIRQWNTKKPR # NKKKELNIKTAQKAVKDYTSLKPREQDIWMGLQLKEIPNIISDFIWKKSTTGLNAETTLQTCHLLNGRRNSTANVERSKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g505 ### # start gene g506 Scaffold_25 AUGUSTUS gene 84378 84977 0.74 - . g506 Scaffold_25 AUGUSTUS transcript 84378 84977 0.74 - . g506.t1 Scaffold_25 AUGUSTUS stop_codon 84378 84380 . - 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_25 AUGUSTUS CDS 84378 84977 0.74 - 0 transcript_id "g506.t1"; gene_id "g506"; Scaffold_25 AUGUSTUS start_codon 84975 84977 . - 0 transcript_id "g506.t1"; gene_id "g506"; # protein sequence = [MKSDLARDFVVNLDELHVFLREEILLAQSRYKEQADRKRISHPEFPIGSEVFVLAKHIRSTRPTEKFSENILVLSRSS # VDLVLCLTSSKLPDYLRRIHLVFHVSQLEPVTPNPFPNRTQSPPPPIEVDGEEEYNVAEILDSKLDRRYKRCPLRYYIRWAGYEGTDDEFSWVAADEL # HADXSMTLHSRRLVHGPTRVTLL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g506 ### # start gene g507 Scaffold_25 AUGUSTUS gene 85958 86518 0.6 - . g507 Scaffold_25 AUGUSTUS transcript 85958 86518 0.6 - . g507.t1 Scaffold_25 AUGUSTUS stop_codon 85958 85960 . - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_25 AUGUSTUS CDS 85958 86518 0.6 - 0 transcript_id "g507.t1"; gene_id "g507"; Scaffold_25 AUGUSTUS start_codon 86516 86518 . - 0 transcript_id "g507.t1"; gene_id "g507"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFWKARFYEPRLSWISKPYTKLS # FALPADPSSVAGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSATSMIIHFPAISARTALSKLYVVNTPGPRSETLFVTTLPLALSVVAI # SPAVIGLTAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g507 ### # start gene g508 Scaffold_25 AUGUSTUS gene 87237 88400 0.39 - . g508 Scaffold_25 AUGUSTUS transcript 87237 88400 0.39 - . g508.t1 Scaffold_25 AUGUSTUS stop_codon 87237 87239 . - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_25 AUGUSTUS CDS 87237 87886 0.58 - 2 transcript_id "g508.t1"; gene_id "g508"; Scaffold_25 AUGUSTUS CDS 88148 88400 0.39 - 0 transcript_id "g508.t1"; gene_id "g508"; Scaffold_25 AUGUSTUS start_codon 88398 88400 . - 0 transcript_id "g508.t1"; gene_id "g508"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPVVAKVAV # PLPELRQVAARAADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPS # SSPHGAPVLFVPKKDGKLRLCVDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLSESLKVTNGRPPFGPATALTNGRSCRSALRTPL # RLSSGLLMTSSLTCSMSVSSSILTIF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g508 ### # start gene g509 Scaffold_25 AUGUSTUS gene 91072 91341 0.96 + . g509 Scaffold_25 AUGUSTUS transcript 91072 91341 0.96 + . g509.t1 Scaffold_25 AUGUSTUS start_codon 91072 91074 . + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_25 AUGUSTUS CDS 91072 91341 0.96 + 0 transcript_id "g509.t1"; gene_id "g509"; Scaffold_25 AUGUSTUS stop_codon 91339 91341 . + 0 transcript_id "g509.t1"; gene_id "g509"; # protein sequence = [MPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEELSDRLGNLEAHREDDVC # VFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g509 ### # start gene g510 Scaffold_25 AUGUSTUS gene 91465 91833 0.97 + . g510 Scaffold_25 AUGUSTUS transcript 91465 91833 0.97 + . g510.t1 Scaffold_25 AUGUSTUS start_codon 91465 91467 . + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_25 AUGUSTUS CDS 91465 91833 0.97 + 0 transcript_id "g510.t1"; gene_id "g510"; Scaffold_25 AUGUSTUS stop_codon 91831 91833 . + 0 transcript_id "g510.t1"; gene_id "g510"; # protein sequence = [MGYIPKKPGLIPGKLVETTNGNQKTVRFEAPKSINRPLKKPSVTIEDVDESDDEDAIKLIPSSRPTNQINSEHRPYDH # VQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKLGMKSRDQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g510 ### # start gene g511 Scaffold_25 AUGUSTUS gene 92891 93674 0.36 + . g511 Scaffold_25 AUGUSTUS transcript 92891 93674 0.36 + . g511.t1 Scaffold_25 AUGUSTUS start_codon 92891 92893 . + 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_25 AUGUSTUS CDS 92891 93042 0.47 + 0 transcript_id "g511.t1"; gene_id "g511"; Scaffold_25 AUGUSTUS CDS 93197 93674 0.68 + 1 transcript_id "g511.t1"; gene_id "g511"; Scaffold_25 AUGUSTUS stop_codon 93672 93674 . + 0 transcript_id "g511.t1"; gene_id "g511"; # protein sequence = [MFSKKELSEAYVLASREHLKSQDDQAEEIINCYLNQKTIGINKYSVYGEMVLGENCDKSESTETTQNQCNNENTSETI # RDDNWNKPKNFQRTRKRMVRYEVLKRGTESFQRSQPSFEKVRYESRQRKKGKAQDLKDKKENVQPGLVNEPPTNKLEERIKLNQQDRSPINLIDETNK # QVVNEAIGVEKPINLNTERCLRSINQLTRRLTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g511 ### # start gene g512 Scaffold_25 AUGUSTUS gene 94666 95082 0.55 + . g512 Scaffold_25 AUGUSTUS transcript 94666 95082 0.55 + . g512.t1 Scaffold_25 AUGUSTUS start_codon 94666 94668 . + 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_25 AUGUSTUS CDS 94666 95082 0.55 + 0 transcript_id "g512.t1"; gene_id "g512"; Scaffold_25 AUGUSTUS stop_codon 95080 95082 . + 0 transcript_id "g512.t1"; gene_id "g512"; # protein sequence = [MPEEHIAQVVLEWPSCRDKTEVRAFLGTASQLRMFIVNFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRESPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPSEKKKFFNYFGSMTLNEREARFSQSKKNCMA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g512 ### # start gene g513 Scaffold_25 AUGUSTUS gene 95165 96400 0.55 + . g513 Scaffold_25 AUGUSTUS transcript 95165 96400 0.55 + . g513.t1 Scaffold_25 AUGUSTUS start_codon 95165 95167 . + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_25 AUGUSTUS CDS 95165 96400 0.55 + 0 transcript_id "g513.t1"; gene_id "g513"; Scaffold_25 AUGUSTUS stop_codon 96398 96400 . + 0 transcript_id "g513.t1"; gene_id "g513"; # protein sequence = [MLDNPNCGPNATINRWIEHVRNYHFTLIHVKGATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGET # EEPYQFDDFKDQIDPRSSYLYETAQEADDIELDVQEALDEERSYEIRRNYMLESKNATCEVFSRNLFPTFDEEFVQNNLYPETHRSSEGNRLDGLIPL # IGDYLSNPTDESLGEMSKEERIKFIRLIKKFQGDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFATNDFLQKRFWWPDIYKDVEWY # VRSCQECQNRQMKLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGCPEEVVTDNAGQM # KNMLAWLEEKYGIKGKEFPPTTLKLMARLKERIWTYARP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g513 ### # start gene g514 Scaffold_25 AUGUSTUS gene 96448 96834 0.6 + . g514 Scaffold_25 AUGUSTUS transcript 96448 96834 0.6 + . g514.t1 Scaffold_25 AUGUSTUS start_codon 96448 96450 . + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_25 AUGUSTUS CDS 96448 96834 0.6 + 0 transcript_id "g514.t1"; gene_id "g514"; Scaffold_25 AUGUSTUS stop_codon 96832 96834 . + 0 transcript_id "g514.t1"; gene_id "g514"; # protein sequence = [MILWADRVTPRRGLGCSPYFLVTGAEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANK # VAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIERVWIERCIQDIEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g514 ### # start gene g515 Scaffold_25 AUGUSTUS gene 98750 99916 0.88 + . g515 Scaffold_25 AUGUSTUS transcript 98750 99916 0.88 + . g515.t1 Scaffold_25 AUGUSTUS start_codon 98750 98752 . + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_25 AUGUSTUS CDS 98750 99916 0.88 + 0 transcript_id "g515.t1"; gene_id "g515"; Scaffold_25 AUGUSTUS stop_codon 99914 99916 . + 0 transcript_id "g515.t1"; gene_id "g515"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g515 ### # start gene g516 Scaffold_25 AUGUSTUS gene 104126 105495 0.05 - . g516 Scaffold_25 AUGUSTUS transcript 104126 105495 0.05 - . g516.t1 Scaffold_25 AUGUSTUS stop_codon 104126 104128 . - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_25 AUGUSTUS CDS 104126 104657 0.57 - 1 transcript_id "g516.t1"; gene_id "g516"; Scaffold_25 AUGUSTUS CDS 104797 104819 0.39 - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_25 AUGUSTUS CDS 104895 105062 0.32 - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_25 AUGUSTUS CDS 105328 105495 0.85 - 0 transcript_id "g516.t1"; gene_id "g516"; Scaffold_25 AUGUSTUS start_codon 105493 105495 . - 0 transcript_id "g516.t1"; gene_id "g516"; # protein sequence = [MPVHHKKDLDVAQVAEPHLGALQQLLASYKGKKTNNPDKATISVLRRSTEYLHDLLSFQNTFVRNRLLDCARSVHSDH # EASTRSDNSCFVKKSKKKTTRFASSRDVKCEPRSMNSASEDDGSNKGSNKDEKSAVNDGSPFSARFIATLTVMFLLTVCRVSLKIKVIQFKFKSVLNG # FLFCVLVTHSKHINHALAQVVSSNLDTPPAPLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSGSDLLLLTQVSLL # LRVFLSRSGRGGVTNGAGKRSD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g516 ### # start gene g517 Scaffold_25 AUGUSTUS gene 106491 106835 0.73 - . g517 Scaffold_25 AUGUSTUS transcript 106491 106835 0.73 - . g517.t1 Scaffold_25 AUGUSTUS stop_codon 106491 106493 . - 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_25 AUGUSTUS CDS 106491 106835 0.73 - 0 transcript_id "g517.t1"; gene_id "g517"; Scaffold_25 AUGUSTUS start_codon 106833 106835 . - 0 transcript_id "g517.t1"; gene_id "g517"; # protein sequence = [MATLFRWPSPFNLSGLDFNNRTPGEWIELLRSIHSGESTASIDKHGHLVKSSPPPDSAAEALEGLNDVEKGLADEDTS # SQVGGSVPMELDLPTIESLAERTLSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g517 ### # start gene g518 Scaffold_25 AUGUSTUS gene 113214 113687 0.88 - . g518 Scaffold_25 AUGUSTUS transcript 113214 113687 0.88 - . g518.t1 Scaffold_25 AUGUSTUS stop_codon 113214 113216 . - 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_25 AUGUSTUS CDS 113214 113687 0.88 - 0 transcript_id "g518.t1"; gene_id "g518"; Scaffold_25 AUGUSTUS start_codon 113685 113687 . - 0 transcript_id "g518.t1"; gene_id "g518"; # protein sequence = [MEERSSSTSSMNKPEVFKGKDSAEARRFMAQFQNWASEQPDLTKSQAKLIKSALGFFTESAGDWATPHLLHFNAEHPP # FGGNWEEFLKEFGQHFESVDPGRKLAARSKISNKVKVRQPRNLPQKFKDIGDRTGMSDIDYENASSLPYFRRSDKISSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g518 ### # start gene g519 Scaffold_25 AUGUSTUS gene 115825 116037 0.64 + . g519 Scaffold_25 AUGUSTUS transcript 115825 116037 0.64 + . g519.t1 Scaffold_25 AUGUSTUS start_codon 115825 115827 . + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_25 AUGUSTUS CDS 115825 116037 0.64 + 0 transcript_id "g519.t1"; gene_id "g519"; Scaffold_25 AUGUSTUS stop_codon 116035 116037 . + 0 transcript_id "g519.t1"; gene_id "g519"; # protein sequence = [MAEGVGLEALESSTTLTVVLDLGSFLLTETLVEEAQEAEPADGNSLKSSLSESLERVERGGETEKTKRTK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g519 ### # start gene g520 Scaffold_25 AUGUSTUS gene 121053 121733 0.86 - . g520 Scaffold_25 AUGUSTUS transcript 121053 121733 0.86 - . g520.t1 Scaffold_25 AUGUSTUS stop_codon 121053 121055 . - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_25 AUGUSTUS CDS 121053 121733 0.86 - 0 transcript_id "g520.t1"; gene_id "g520"; Scaffold_25 AUGUSTUS start_codon 121731 121733 . - 0 transcript_id "g520.t1"; gene_id "g520"; # protein sequence = [MEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVKLIKSALGFFTESAGDWATPHLLHFNAENPP # FGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLITVNIAQGIAPTLKEAIKRAI # SVDVYLHDPTMTGRNSGYPPTHTAHTTLLTPTLWTLMQPTPVMGILGKHS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g520 ### # start gene g521 Scaffold_25 AUGUSTUS gene 125539 126021 0.8 + . g521 Scaffold_25 AUGUSTUS transcript 125539 126021 0.8 + . g521.t1 Scaffold_25 AUGUSTUS start_codon 125539 125541 . + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_25 AUGUSTUS CDS 125539 126021 0.8 + 0 transcript_id "g521.t1"; gene_id "g521"; Scaffold_25 AUGUSTUS stop_codon 126019 126021 . + 0 transcript_id "g521.t1"; gene_id "g521"; # protein sequence = [MDFIEQLPMSNGFTAILVVVDRSSKQAIFIPTYNTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYYPXKLVTEHVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPKYHCSGPRST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g521 ### # start gene g522 Scaffold_25 AUGUSTUS gene 131861 132322 0.96 - . g522 Scaffold_25 AUGUSTUS transcript 131861 132322 0.96 - . g522.t1 Scaffold_25 AUGUSTUS stop_codon 131861 131863 . - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_25 AUGUSTUS CDS 131861 132196 0.97 - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_25 AUGUSTUS CDS 132293 132322 0.96 - 0 transcript_id "g522.t1"; gene_id "g522"; Scaffold_25 AUGUSTUS start_codon 132320 132322 . - 0 transcript_id "g522.t1"; gene_id "g522"; # protein sequence = [MHLTFPYFVFPRVAGPPQRTEPKFHLKFIEPSVGSLKPEELIRDRIRAAIKTAPNYGSIFEYVVYDNQCNIEDPRFAG # EITVKFWTNVKDATDGCTEKSPCTGKVVQNGDSNSLIRVVEGQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g522 ### # start gene g523 Scaffold_25 AUGUSTUS gene 144301 145002 0.94 + . g523 Scaffold_25 AUGUSTUS transcript 144301 145002 0.94 + . g523.t1 Scaffold_25 AUGUSTUS start_codon 144301 144303 . + 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_25 AUGUSTUS CDS 144301 144357 0.95 + 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_25 AUGUSTUS CDS 144499 145002 0.97 + 0 transcript_id "g523.t1"; gene_id "g523"; Scaffold_25 AUGUSTUS stop_codon 145000 145002 . + 0 transcript_id "g523.t1"; gene_id "g523"; # protein sequence = [MVRYEILKEELNHFKGLNRQDRSPINLIDETNKHVDNEAIGVEKPINLNTEEVFTKYKPVDKKVNPIKERYQMNFELK # DTFMVHPLLELPELSKHPKPFAPTGRYTEERKEIIDKNHPEGFLWERERDLMHEMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPI # PPGIFEDVCK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g523 ### # start gene g524 Scaffold_25 AUGUSTUS gene 148068 148923 0.59 - . g524 Scaffold_25 AUGUSTUS transcript 148068 148923 0.59 - . g524.t1 Scaffold_25 AUGUSTUS stop_codon 148068 148070 . - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_25 AUGUSTUS CDS 148068 148239 0.66 - 1 transcript_id "g524.t1"; gene_id "g524"; Scaffold_25 AUGUSTUS CDS 148313 148923 0.7 - 0 transcript_id "g524.t1"; gene_id "g524"; Scaffold_25 AUGUSTUS start_codon 148921 148923 . - 0 transcript_id "g524.t1"; gene_id "g524"; # protein sequence = [MDFIEQLPMSNGYTAILVVVDRSSKQAIFIPTHDTITSEQLAELFVIHVFSKHGVPNHVTSDRGSEFVSAFFRALGKA # LSMELHYTSGYHPEADGQTERVNQTLEQYIRIYCSYQQDDWSPLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEVDMKSDLARDFVVNLDEL # HVFLREEILLAQSRYKEQADRKRISHPEKISWSFQGHQSTWYFVLRAQAPRLSSPNSPGFPRLTAGAGYAESFPESYSISSTSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g524 ### # start gene g525 Scaffold_25 AUGUSTUS gene 149126 149527 0.67 - . g525 Scaffold_25 AUGUSTUS transcript 149126 149527 0.67 - . g525.t1 Scaffold_25 AUGUSTUS stop_codon 149126 149128 . - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_25 AUGUSTUS CDS 149126 149527 0.67 - 0 transcript_id "g525.t1"; gene_id "g525"; Scaffold_25 AUGUSTUS start_codon 149525 149527 . - 0 transcript_id "g525.t1"; gene_id "g525"; # protein sequence = [MVIRFRPGKLGEKPDSITRRWDVYPKEGDIGYAQVNPHNFRPIFTNEQLTASLRATFLEGPVLRASIIMDIEALHQAI # ILALPADPSSVVGLELAKDPSNERWSLGSDKLLRLDDRIYVLITAIFAFKSSLFP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g525 ### # start gene g526 Scaffold_25 AUGUSTUS gene 150677 151408 0.8 - . g526 Scaffold_25 AUGUSTUS transcript 150677 151408 0.8 - . g526.t1 Scaffold_25 AUGUSTUS stop_codon 150677 150679 . - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_25 AUGUSTUS CDS 150677 151408 0.8 - 0 transcript_id "g526.t1"; gene_id "g526"; Scaffold_25 AUGUSTUS start_codon 151406 151408 . - 0 transcript_id "g526.t1"; gene_id "g526"; # protein sequence = [MANIAVRFPSGELLLLPFYVTHLDSSCKAVLGYSFLSRYNPLIDWASRNITFRNTSHLDSPQTSVPSAINPLLQRSLF # RYRNFRRRFHRQFWRPLLGTHSLSLSLPLSDFTGQAPFVQIPFEPIYSYPTVSQFAAQLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAAR # AADRSSTTPTVPPLHPSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEALRRLSAVFTLCLKRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g526 ### # start gene g527 Scaffold_25 AUGUSTUS gene 151888 152256 0.83 - . g527 Scaffold_25 AUGUSTUS transcript 151888 152256 0.83 - . g527.t1 Scaffold_25 AUGUSTUS stop_codon 151888 151890 . - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_25 AUGUSTUS CDS 151888 152256 0.83 - 0 transcript_id "g527.t1"; gene_id "g527"; Scaffold_25 AUGUSTUS start_codon 152254 152256 . - 0 transcript_id "g527.t1"; gene_id "g527"; # protein sequence = [MARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFVARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPF # SGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKSFPPRRKEG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g527 ### # start gene g528 Scaffold_25 AUGUSTUS gene 154118 154513 0.71 + . g528 Scaffold_25 AUGUSTUS transcript 154118 154513 0.71 + . g528.t1 Scaffold_25 AUGUSTUS start_codon 154118 154120 . + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_25 AUGUSTUS CDS 154118 154513 0.71 + 0 transcript_id "g528.t1"; gene_id "g528"; Scaffold_25 AUGUSTUS stop_codon 154511 154513 . + 0 transcript_id "g528.t1"; gene_id "g528"; # protein sequence = [MPEEHIAQVVLEWPSCHDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPAL # RPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNEREARFSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g528 ### # start gene g529 Scaffold_25 AUGUSTUS gene 154834 156434 0.55 + . g529 Scaffold_25 AUGUSTUS transcript 154834 156434 0.55 + . g529.t1 Scaffold_25 AUGUSTUS start_codon 154834 154836 . + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_25 AUGUSTUS CDS 154834 155003 0.58 + 0 transcript_id "g529.t1"; gene_id "g529"; Scaffold_25 AUGUSTUS CDS 155042 156434 0.81 + 1 transcript_id "g529.t1"; gene_id "g529"; Scaffold_25 AUGUSTUS stop_codon 156432 156434 . + 0 transcript_id "g529.t1"; gene_id "g529"; # protein sequence = [MGDGETEEPYQFDNFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMNLFPTFDEEFVQNNPYPEAHR # SSEGNRLDELIPLIEKYLSNPSDESLGEMSKDERIKFIRLIKKFQVDDQGRLYHRNTDQPDQPQLVVEKEKRMHMLNSAHDCLGHKGVFANDFLQKRF # WWPDIYKDVEWYVRSCKECQNRQMRLLKAPPTLMHTPSLFQKVHVDTMIMSIPSNGCKYIIHGRDSLSSWSEARAVKHENARTLGEWFFDDIICRWGC # PEEVVTDNAGQMKNMLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTGAEPLLP # FDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYPRYRGPMV # VIRRLRVALISLLKWMEQYSKRRSEPSEYCRISREMNQLNCQTIFTNLST] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g529 ### # start gene g530 Scaffold_25 AUGUSTUS gene 156838 157510 0.75 - . g530 Scaffold_25 AUGUSTUS transcript 156838 157510 0.75 - . g530.t1 Scaffold_25 AUGUSTUS stop_codon 156838 156840 . - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_25 AUGUSTUS CDS 156838 157032 0.8 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_25 AUGUSTUS CDS 157112 157263 0.85 - 2 transcript_id "g530.t1"; gene_id "g530"; Scaffold_25 AUGUSTUS CDS 157345 157510 0.86 - 0 transcript_id "g530.t1"; gene_id "g530"; Scaffold_25 AUGUSTUS start_codon 157508 157510 . - 0 transcript_id "g530.t1"; gene_id "g530"; # protein sequence = [MFCIHDSFHVVESSQHSLSHWSNKGSNKDEKSAVNEVSPRLSKVHCHTDSHVSSNLTHSKHINHALAQVVSSNLDTPP # APLESQSTKFIAATLNFQAAEFEFNANLIWLRLFCSDASFATAQSIPTTGSEDTVVTPTEIAVPVPKTVERATTPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g530 ### # start gene g531 Scaffold_25 AUGUSTUS gene 159253 159597 0.79 - . g531 Scaffold_25 AUGUSTUS transcript 159253 159597 0.79 - . g531.t1 Scaffold_25 AUGUSTUS stop_codon 159253 159255 . - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_25 AUGUSTUS CDS 159253 159597 0.79 - 0 transcript_id "g531.t1"; gene_id "g531"; Scaffold_25 AUGUSTUS start_codon 159595 159597 . - 0 transcript_id "g531.t1"; gene_id "g531"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIELLRSIQSGESTVHIDEHGHLVEASPPPDSATEALEGLKEVERGSADEGTS # SPVGGSVPMELDLPTIESLAERALSPEKGAESAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g531 ### # start gene g532 Scaffold_25 AUGUSTUS gene 160508 161212 0.56 - . g532 Scaffold_25 AUGUSTUS transcript 160508 161212 0.56 - . g532.t1 Scaffold_25 AUGUSTUS stop_codon 160508 160510 . - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_25 AUGUSTUS CDS 160508 160944 0.91 - 2 transcript_id "g532.t1"; gene_id "g532"; Scaffold_25 AUGUSTUS CDS 161005 161212 0.56 - 0 transcript_id "g532.t1"; gene_id "g532"; Scaffold_25 AUGUSTUS start_codon 161210 161212 . - 0 transcript_id "g532.t1"; gene_id "g532"; # protein sequence = [MMRLAPSKELDVFAPLRGKGSPGASKAVSPPKVSDVISPPPVTKAQAVPPRALRRNREIESLKADASSFLASPRSTHS # KDSDNELLSGFPLVDEAPRASSSAKVSVGRKEPKSKTTVKVVEDPKADHPPLAGMAYKRVRLPPRSRKNTSIASKGKARQIVVTDEDSTSNEVESEDE # DEDEDTAPPPKRLKTTSSISGKIFILHFLSHFINSIRL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g532 ### # start gene g533 Scaffold_25 AUGUSTUS gene 163942 164933 0.58 - . g533 Scaffold_25 AUGUSTUS transcript 163942 164933 0.58 - . g533.t1 Scaffold_25 AUGUSTUS stop_codon 163942 163944 . - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_25 AUGUSTUS CDS 163942 164386 0.58 - 1 transcript_id "g533.t1"; gene_id "g533"; Scaffold_25 AUGUSTUS CDS 164473 164933 1 - 0 transcript_id "g533.t1"; gene_id "g533"; Scaffold_25 AUGUSTUS start_codon 164931 164933 . - 0 transcript_id "g533.t1"; gene_id "g533"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSESISAIGQPRRRNRGFGPATVPTTSTLPEAMEEDQQFEYSTLYTGDRQP # VQVLTPRRGQPPVVAPARGQSTTRIESPILQAIARRTGKQPQRRAASESPLDPPPHFDLDTGDHDDQDPPANFAFAAKIYTKLDLAHAYHLVRITEGD # EWKTTFRTRYGSYEWKVMPFGLTNAPAAFQRFVNDIFSDMLDVCVIVYLDDILIYSDTPEEHREHVKEVLRRLRKHRLYANPDKCEFNMDTVEYLGYI # LSPDNELASFLCERERKESNGHSNQPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g533 ### # start gene g534 Scaffold_25 AUGUSTUS gene 168157 168864 0.96 + . g534 Scaffold_25 AUGUSTUS transcript 168157 168864 0.96 + . g534.t1 Scaffold_25 AUGUSTUS start_codon 168157 168159 . + 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_25 AUGUSTUS CDS 168157 168864 0.96 + 0 transcript_id "g534.t1"; gene_id "g534"; Scaffold_25 AUGUSTUS stop_codon 168862 168864 . + 0 transcript_id "g534.t1"; gene_id "g534"; # protein sequence = [MHNPVIDWKELCLTFQDQNIRISAALALEIGQPGAEGGTEELGKGVNGEEIHEGTLQPPPEAPQQPPEAPQSPPEVPQ # QSPEAPLRAPRTGVKLEEVKDEEYEARQPGPHELFPSDRNLGPDDPILMGINEWLAFASESREEEVEEILEAGRSAMEKVTPQPVKDSEEAYQKWKSK # DTNRSSSWPGAKQKVQWRKKRREHGPYPDLPTLDIESLNIPKIPSRSGLTPKGSIGVFN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g534 ### # start gene g535 Scaffold_25 AUGUSTUS gene 170508 170882 0.55 - . g535 Scaffold_25 AUGUSTUS transcript 170508 170882 0.55 - . g535.t1 Scaffold_25 AUGUSTUS stop_codon 170508 170510 . - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_25 AUGUSTUS CDS 170508 170882 0.55 - 0 transcript_id "g535.t1"; gene_id "g535"; Scaffold_25 AUGUSTUS start_codon 170880 170882 . - 0 transcript_id "g535.t1"; gene_id "g535"; # protein sequence = [MREFNVRLSSERIKVEHAFGKLKGRFLSLKEMGWHKNLQEMYKVIEALLILHNMCIDYGDIPEHILDFDPSDNTIPVE # VAAGDIHFGLVDVTQEANIPQYETDQWIKEEGRRKRDLIFNDLFPI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g535 ### # start gene g536 Scaffold_25 AUGUSTUS gene 174081 174969 0.39 - . g536 Scaffold_25 AUGUSTUS transcript 174081 174969 0.39 - . g536.t1 Scaffold_25 AUGUSTUS stop_codon 174081 174083 . - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_25 AUGUSTUS CDS 174081 174273 0.93 - 1 transcript_id "g536.t1"; gene_id "g536"; Scaffold_25 AUGUSTUS CDS 174371 174969 0.39 - 0 transcript_id "g536.t1"; gene_id "g536"; Scaffold_25 AUGUSTUS start_codon 174967 174969 . - 0 transcript_id "g536.t1"; gene_id "g536"; # protein sequence = [MSTIKEVVSKCDALVTIDYLSPLPVILAVDSSYIACGIILSQDNKDGRRRPSRFWSIAWNEREARYSQAKIELYGLFR # AFHAMKVYLIGVQKLIVEMDASYVKGMINDPDMHPNAAVNRWIAAIQLFDFDLKHIPGKEFVGPDGISRRRRTVDEGDELEGAAEEWVDEILSAGVWI # AGAWDKEDKFGGIVEYRGTGTSSATTSQPSQRHPRFPHCNSSNSFNEPRDILSKQIVYGDENTPADINLSFFPFLIDFPSYNKLTTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g536 ### # start gene g537 Scaffold_25 AUGUSTUS gene 175492 176139 0.99 - . g537 Scaffold_25 AUGUSTUS transcript 175492 176139 0.99 - . g537.t1 Scaffold_25 AUGUSTUS stop_codon 175492 175494 . - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_25 AUGUSTUS CDS 175492 176139 0.99 - 0 transcript_id "g537.t1"; gene_id "g537"; Scaffold_25 AUGUSTUS start_codon 176137 176139 . - 0 transcript_id "g537.t1"; gene_id "g537"; # protein sequence = [MPDYAKVIQRFPENPLLSLPTLSPNPTQFTPGVRPTEDRLDGLGVLTNKFLWPEERLLMADVLKKNELGIAWDETEKG # RFREDYFPPLKIPTIAHTPWAEKTLPIPPGIRDKVIQLVREKVASGLYEPSNSSYRSQWFVVAKSDGGLHIVHNLKKLNAITVRDSGQPPILHLFLEQ # CGGRGIYSGIDVIAGFDHGTLHEDSRDPQPLIPPLERSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g537 ### # # ----- prediction on sequence number 12 (length = 586226, name = Scaffold_19) ----- # # Predicted genes for sequence number 12 on both strands # start gene g538 Scaffold_19 AUGUSTUS gene 6765 7798 0.63 + . g538 Scaffold_19 AUGUSTUS transcript 6765 7798 0.63 + . g538.t1 Scaffold_19 AUGUSTUS start_codon 6765 6767 . + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_19 AUGUSTUS CDS 6765 7267 0.94 + 0 transcript_id "g538.t1"; gene_id "g538"; Scaffold_19 AUGUSTUS CDS 7357 7798 0.63 + 1 transcript_id "g538.t1"; gene_id "g538"; Scaffold_19 AUGUSTUS stop_codon 7796 7798 . + 0 transcript_id "g538.t1"; gene_id "g538"; # protein sequence = [MIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQL # VHQFNPIDAGEQEKMRIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAENRGHINLPF # AADVPKTDRNYLQALKPKVEDEFKDLLGIKLESLIPRELTEEQQQMVALNKDLMEANMKEIRAVKSLQSHFKEGADIMTQLTAVMAQMAKENAKGMIN # SIPPSGPSNQSNRFERNTTPKFEWNSVGMFLVQVDRSFYE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g538 ### # start gene g539 Scaffold_19 AUGUSTUS gene 7839 8096 0.32 + . g539 Scaffold_19 AUGUSTUS transcript 7839 8096 0.32 + . g539.t1 Scaffold_19 AUGUSTUS start_codon 7839 7841 . + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_19 AUGUSTUS CDS 7839 8096 0.32 + 0 transcript_id "g539.t1"; gene_id "g539"; Scaffold_19 AUGUSTUS stop_codon 8094 8096 . + 0 transcript_id "g539.t1"; gene_id "g539"; # protein sequence = [MPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNPNVNLAVWMTRIEN # YQIDLGI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g539 ### # start gene g540 Scaffold_19 AUGUSTUS gene 8167 10231 0.27 + . g540 Scaffold_19 AUGUSTUS transcript 8167 10231 0.27 + . g540.t1 Scaffold_19 AUGUSTUS start_codon 8167 8169 . + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_19 AUGUSTUS CDS 8167 9342 0.35 + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_19 AUGUSTUS CDS 9677 10231 0.64 + 0 transcript_id "g540.t1"; gene_id "g540"; Scaffold_19 AUGUSTUS stop_codon 10229 10231 . + 0 transcript_id "g540.t1"; gene_id "g540"; # protein sequence = [MKEQDRSMRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLK # KPSVTIEDVNESDDEDAIKLIPSSRPTNQINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVD # LSTEELAALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEDLWQDQTDMFEVLTESRNDIPVGSIVQKDIVESF # LRDLSIDDERRNIAIVANQSVAYEDHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTL # GLARNIPFKFGEVTVYLQLHQNIVLDGYKRCEQETFSKKELSEAYVLASREHLKSQDEQAEEIIDCYLNQKTIGDKQVFCVWRDGVLGEFDDQLNNDQ # FNLNPIKSFFLQNGRIKPKPVRKKVQKRRFVEPILQNFSLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMFDMKYSKEELNHSK # DLNRVLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g540 ### # start gene g541 Scaffold_19 AUGUSTUS gene 10690 12673 0.15 + . g541 Scaffold_19 AUGUSTUS transcript 10690 12673 0.15 + . g541.t1 Scaffold_19 AUGUSTUS start_codon 10690 10692 . + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_19 AUGUSTUS CDS 10690 11947 0.23 + 0 transcript_id "g541.t1"; gene_id "g541"; Scaffold_19 AUGUSTUS CDS 12085 12421 0.89 + 2 transcript_id "g541.t1"; gene_id "g541"; Scaffold_19 AUGUSTUS CDS 12478 12673 0.34 + 1 transcript_id "g541.t1"; gene_id "g541"; Scaffold_19 AUGUSTUS stop_codon 12671 12673 . + 0 transcript_id "g541.t1"; gene_id "g541"; # protein sequence = [MMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFC # VIKKDGKSLRLVHSLEPLNKVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTY # ILRDEIPHVTIPYIDDVPVKGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGSMPEEHIA # QVVLEWPPCRDKTEVRAFLGTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQI # DPTEKKKFFNYFGSMTLNEREARFSQSKRELYGLKLALEASYYHVYGCATHGPDGLSRITPGGWQTKRPEVNPEDYVDEDGGEPINFIMGDGETEEPY # QFDDFKDQIDPRSGYLYETAQEADDIELDVQEALDEERSYEIRRNHMLESKDATCEVFSRNLSSEGNRLDELIPLIGKYLSNPSDESLSEMSKDERIK # FIRLIKKFQVDDQGRLYHRILINLINHN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g541 ### # start gene g542 Scaffold_19 AUGUSTUS gene 13110 13658 0.25 + . g542 Scaffold_19 AUGUSTUS transcript 13110 13658 0.25 + . g542.t1 Scaffold_19 AUGUSTUS start_codon 13110 13112 . + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_19 AUGUSTUS CDS 13110 13658 0.25 + 0 transcript_id "g542.t1"; gene_id "g542"; Scaffold_19 AUGUSTUS stop_codon 13656 13658 . + 0 transcript_id "g542.t1"; gene_id "g542"; # protein sequence = [MLAWLEEKYGIKGIRISAYNSQANGKIERAHLDIRQALIKATGGDVSKWFYFLKMILWADRVTPRRGLGCSPYFLVTG # AEPLLPFDIVESTWLVNPPNRILTRDELIGYRAQALSKHNSFIEKVRRRVDANKVAELRRFERKYRHTIKDWDFKPGQLVQVRNSGIEKSLDRKMYQD # IEDLWS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g542 ### # start gene g543 Scaffold_19 AUGUSTUS gene 13697 13954 0.71 + . g543 Scaffold_19 AUGUSTUS transcript 13697 13954 0.71 + . g543.t1 Scaffold_19 AUGUSTUS start_codon 13697 13699 . + 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_19 AUGUSTUS CDS 13697 13954 0.71 + 0 transcript_id "g543.t1"; gene_id "g543"; Scaffold_19 AUGUSTUS stop_codon 13952 13954 . + 0 transcript_id "g543.t1"; gene_id "g543"; # protein sequence = [MDGTILKEKVGAFRVLPHFTRNEPIELPNNIHELIDLTAEQLDLMVEDEDEYWMTPENDYIFDAIPRLRLSDTDSDEE # LSEGEDQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g543 ### # start gene g544 Scaffold_19 AUGUSTUS gene 14220 14994 0.52 - . g544 Scaffold_19 AUGUSTUS transcript 14220 14994 0.52 - . g544.t1 Scaffold_19 AUGUSTUS stop_codon 14220 14222 . - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_19 AUGUSTUS CDS 14220 14644 1 - 2 transcript_id "g544.t1"; gene_id "g544"; Scaffold_19 AUGUSTUS CDS 14726 14861 0.63 - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_19 AUGUSTUS CDS 14968 14994 0.53 - 0 transcript_id "g544.t1"; gene_id "g544"; Scaffold_19 AUGUSTUS start_codon 14992 14994 . - 0 transcript_id "g544.t1"; gene_id "g544"; # protein sequence = [MNSASEDELNRRSTPYPTTGSNKGSNKEEKSAVNDVPPRLSKVHCHADSHVSSNLTHSKHINHALAQVVSSNLDTPPA # PLESQSTKFIAATLNFQAAEFEFNANLVKTYATRARIAKVIADEACSILKSRQDSQTLTASDASFATAQSIPTTGSEDTIVTPTEIAVPVPKTVERAT # TPFTRGVTPMMEDKGHVSA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g544 ### # start gene g545 Scaffold_19 AUGUSTUS gene 16697 17041 0.33 - . g545 Scaffold_19 AUGUSTUS transcript 16697 17041 0.33 - . g545.t1 Scaffold_19 AUGUSTUS stop_codon 16697 16699 . - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_19 AUGUSTUS CDS 16697 17041 0.33 - 0 transcript_id "g545.t1"; gene_id "g545"; Scaffold_19 AUGUSTUS start_codon 17039 17041 . - 0 transcript_id "g545.t1"; gene_id "g545"; # protein sequence = [MATLFRWPSPFNLSGLDFDNRTPGEWIDLLRSIHSGESTAHIDEHGHLVESSPPPDSATEALEGLKEVERGSADEGAS # SQVGGSIPMELDLPAIESLAEPALSPEKGAEPAQTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g545 ### # start gene g546 Scaffold_19 AUGUSTUS gene 17948 18650 0.46 - . g546 Scaffold_19 AUGUSTUS transcript 17948 18650 0.46 - . g546.t1 Scaffold_19 AUGUSTUS stop_codon 17948 17950 . - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_19 AUGUSTUS CDS 17948 18384 0.9 - 2 transcript_id "g546.t1"; gene_id "g546"; Scaffold_19 AUGUSTUS CDS 18443 18650 0.51 - 0 transcript_id "g546.t1"; gene_id "g546"; Scaffold_19 AUGUSTUS start_codon 18648 18650 . - 0 transcript_id "g546.t1"; gene_id "g546"; # protein sequence = [MRLAPSKDLDVFASLRGKVSPAVTSKITTPSPPLEIKPSTPAPKAPVAPPRLIRRNRELENLKTDASSFLASPRSARS # KDSDNELLSGFPLVDAAPRASSSTKVPVGRKEPKSKTTVKVVEDSKAPDPSTSALVYKRVRLPPRSRKVAPAASKGKARQIVVTDEDSASNEVESEDE # DEEEDSAPPPKRLKTTSSISGKVYSSFISFYFTNLMGL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g546 ### # start gene g547 Scaffold_19 AUGUSTUS gene 21350 21694 0.8 - . g547 Scaffold_19 AUGUSTUS transcript 21350 21694 0.8 - . g547.t1 Scaffold_19 AUGUSTUS stop_codon 21350 21352 . - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_19 AUGUSTUS CDS 21350 21694 0.8 - 0 transcript_id "g547.t1"; gene_id "g547"; Scaffold_19 AUGUSTUS start_codon 21692 21694 . - 0 transcript_id "g547.t1"; gene_id "g547"; # protein sequence = [MVEPEPFPVPVIDEPLSTYLNGYEIEKPAPTSVSRTPTPEPTPDAASTPPPAAAVIAPSPSPTPAVAAFGTTPANELA # SFCVKEKGRNLMGTPTNQSNTQYASSLLSNLFNSKG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g547 ### # start gene g548 Scaffold_19 AUGUSTUS gene 31019 32093 0.44 + . g548 Scaffold_19 AUGUSTUS transcript 31019 32093 0.44 + . g548.t1 Scaffold_19 AUGUSTUS start_codon 31019 31021 . + 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_19 AUGUSTUS CDS 31019 31062 0.55 + 0 transcript_id "g548.t1"; gene_id "g548"; Scaffold_19 AUGUSTUS CDS 31478 32093 0.99 + 1 transcript_id "g548.t1"; gene_id "g548"; Scaffold_19 AUGUSTUS stop_codon 32091 32093 . + 0 transcript_id "g548.t1"; gene_id "g548"; # protein sequence = [MSEVAFAHSISCGEFPEFSSKCIPPNHTEQKYDLTFVNIKPSNYLCRKLSIGGTQNTNATGSFAAESSRHCQAIPYSS # SHCSSFLHRVPSGSVLGGDPYPISIDSHLNQAEVLLPSIADSYNDDKICQSYSRWPPHWDSTFFSASSFSSPEHLLAASIPNLEIDMFGSAESVSKET # FVPVLPPISILEDLRGFHDDDALNILHRLSRDDNENVLNDNHK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g548 ### # start gene g549 Scaffold_19 AUGUSTUS gene 34345 34770 0.52 + . g549 Scaffold_19 AUGUSTUS transcript 34345 34770 0.52 + . g549.t1 Scaffold_19 AUGUSTUS start_codon 34345 34347 . + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_19 AUGUSTUS CDS 34345 34770 0.52 + 0 transcript_id "g549.t1"; gene_id "g549"; Scaffold_19 AUGUSTUS stop_codon 34768 34770 . + 0 transcript_id "g549.t1"; gene_id "g549"; # protein sequence = [MNASDSLSSCVCLCLIFPIMHARPTVSKLGSAAQIILVEKVGRNIHSGGKWEDDEERKFFEEVQDLKDFVPKNVLGLD # DADKATDDDAEKAIEQEKELRKLDEELQTLGGEDGISENTHSMDEEDECVIFSLFPKSSICLK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g549 ### # start gene g550 Scaffold_19 AUGUSTUS gene 75390 77344 0.33 + . g550 Scaffold_19 AUGUSTUS transcript 75390 77344 0.33 + . g550.t1 Scaffold_19 AUGUSTUS start_codon 75390 75392 . + 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_19 AUGUSTUS CDS 75390 76669 0.33 + 0 transcript_id "g550.t1"; gene_id "g550"; Scaffold_19 AUGUSTUS CDS 76792 77344 0.42 + 1 transcript_id "g550.t1"; gene_id "g550"; Scaffold_19 AUGUSTUS stop_codon 77342 77344 . + 0 transcript_id "g550.t1"; gene_id "g550"; # protein sequence = [MPSAVLGDGTECEEEVSAPFRIPHLRWKYHVLGPKTDFPVTVNSLIDNGAHLALIHPDVVACLGLTRRLLKSPELVSA # AFQTKHDQPTIPALSEYVVLKVGSTDGSFTPRNVPFVIAPGLCTQLLLGLPWLCHNQIIIDYASCTCIHKPSGFNLLAPRPVEHMFSFQSKSIENIHA # SLHRISNKAKDSRKKVLTELKEVCLTLCPKFPASLVTPSPSTAQVITAVRTRIENLATLSSLQEHESCLKKKYFSIFEPIPHVDELPTTVTAKIQLVD # AAKSISSHSYCCPRKFRAAWQTLIQKHLDSGKIRPSDSPYASPSFVIPKSDPNALPRWVADYCQLNDKTVFDAHPLPRIDDILTDCGKGRIWGKIDMI # DSFFQTRMNEDSIKLTAITTPFGLYEWTVMPQGLKNSPAIHQRRVTSSVKSAMCIFNVHFLGHSISAKGIAADDKKVERILDWPTPKTVKELQAFLGL # VRYVAAFLPRLAELTDILTGLTSNCVDKNRLAWEPRHQSAFDDIKSLVTSHECLTVIDHDQLDTHKIFITTDASDRCSGAVISFGTSWETARPVSFDS # STFKNAELNYPVHEKELLAIIRALKKWRVDLLGVPFVLMTDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g550 ### # start gene g551 Scaffold_19 AUGUSTUS gene 77761 79181 0.53 + . g551 Scaffold_19 AUGUSTUS transcript 77761 79181 0.53 + . g551.t1 Scaffold_19 AUGUSTUS start_codon 77761 77763 . + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_19 AUGUSTUS CDS 77761 78335 0.57 + 0 transcript_id "g551.t1"; gene_id "g551"; Scaffold_19 AUGUSTUS CDS 78551 79181 0.75 + 1 transcript_id "g551.t1"; gene_id "g551"; Scaffold_19 AUGUSTUS stop_codon 79179 79181 . + 0 transcript_id "g551.t1"; gene_id "g551"; # protein sequence = [MDKWCKDLPSMASSMPLIRRDPISKLWYIGDRVIVPRVANIREELFWLAHDNLGHFGFDKSYAALHEAYYWPHMRRNL # EKAYVPACDECQRNKSSTQKKAGPLHPLPVPDRRFSSVAMDFIGPLPEDNGSNCILTITDRLGADIRIVPCRTDLTASECAQLFFDSWYYENGLPDDI # ICDRDHLFVSKFWEAFGFSPRLIPPLVPNLPPRSSEHKFDMHAFLTNIQVDVLEAQDCLLLAKLDQARAHNRHRCADPVFQLHDRVLLKTKHHKNEYK # RKGEKRAAKFFPHYDGPYTITDVHPAYTLDLPASLNIFPTFHADELKLYTNNDPDLFPNREFPQPGPIVTADGLLKLEVDRILDERKVGRGRRYLVHW # RGYGPEFDSWEPGCSLQQCEALDIWEGLA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g551 ### # start gene g552 Scaffold_19 AUGUSTUS gene 80169 80378 0.66 - . g552 Scaffold_19 AUGUSTUS transcript 80169 80378 0.66 - . g552.t1 Scaffold_19 AUGUSTUS stop_codon 80169 80171 . - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_19 AUGUSTUS CDS 80169 80378 0.66 - 0 transcript_id "g552.t1"; gene_id "g552"; Scaffold_19 AUGUSTUS start_codon 80376 80378 . - 0 transcript_id "g552.t1"; gene_id "g552"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEAVASWLSSKLGVRTT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g552 ### # start gene g553 Scaffold_19 AUGUSTUS gene 83245 83799 0.48 - . g553 Scaffold_19 AUGUSTUS transcript 83245 83799 0.48 - . g553.t1 Scaffold_19 AUGUSTUS stop_codon 83245 83247 . - 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_19 AUGUSTUS CDS 83245 83799 0.48 - 0 transcript_id "g553.t1"; gene_id "g553"; Scaffold_19 AUGUSTUS start_codon 83797 83799 . - 0 transcript_id "g553.t1"; gene_id "g553"; # protein sequence = [MVIAHELFKAEPLKPPRRKALPARRWSRVLPTSRTSSTPTSTPVHVSGDPTAKSAPVFRKQVMLDREQAPHTIPLRDS # RSQKLEHQRGHDGQNSLNPTSTKHRQTFSNRHLSIKESGMNSSSSSSTSSDVWESYVDSLDSGWKTGKSHFGPKPERRGCLIQKMRAMWEYINDTQKD # YRTFRLRK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g553 ### # start gene g554 Scaffold_19 AUGUSTUS gene 85877 86865 0.28 - . g554 Scaffold_19 AUGUSTUS transcript 85877 86865 0.28 - . g554.t1 Scaffold_19 AUGUSTUS stop_codon 85877 85879 . - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_19 AUGUSTUS CDS 85877 85968 0.75 - 2 transcript_id "g554.t1"; gene_id "g554"; Scaffold_19 AUGUSTUS CDS 86224 86422 0.45 - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_19 AUGUSTUS CDS 86475 86800 0.81 - 2 transcript_id "g554.t1"; gene_id "g554"; Scaffold_19 AUGUSTUS CDS 86847 86865 0.65 - 0 transcript_id "g554.t1"; gene_id "g554"; Scaffold_19 AUGUSTUS start_codon 86863 86865 . - 0 transcript_id "g554.t1"; gene_id "g554"; # protein sequence = [MFVFVNYLRSFTSLDFHSRSTLYDQVEQLIAGNLEVLKPLDMVMHFLNDVFSEKSIPNVSTMSMQRVPSLSDHGGLWL # VDSGREVISVAVVAQISPYPDDLKCGEYLDMNVYNQEINLDSLRRASARLFFNEVSSSAEFSDEIANIYTVHSSRFQKLLNVLQEATMQYLDSVKTID # GKDLCRKLKSSEKEKNLKALITDKDVSGMWFVLIQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g554 ### # start gene g555 Scaffold_19 AUGUSTUS gene 100234 100734 1 + . g555 Scaffold_19 AUGUSTUS transcript 100234 100734 1 + . g555.t1 Scaffold_19 AUGUSTUS start_codon 100234 100236 . + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_19 AUGUSTUS CDS 100234 100734 1 + 0 transcript_id "g555.t1"; gene_id "g555"; Scaffold_19 AUGUSTUS stop_codon 100732 100734 . + 0 transcript_id "g555.t1"; gene_id "g555"; # protein sequence = [MSSSRTQTVTTNSSTAGPSRSRPVPPPPIDLTAHDEEGLEDDEDDEDEIIRRAQARVEKVRARKAAEAARKAAEEKAA # RAAAGAGGARSGHLGSSARGRGFGTEEAVGQGGDRQESEGDFSKRGVCFPKEACGRTSASGERKGEGKGPGESRVCGSILLTNVSFGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g555 ### # start gene g556 Scaffold_19 AUGUSTUS gene 105385 106646 0.67 - . g556 Scaffold_19 AUGUSTUS transcript 105385 106646 0.67 - . g556.t1 Scaffold_19 AUGUSTUS stop_codon 105385 105387 . - 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_19 AUGUSTUS CDS 105385 105714 1 - 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_19 AUGUSTUS CDS 105798 106646 0.67 - 0 transcript_id "g556.t1"; gene_id "g556"; Scaffold_19 AUGUSTUS start_codon 106644 106646 . - 0 transcript_id "g556.t1"; gene_id "g556"; # protein sequence = [MIKTLLSTPTIRAPTTIDDLDDDSGGLPRGEPGDPSGPGGPGGPGGPGGPGGPGGPRSPISPDIPNEQRAMLELLSGF # KGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLSYLSGSAKEWFVPDILDPDLDSLPAWTSS # FKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIRKYNIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWK # REETRSVRLPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQRPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGRA # AEVEETPEATVEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g556 ### # start gene g557 Scaffold_19 AUGUSTUS gene 106739 107071 0.97 - . g557 Scaffold_19 AUGUSTUS transcript 106739 107071 0.97 - . g557.t1 Scaffold_19 AUGUSTUS stop_codon 106739 106741 . - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_19 AUGUSTUS CDS 106739 107071 0.97 - 0 transcript_id "g557.t1"; gene_id "g557"; Scaffold_19 AUGUSTUS start_codon 107069 107071 . - 0 transcript_id "g557.t1"; gene_id "g557"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPRRRNRGFGPATVPTTSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSLLELILQSSKP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g557 ### # start gene g558 Scaffold_19 AUGUSTUS gene 108218 112090 0.79 - . g558 Scaffold_19 AUGUSTUS transcript 108218 112090 0.79 - . g558.t1 Scaffold_19 AUGUSTUS stop_codon 108218 108220 . - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_19 AUGUSTUS CDS 108218 112090 0.79 - 0 transcript_id "g558.t1"; gene_id "g558"; Scaffold_19 AUGUSTUS start_codon 112088 112090 . - 0 transcript_id "g558.t1"; gene_id "g558"; # protein sequence = [MDSLLRTAVTLSGNVPLWLLPEHIDSCRVHLSKLSTQKLIISTKRVKHDVALDNVIQALLNFSGRSFVVGLEDICLYS # YVHQQCVVEFGLAVVNTLHCHLKVHVQVGRCVELLIDNKFLPVIMSVFEQLSADELVRVKQALKICERGSTLSPIFCCPSPHGFSEMRSNNLFRLLAK # CFQRDYRYFFSMDDVTLSDRYLYCYGSVFVGMELRGVILKLLVAIGYTETLLDDIVHAIPEQYVFQSKENVDKKDKRRDSRIQHANDEYDLLHKSSNI # WPQVVPVDVRMNCLYNYRQAVQYVVPEICACCGSADQLYTGCYRLESEWPSLSVLKVTDPFILAQTPQSRFTYICRALDGLLLDKRGIRSTDIDCSSF # EIYFCQECYNCLRRVSMPRLALNNHLYRGELIEGIEDITWVEEMACAIYHTSAHVTRIYGSSNAGDSLQLHGNVCAHPLDICSVAKKLPWSPADLNDL # ITVVFVSKARLKHDDLRKLKPYFVRRSVIRMLLSDLCHRNRLYTGLYTLDNSMLELYPDNDLLPGLQERIVYDHDSSVDDLFGVESVGFDSHPAELLV # DSEQDNVLLERSGIYDAESQDVPARFMTASSINNIAQSLPVNNKDVIVKYEKDPIDEYNNPDLFPGMFPTLFPLGIGGFEDRRRRPAVSLEAHVEHLL # DQSTHEFRYHHFFSFVALNVIQRRKAHLHTTLWISSNKFSALAPMLLSISSSVLFDLADKLKNEKDEVEFSDEELDAFQLLKQVNIIAAKIPGSQASK # TATRNQIRSYYAYFGLPHLFLTLNPSAVHSPVFQVIYGEDKVDLAERFPYVVHPHSERACRVVKDPVAAADFFDFMYHTVFEHLFGWDFKAGKSTVDG # GIFAHLRAFFGCAELTERGCFHGHYLLFLRGGLNPSEVHQKMREVEGYSSQFLTFFDDIIHHHLPKVDCPLAEGYEPRIEMPPHLFDNNGNDSVMHSD # WQRLFEDEHKKIGERFQRHKCRPVCYKGRSSSSSCRFGYPHKIIESSSYDIEENSIIFCRKESDVNGHNPDLLVYTRHNHDLKCILSGKAAKAAMFYI # SDYITKMPLSTDILLSTLSKAVASLATEEVDNDPVIASKKLLHRCLTHFGRKQQIHAQQCARYLRRLGDNMFSHQSAILPSGNLMSFVKQLYKLDVRS # DGSNNEGSEVDIQLSLGFKDGKMFSYSQIIDYWYRDAMLFDMCFYDFIRYVSLQLQSKSKTVNTSDTRLGVLRRYKLMAGHPLYETHELIRHTNYRQG # DVGKEFVPVMVGIVPPRKHHKDYALFVLAHFKPFSL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g558 ### # start gene g559 Scaffold_19 AUGUSTUS gene 120523 121588 0.57 + . g559 Scaffold_19 AUGUSTUS transcript 120523 121588 0.57 + . g559.t1 Scaffold_19 AUGUSTUS start_codon 120523 120525 . + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_19 AUGUSTUS CDS 120523 120525 0.68 + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_19 AUGUSTUS CDS 120580 121056 0.86 + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_19 AUGUSTUS CDS 121121 121588 0.91 + 0 transcript_id "g559.t1"; gene_id "g559"; Scaffold_19 AUGUSTUS stop_codon 121586 121588 . + 0 transcript_id "g559.t1"; gene_id "g559"; # protein sequence = [MYISIKDKGKIGSVLKNWPKLDEARIAVVTDGTDYWILNIELFDDDGSHCRLSHSRSRRSWCQRDGYLGWKTFTICCW # SRVCTVYECLIIQAQNRLPRIRPHSTVPICLDFGTNTQKYLDDPLYMGLRQRRIGDEEMIEFMDEFMHEISAAFPKLLIQFEDFSTDHAFMWLERFRS # KYPLFNDDIQGTGAVVLSGFINAAKLSSAASGKPLTSHRILFFGAGSAGVGVAMQLMSFFTMQGLSEKEARERIWLVDSQGLVFDARGPMAEHKKCEI # YVSFSRNSYLLFSQTSLVEIMLVRQSRTFLIVSHGQSPSDH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g559 ### # start gene g560 Scaffold_19 AUGUSTUS gene 123480 124058 0.61 - . g560 Scaffold_19 AUGUSTUS transcript 123480 124058 0.61 - . g560.t1 Scaffold_19 AUGUSTUS stop_codon 123480 123482 . - 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_19 AUGUSTUS CDS 123480 124058 0.61 - 0 transcript_id "g560.t1"; gene_id "g560"; Scaffold_19 AUGUSTUS start_codon 124056 124058 . - 0 transcript_id "g560.t1"; gene_id "g560"; # protein sequence = [MAKPDSHHFWRGLSPQTCSLGEYAKPDIAFLIYISNNVSGFSLPDGKVFIVANNQSILYDIEAQTETILPTIPNGVHV # TNPMDGTATLLPLSPPEFIPEVLVCGGSNFSDATPSEDLSSQDPASDQCTRITLTPEGIEKGWIIERMPEGRMMPEMVLLPNGQVLITNGAGTGYAAV # ASVGDPIGNSNADHPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g560 ### # start gene g561 Scaffold_19 AUGUSTUS gene 127164 127412 0.66 + . g561 Scaffold_19 AUGUSTUS transcript 127164 127412 0.66 + . g561.t1 Scaffold_19 AUGUSTUS start_codon 127164 127166 . + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_19 AUGUSTUS CDS 127164 127412 0.66 + 0 transcript_id "g561.t1"; gene_id "g561"; Scaffold_19 AUGUSTUS stop_codon 127410 127412 . + 0 transcript_id "g561.t1"; gene_id "g561"; # protein sequence = [MIGSDKVSISVAGQQDLNVGVATGSTDLAIQKNGLFQFDFSDFNDGNFGLNFLHKAASGDFVQGVVATVTRQNYGERW # ELVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g561 ### # start gene g562 Scaffold_19 AUGUSTUS gene 134074 134901 0.98 + . g562 Scaffold_19 AUGUSTUS transcript 134074 134901 0.98 + . g562.t1 Scaffold_19 AUGUSTUS start_codon 134074 134076 . + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_19 AUGUSTUS CDS 134074 134901 0.98 + 0 transcript_id "g562.t1"; gene_id "g562"; Scaffold_19 AUGUSTUS stop_codon 134899 134901 . + 0 transcript_id "g562.t1"; gene_id "g562"; # protein sequence = [MGIPLEPVAPTLWDRKAIANVDQDSSIIDRKLKFLLNRLTIEKFDSISDRIIALVNKSEKEKDGRTLIQVIRLVFEQA # TDGENQSEMYALLCRKMMEQISANVQDDSIRNAEGKPIAGGNLFRKYLLDRCQEDFERGWFNKEATAAAAATKVIEEQALKAANTTKGEEEVALYSDE # YYAAQKAKRQGLGLIKFIGELFKLQMLTERIMHECVKKFLRNVENPEEEIESLCKLLITVGRILDTPKARAHMNVYFDRMKQLAKSTNVNSRMQFMLQ # V] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g562 ### # start gene g563 Scaffold_19 AUGUSTUS gene 142640 143158 0.97 + . g563 Scaffold_19 AUGUSTUS transcript 142640 143158 0.97 + . g563.t1 Scaffold_19 AUGUSTUS start_codon 142640 142642 . + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_19 AUGUSTUS CDS 142640 143158 0.97 + 0 transcript_id "g563.t1"; gene_id "g563"; Scaffold_19 AUGUSTUS stop_codon 143156 143158 . + 0 transcript_id "g563.t1"; gene_id "g563"; # protein sequence = [MAPGMPPEQGGYMYPMPWAYNMQPQQMPPPHPQQHPHPPLSHHPSSQGPPHPSMPMSPRNPPIPLQGGPPGTPTSSHA # SAAPHSPHPAPLSHLSSNSISAVSSPPPTPSSATMPGSARLNNNANPFVPRPTSKIVIKSADGSEVNLENFKKGPSHQSSPSIVTSLPHPRPPD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g563 ### # start gene g564 Scaffold_19 AUGUSTUS gene 143236 145405 0.37 + . g564 Scaffold_19 AUGUSTUS transcript 143236 145405 0.37 + . g564.t1 Scaffold_19 AUGUSTUS start_codon 143236 143238 . + 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_19 AUGUSTUS CDS 143236 144011 0.41 + 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_19 AUGUSTUS CDS 144062 144362 0.38 + 1 transcript_id "g564.t1"; gene_id "g564"; Scaffold_19 AUGUSTUS CDS 144527 145405 0.87 + 0 transcript_id "g564.t1"; gene_id "g564"; Scaffold_19 AUGUSTUS stop_codon 145403 145405 . + 0 transcript_id "g564.t1"; gene_id "g564"; # protein sequence = [MQAKAATLEKERKAKEEIEKKAKEEERLRKEKQEAERKEKEEAKRKTKEEAERKAKEEADRLAKEEAERIAKQEAERK # AKEEEEERQRLKAEEEEKARIAEEERLRQEILEAEKHRQEEEEKKKEEEQARLLKEEEDAAAKAKAELESEAKAEEEEEGEVIEKDKPHTDGPEAKAT # EIKPDEKKALRIDTARPSEPLPKRRPGPLDLSTVAGKTNIPPPLPSALATARIIEDLGRISYPEGVQSPKVELNVNAKDGKFRYDRDFLLQFMSVCKE # KPDNLPALDAIGLEPPSQPPFPIIRTQSGRGTRPGNIVRSTSVGLGAGFKGTPTPFGGMGNFGTAGSASKLSSEERFQLANPGRTYGHAGTTYGPGGI # PLEPVAPLQLSENRWDRKAIANVDQDSPEIVDRKVKSLLNKLTMEKFDSISDQIIAWANKSEKEKDGRTLIQVIRLVFEKATDEATWSEMYARLCRKM # MEQISAKVQDDGIRNAEGKPIAGGNLFRKYLLNRCQEDFERGWFNKEATAAAAATKAIEEQALKAANTTKEEEEVALYSDEYYAAQKAKRQGLGLIKF # IGELFKLQMLTERIMHECVKKLLGNVENPEEEEIESLCKLLITVGQMLDTPKARAHMNVYFDRMKELTKSTNVNSRMQFMLQV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g564 ### # start gene g565 Scaffold_19 AUGUSTUS gene 145660 146534 0.31 + . g565 Scaffold_19 AUGUSTUS transcript 145660 146534 0.31 + . g565.t1 Scaffold_19 AUGUSTUS start_codon 145660 145662 . + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_19 AUGUSTUS CDS 145660 146017 0.31 + 0 transcript_id "g565.t1"; gene_id "g565"; Scaffold_19 AUGUSTUS CDS 146089 146534 0.99 + 2 transcript_id "g565.t1"; gene_id "g565"; Scaffold_19 AUGUSTUS stop_codon 146532 146534 . + 0 transcript_id "g565.t1"; gene_id "g565"; # protein sequence = [MSRTGSRRGGDRNDHQAGADGWTVTGNAPRPPAKVGDLSKFGQISKGAPMTFGPSSVFAGKKESKRESLSRTNSNANM # FQMLQNVEAAEVATKTSRPPSRKPSVDLGSGGAPEPAPQRKQEEEITDEPEQEMSEDEAKKKISEDTKEFFGVRSLDEAEVYFEKLPSMYHHSLVDKL # VTLAIESKEADARLVGDFFERASSKKLCSASAFEEGFLGIAEFLDDIAIDAPKATDLLAIMIKGADLGEEQRTNIASKSAENGDKLLKLSS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g565 ### # start gene g566 Scaffold_19 AUGUSTUS gene 159848 160714 0.94 + . g566 Scaffold_19 AUGUSTUS transcript 159848 160714 0.94 + . g566.t1 Scaffold_19 AUGUSTUS start_codon 159848 159850 . + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_19 AUGUSTUS CDS 159848 160714 0.94 + 0 transcript_id "g566.t1"; gene_id "g566"; Scaffold_19 AUGUSTUS stop_codon 160712 160714 . + 0 transcript_id "g566.t1"; gene_id "g566"; # protein sequence = [MSLGSLTSTYHRDTYPAISPSNDYLSQAGKTVLITGGGGGIGFETARSFAKAKASRIIIMGRRSSVLDVAAAKLREEF # NNSTTEFIAHQGDISDDSSVTSLWDSLHSRNIFVHVLVLNAAEFYPSGPDTFKMDKRELMKAFDVNVGGNFSMSVKFVSQPLRPVGQQLNLVNVSTAA # IQTYRVPNQNPYSTSKAAFTALVGRIADEHPVEDVQIISFHPGVLYSESASASFDKNAINWDESEYHLPAVLILNLKLTFAIVALPADYAVWAASPEA # SWLHGRFVWAHWDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g566 ### # start gene g567 Scaffold_19 AUGUSTUS gene 168185 169068 0.64 + . g567 Scaffold_19 AUGUSTUS transcript 168185 169068 0.64 + . g567.t1 Scaffold_19 AUGUSTUS start_codon 168185 168187 . + 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_19 AUGUSTUS CDS 168185 168480 0.64 + 0 transcript_id "g567.t1"; gene_id "g567"; Scaffold_19 AUGUSTUS CDS 168546 169068 0.79 + 1 transcript_id "g567.t1"; gene_id "g567"; Scaffold_19 AUGUSTUS stop_codon 169066 169068 . + 0 transcript_id "g567.t1"; gene_id "g567"; # protein sequence = [MSTPVPPAPNTSAEDLMAQLIRQVASLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTALLPEIRQHLIIVNIAQGIAPTL # KEAIKRAISVDVYLHDPTMTRRPETPDTLPHTLLTLPLPTLTPWTLMLLIPALGIAGRPSLPVCADDVLVVELKAMLSRIAHTRRLPADTVDAGDT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g567 ### # start gene g568 Scaffold_19 AUGUSTUS gene 170044 171258 0.86 + . g568 Scaffold_19 AUGUSTUS transcript 170044 171258 0.86 + . g568.t1 Scaffold_19 AUGUSTUS start_codon 170044 170046 . + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_19 AUGUSTUS CDS 170044 171258 0.86 + 0 transcript_id "g568.t1"; gene_id "g568"; Scaffold_19 AUGUSTUS stop_codon 171256 171258 . + 0 transcript_id "g568.t1"; gene_id "g568"; # protein sequence = [MGESGDIGRTNRGSMVLSRVHYSQQLAEEANRDKPIKTFEEMVPEQYRDFKKVFSESASERLPAHQPWDHAIDLVPGA # PATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPLVADIISRLQGARYFTKFDVRWGY # NNVRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLKEHRQVVREVLTRLEKHDLYLRPEKCEFE # QQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGFANFYRRFIRNFARIARPLNDLTKKDTSFNWTGTQQEAFDTLREAFISAPILALW # APDRPTRIEVDASGFATGGALMQKQDDGQWHP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g568 ### # start gene g569 Scaffold_19 AUGUSTUS gene 172251 173099 0.42 + . g569 Scaffold_19 AUGUSTUS transcript 172251 173099 0.42 + . g569.t1 Scaffold_19 AUGUSTUS start_codon 172251 172253 . + 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_19 AUGUSTUS CDS 172251 173099 0.42 + 0 transcript_id "g569.t1"; gene_id "g569"; Scaffold_19 AUGUSTUS stop_codon 173097 173099 . + 0 transcript_id "g569.t1"; gene_id "g569"; # protein sequence = [MRSLLARLGIKSDLTSGYRPQSNGQTERANQEVEKYIRLYVGRRQDDWAEHLPMAEFVINSRTHSALGMSPFELTYGY # LPLFNIPVGQRSGIPAVDDRIRILREARQDAGAALHLGKKQQKEGYERGKRKAHQFKVGDLVWLSAEDINLQLSSEKLGDRQLGPYRILEKVGPLDYR # LDLPLSLDRLHPVFHVDKLYPWKGNPINGEIPTPPEPVYLEDEDEPEYEVEEILDSRVRWKKLEYLVKWKGYDAGHNSWEPAPNLSRAPKNCSGLSQK # TSDSAKQP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g569 ### # start gene g570 Scaffold_19 AUGUSTUS gene 178731 179189 0.64 - . g570 Scaffold_19 AUGUSTUS transcript 178731 179189 0.64 - . g570.t1 Scaffold_19 AUGUSTUS stop_codon 178731 178733 . - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_19 AUGUSTUS CDS 178731 179189 0.64 - 0 transcript_id "g570.t1"; gene_id "g570"; Scaffold_19 AUGUSTUS start_codon 179187 179189 . - 0 transcript_id "g570.t1"; gene_id "g570"; # protein sequence = [MITRSKTPRTSGTDAISAPLSSISAVDSTFTSLFGSMASATTSRNNTPSSALPSSVSATSATAMDFASSVDIDPIVDP # PSGSTTSSSFIASAIPASPKVLSDDDCDDNFHGEVEIYLDYTSDILQAQAEEVKLLRWEVASAHEEKDVSNNEI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g570 ### # start gene g571 Scaffold_19 AUGUSTUS gene 186120 186668 1 + . g571 Scaffold_19 AUGUSTUS transcript 186120 186668 1 + . g571.t1 Scaffold_19 AUGUSTUS start_codon 186120 186122 . + 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_19 AUGUSTUS CDS 186120 186668 1 + 0 transcript_id "g571.t1"; gene_id "g571"; Scaffold_19 AUGUSTUS stop_codon 186666 186668 . + 0 transcript_id "g571.t1"; gene_id "g571"; # protein sequence = [MSVRNALVDLDATTTSLHIVVAIIDANPSAPSESGTMNLGTMLGTSSNAELLGVDGTTTSAHITVADIDANPSAPSEY # GTMKFGMMLGTSSNNIADCPVTSPSIPIDANPPILTLAEPIVPLFQSGSTSHAFVLQFENQHLEAFMLGYLATPNPKSSIGMREFEFHFLAQLDPNSK # KRSFPY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g571 ### # start gene g572 Scaffold_19 AUGUSTUS gene 187318 188310 0.68 - . g572 Scaffold_19 AUGUSTUS transcript 187318 188310 0.68 - . g572.t1 Scaffold_19 AUGUSTUS stop_codon 187318 187320 . - 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_19 AUGUSTUS CDS 187318 188310 0.68 - 0 transcript_id "g572.t1"; gene_id "g572"; Scaffold_19 AUGUSTUS start_codon 188308 188310 . - 0 transcript_id "g572.t1"; gene_id "g572"; # protein sequence = [MSSTAVFPHLISTRFCPELFREYLSYVPVMDLDACSRVCHYWREPALSAQFRTVDVENKVQLALLSIDPRRLRYVREV # IGDSCSAFTTAFTSYPAHLRTLEIRDMDFIATNNQINQAVVAFSPTITTFTIHSSLRMTYQDFCELLQCLVHCKSLRNLTFPPPARAIDDRSSSPERA # VEARNAIDVMAHIREEKAKLAFLQLIPTSYRRDPQYTGDAPHAQEYGWLNAGVCPFDLSELETLVVGSASAAQILLPAISKHLTRLEFCLPFDNRSAW # TEYGKFFCMEQVSLFLTISRNPLRSPDRSAFPAPPRIDFSYTPIELATGRHSHASA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g572 ### # start gene g573 Scaffold_19 AUGUSTUS gene 195222 195899 0.6 + . g573 Scaffold_19 AUGUSTUS transcript 195222 195899 0.6 + . g573.t1 Scaffold_19 AUGUSTUS start_codon 195222 195224 . + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_19 AUGUSTUS CDS 195222 195899 0.6 + 0 transcript_id "g573.t1"; gene_id "g573"; Scaffold_19 AUGUSTUS stop_codon 195897 195899 . + 0 transcript_id "g573.t1"; gene_id "g573"; # protein sequence = [MARTRASPVPTHTNESHHFQETSFSSVANTSSGNRALDRIQRHPSPGPETSDPLFFATHSQGHPHIQGPQNHVHRDSS # SSSVASTPPLIVDSTVSDPSLNGVNPLDELPSKPTIPVELMTQVDQKILGYLETFHTRSQRLFNEQKATSEFTKEQISVVAQQCIVSDSHYSVIYCSE # FYFYQDLQAIIELRKKVRKLKHCCPYCKDLAWNPHMCVLTPSSNHPFCL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g573 ### # start gene g574 Scaffold_19 AUGUSTUS gene 197410 197751 0.33 - . g574 Scaffold_19 AUGUSTUS transcript 197410 197751 0.33 - . g574.t1 Scaffold_19 AUGUSTUS stop_codon 197410 197412 . - 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_19 AUGUSTUS CDS 197410 197751 0.33 - 0 transcript_id "g574.t1"; gene_id "g574"; Scaffold_19 AUGUSTUS start_codon 197749 197751 . - 0 transcript_id "g574.t1"; gene_id "g574"; # protein sequence = [MENSSTTLASGGSGSPSSPSDTANNDSASSDSSIKPASSARILVDIDSIHEFPMLPSGREEYLERQGGTDELVKGLDT # LHAASGKIFRAQKEEIHLRRHQISVLKEQSRVSET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g574 ### # start gene g575 Scaffold_19 AUGUSTUS gene 198996 199412 0.41 + . g575 Scaffold_19 AUGUSTUS transcript 198996 199412 0.41 + . g575.t1 Scaffold_19 AUGUSTUS start_codon 198996 198998 . + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_19 AUGUSTUS CDS 198996 199412 0.41 + 0 transcript_id "g575.t1"; gene_id "g575"; Scaffold_19 AUGUSTUS stop_codon 199410 199412 . + 0 transcript_id "g575.t1"; gene_id "g575"; # protein sequence = [MLTRNRAQHNVESPLTPPLALLPAITDSTTRILGLVSSHAYGNTESIMDVIENVVSESHKELDQWARQEISSRDKQIE # EERRLSENNKIVLSQQNDAQIHKLKSHYEGKELALTNKLEKCETQLLVSVHNVVSLHFLT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g575 ### # start gene g576 Scaffold_19 AUGUSTUS gene 204353 204874 0.99 - . g576 Scaffold_19 AUGUSTUS transcript 204353 204874 0.99 - . g576.t1 Scaffold_19 AUGUSTUS stop_codon 204353 204355 . - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_19 AUGUSTUS CDS 204353 204874 0.99 - 0 transcript_id "g576.t1"; gene_id "g576"; Scaffold_19 AUGUSTUS start_codon 204872 204874 . - 0 transcript_id "g576.t1"; gene_id "g576"; # protein sequence = [MINILRSEFPSTELRDPGRYINGLWRKRKTDDGSGCSSPSAPTCPGSDPSTTNGSVNQQTNSKNINNFSSETHNSADM # NLSFQNDSVLASNINSTSEGSSNLPRINGHNDYGMSVMAQVILNRDSLAFTPLDLSDLEVIVGAARATVLVRADFLSPPRRSFSVTPDGKPRLPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g576 ### # start gene g577 Scaffold_19 AUGUSTUS gene 208766 209287 0.99 - . g577 Scaffold_19 AUGUSTUS transcript 208766 209287 0.99 - . g577.t1 Scaffold_19 AUGUSTUS stop_codon 208766 208768 . - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_19 AUGUSTUS CDS 208766 209287 0.99 - 0 transcript_id "g577.t1"; gene_id "g577"; Scaffold_19 AUGUSTUS start_codon 209285 209287 . - 0 transcript_id "g577.t1"; gene_id "g577"; # protein sequence = [MSLDSLNVTSTYHRDTYPAISPSKPSLSQNGRAVLITGGGGGIGFEIARSFAKAGASKIIIVGRRSAVLDAAAVKLRE # EFKDSTPAPPEFIAHQGDIGNDDSISSLWDFLNSQGIFIRVLVLNAAHVTPWGLDTLKMDKRELMEGFDVNVGGNFLMTVKFVNQSLPLLASSSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g577 ### # start gene g578 Scaffold_19 AUGUSTUS gene 209877 210626 0.56 - . g578 Scaffold_19 AUGUSTUS transcript 209877 210626 0.56 - . g578.t1 Scaffold_19 AUGUSTUS stop_codon 209877 209879 . - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_19 AUGUSTUS CDS 209877 210626 0.56 - 0 transcript_id "g578.t1"; gene_id "g578"; Scaffold_19 AUGUSTUS start_codon 210624 210626 . - 0 transcript_id "g578.t1"; gene_id "g578"; # protein sequence = [MSGTLNFSAMSLTKTHHRDTYPTISSTKPSLSQVGKTVLITGGASGIGFEIARSFAKASAARIIILSRKISSLNAAVE # KLRDEFQSSGTEFITRQGDIGDDSSIIALWDYLNSQNIFVHVLVLNAAHVTPFGPDTLSMDKQELMQTFDVNVGGNFLMSSRFVKQPLRPAGQQLNLV # FVSTAGIQRHPAPAQNPYTTSKAAFTALLGRIADERSAEDVQIISFHPGLLHTEGVVSYFGQNLPRCDESKCC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g578 ### # start gene g579 Scaffold_19 AUGUSTUS gene 212776 213159 0.71 - . g579 Scaffold_19 AUGUSTUS transcript 212776 213159 0.71 - . g579.t1 Scaffold_19 AUGUSTUS stop_codon 212776 212778 . - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_19 AUGUSTUS CDS 212776 213159 0.71 - 0 transcript_id "g579.t1"; gene_id "g579"; Scaffold_19 AUGUSTUS start_codon 213157 213159 . - 0 transcript_id "g579.t1"; gene_id "g579"; # protein sequence = [MKFFAILIASAALATVTNALPVRLVEREPTRHFQGSMPPPNSPHLANGSGNGSDTENNTEIATESYTITTSSAIATST # FTTSIPASTPATETAIQSSSTLSLPVGSLSQTQSIVIPTSIGSNGAVLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g579 ### # start gene g580 Scaffold_19 AUGUSTUS gene 215705 216064 0.81 - . g580 Scaffold_19 AUGUSTUS transcript 215705 216064 0.81 - . g580.t1 Scaffold_19 AUGUSTUS stop_codon 215705 215707 . - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_19 AUGUSTUS CDS 215705 216064 0.81 - 0 transcript_id "g580.t1"; gene_id "g580"; Scaffold_19 AUGUSTUS start_codon 216062 216064 . - 0 transcript_id "g580.t1"; gene_id "g580"; # protein sequence = [MKFFAIFITSALLATVTSALPTRLAERNPAHRFQGSMPPPNSPHLAHYNGTGDGSDNENYPETDTKTDTIAAASTSTT # TTAAETTLQSSTKPPLPVETITTTYSIVVPTSIGSDATALA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g580 ### # start gene g581 Scaffold_19 AUGUSTUS gene 217070 217516 0.97 - . g581 Scaffold_19 AUGUSTUS transcript 217070 217516 0.97 - . g581.t1 Scaffold_19 AUGUSTUS stop_codon 217070 217072 . - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_19 AUGUSTUS CDS 217070 217516 0.97 - 0 transcript_id "g581.t1"; gene_id "g581"; Scaffold_19 AUGUSTUS start_codon 217514 217516 . - 0 transcript_id "g581.t1"; gene_id "g581"; # protein sequence = [MKFSTLLLTGAVLTSTALARPSRLAEREATRRSRSSRPFSGSSHNSTSNNTDSRVELHAGTTSTSLHDEYSTNWAGVI # IESPPSGQNFTTVTGTFVVPSPTGSDGAASAWVGIDGDTASQSILQAGVDFKISGGKITYDSWYEWSVSC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g581 ### # start gene g582 Scaffold_19 AUGUSTUS gene 218601 218975 0.95 - . g582 Scaffold_19 AUGUSTUS transcript 218601 218975 0.95 - . g582.t1 Scaffold_19 AUGUSTUS stop_codon 218601 218603 . - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_19 AUGUSTUS CDS 218601 218975 0.95 - 0 transcript_id "g582.t1"; gene_id "g582"; Scaffold_19 AUGUSTUS start_codon 218973 218975 . - 0 transcript_id "g582.t1"; gene_id "g582"; # protein sequence = [MKFYAILSITGALLVAATNALPTRIAERQPTRQFGGSRPPPNSPHLAHYNGTGNGSGDYADDPENDTASYTFTFSSTS # TSSTPMSTSTAMESSSDLPLPVETLTQIQSIVVPIPTGSIAPSSPS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g582 ### # start gene g583 Scaffold_19 AUGUSTUS gene 225202 225975 0.93 + . g583 Scaffold_19 AUGUSTUS transcript 225202 225975 0.93 + . g583.t1 Scaffold_19 AUGUSTUS start_codon 225202 225204 . + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_19 AUGUSTUS CDS 225202 225975 0.93 + 0 transcript_id "g583.t1"; gene_id "g583"; Scaffold_19 AUGUSTUS stop_codon 225973 225975 . + 0 transcript_id "g583.t1"; gene_id "g583"; # protein sequence = [MSLDSFNVTRTFHRDTYPAISPTKASLSQAGKAVLITGGGGGIGFEIARSFAKAGASKIIIVGRRTAVLDAAAVKLRE # EFKNSTPTPEFIAHQGDIGDDASISSIWKFLNSQNIFVRVLVLNAAHFYPLGPDTLKMDKREIMEGFNTNVGGNFLMTVNFVNQPLRPKGQQLNLVNV # STSTIHTIPGPNSTPYAASKAAFTALTGRIADEHPVEEIQIISFHPGIIYSEGTAKFADKNLKWDESKCHQLQSLRCCSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g583 ### # start gene g584 Scaffold_19 AUGUSTUS gene 238961 240367 0.75 + . g584 Scaffold_19 AUGUSTUS transcript 238961 240367 0.75 + . g584.t1 Scaffold_19 AUGUSTUS start_codon 238961 238963 . + 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_19 AUGUSTUS CDS 238961 240367 0.75 + 0 transcript_id "g584.t1"; gene_id "g584"; Scaffold_19 AUGUSTUS stop_codon 240365 240367 . + 0 transcript_id "g584.t1"; gene_id "g584"; # protein sequence = [MSATSTERPSSSKTESKKQKSALSRGNTTQAQKSNQAASSTVITVAAGQRLMSIPEQSFGDETASNIRTPEGRQPEVQ # GPPPVEPGMGPPQRRFTSMGYAQPASSPMGGFAYSPTLGNERPPPGPIPQLDMESASNAGGRVSGQVAAIERIQGGSTDPLTVRQQEKLPERRVSPAV # SEQSRTSSRRLPTPPVQSLNLPPPRRGSSLSSLLKSPAMNTPNWERTHAIHHSRTNFPVQPLSEMTLRLEDVIRIQECIPEDVAMVLREVLESMGIEI # LGDGLEFSDLRVQFLTVGTQLEIDLPEKAQQWLMTPANRSDFLWLYNVLLDPERMLELLEAEARYGRSFRNSRGILPLLPHTHGREKEFCGEAGLRIL # YRASNYRSGAVRFEPPPSRVNIPNYQAIQILRNANLAEAAAKIDEESNEDANAIAAKNRRRRRYTTAHLLAPVESMPDQDSPVRSVADRWYTRTRP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g584 ### # start gene g585 Scaffold_19 AUGUSTUS gene 245000 245998 1 + . g585 Scaffold_19 AUGUSTUS transcript 245000 245998 1 + . g585.t1 Scaffold_19 AUGUSTUS start_codon 245000 245002 . + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_19 AUGUSTUS CDS 245000 245998 1 + 0 transcript_id "g585.t1"; gene_id "g585"; Scaffold_19 AUGUSTUS stop_codon 245996 245998 . + 0 transcript_id "g585.t1"; gene_id "g585"; # protein sequence = [MDRLLREGTPAYFLHISPTKEGSPTEEILRASGSNDPERVQQPNPESGDPSSEQGGVVKELDKEESKHQEMEELKKSI # PVQYQDYLDVFSPGEARTLPPHQPYDIKIETEGDAIPPIGKLYNMSEKELKSLKEYINEMLGKGFIRSSSSPAGAPVLFAKKKDGTLRLCVDYRALNK # ITKKNRYPLPLIGTLVDQLRKAKIFTKIDLCAGYNNIRVAQGHEWKTAFRTRYGSFEYLVMPFGLTNAPSAFQFFMNEIFHDMVDVCVVIYLDDILIY # SDDEVSHVEHVRKVLERLRANHLHAKPEKCAFHVDTVEYLGVIISPLGVSMDPEKSRR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g585 ### # start gene g586 Scaffold_19 AUGUSTUS gene 252803 253973 0.42 - . g586 Scaffold_19 AUGUSTUS transcript 252803 253973 0.42 - . g586.t1 Scaffold_19 AUGUSTUS stop_codon 252803 252805 . - 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_19 AUGUSTUS CDS 252803 253158 0.43 - 2 transcript_id "g586.t1"; gene_id "g586"; Scaffold_19 AUGUSTUS CDS 253247 253973 0.43 - 0 transcript_id "g586.t1"; gene_id "g586"; Scaffold_19 AUGUSTUS start_codon 253971 253973 . - 0 transcript_id "g586.t1"; gene_id "g586"; # protein sequence = [MTLNLEGFPLPTLDHLGVSSISPSDHIDAKAIASDWFNQFATCLKDNDVEGTLGLFNNESYWRDILAFTWDFRTFIGT # NNIKQFLKDRLSISQPKAFKLRDELLGVQQPYPDLIWISFMFDFEVGDTGIASGIGRLVPQIDGSWKANCIFTNLEDLKGFPEKVGSLRNLEPNHGLW # EALRRRETAFEDKEPTALIIGGGQGGMEIAARLKMLDVSALVVEKNARIGDSWRNRYKALCLHDPVFAQEMHPRSEISPISFPPNWPAYSPAAKVCPT # YVSRVPLITDFTSLLGGWNTTPRQWNSTFGPHVKLRKLTGTKPMTVGLLLYTFLMEGIITSRALNISSLPLASTATSRMSLHILAW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g586 ### # start gene g587 Scaffold_19 AUGUSTUS gene 257219 257587 0.83 + . g587 Scaffold_19 AUGUSTUS transcript 257219 257587 0.83 + . g587.t1 Scaffold_19 AUGUSTUS start_codon 257219 257221 . + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_19 AUGUSTUS CDS 257219 257587 0.83 + 0 transcript_id "g587.t1"; gene_id "g587"; Scaffold_19 AUGUSTUS stop_codon 257585 257587 . + 0 transcript_id "g587.t1"; gene_id "g587"; # protein sequence = [MTTASDVSKKYDNALFMPLLRLTQMLRENPSLLDDTAEELKAGSNAYTLESTANDDSTPVQKEPGTKTQVAVEGQRSG # ADISEGPDKKEEIGTEVDEKDWDDDIKPVRPELVFRESIIHLVF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g587 ### # start gene g588 Scaffold_19 AUGUSTUS gene 260199 262919 0.21 + . g588 Scaffold_19 AUGUSTUS transcript 260199 262919 0.21 + . g588.t1 Scaffold_19 AUGUSTUS start_codon 260199 260201 . + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_19 AUGUSTUS CDS 260199 261298 0.98 + 0 transcript_id "g588.t1"; gene_id "g588"; Scaffold_19 AUGUSTUS CDS 262568 262919 0.31 + 1 transcript_id "g588.t1"; gene_id "g588"; Scaffold_19 AUGUSTUS stop_codon 262917 262919 . + 0 transcript_id "g588.t1"; gene_id "g588"; # protein sequence = [MSAFFHPKDDLVVSASMDQTVRVWDISGLRKGSPNSGPGNFETFDTFSTVKYVLEGHDRGVNYATFHPTLPLILSAAD # DRTIKIWRMSETKAWEVDSCRGHFNNVSAAIFHPKHELIVSCGEDKTVRVWDLAKRTAIQTFRREHDRFWDLAAHPNLNLFAAGHDSGLIVFKLERER # PAFAVHQNTLYYIRDKYVRSYDFETASDLGLLSVRKFGSPYVPPRTLSFNPAENAVIVTISSDNGMYELTTLPKPSSAQGGELKDSSVDGKRGSGMSA # IFVARNRFAVLNKTTQVSLFRSFDNIFNIYCVQLIEVRDTSNSVVKTIKPPVQTNEIFYGGTACLILSSTATVVLYDIQQQKTLAEINSPPVNGSLEN # GIEPTYVNGDAAAGSLAALDDWAKDEEVHEEIDPEEGGWELDAGAEFSASHEVHEEVDEEEEELGAGATPGISEIEHWVKNSPLAADHVAAGSFDTAM # QVGLTIFSHHPVS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g588 ### # start gene g589 Scaffold_19 AUGUSTUS gene 266497 267459 0.81 - . g589 Scaffold_19 AUGUSTUS transcript 266497 267459 0.81 - . g589.t1 Scaffold_19 AUGUSTUS stop_codon 266497 266499 . - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_19 AUGUSTUS CDS 266497 267459 0.81 - 0 transcript_id "g589.t1"; gene_id "g589"; Scaffold_19 AUGUSTUS start_codon 267457 267459 . - 0 transcript_id "g589.t1"; gene_id "g589"; # protein sequence = [MISNHQTPQNSPFIPNATLYPASPYSNPASIGGSPQIPALSLVPPGSPNTVPFPYEPAWNQNMYAAPVRQRRPSYHGD # FIPPTSPFLSDGYRPDSDPYFRERRRSFGGSYYQPGWASSTYMGAIAPPASPSGFMLHPWLNADVWKGDFVLDLTSRDFRPLQINPAGQARPCPVEYL # NQSATHPPITRLRIVSDLLPEWPIDIAYRQQYVGGLSSSISAAWTPGFGIDTTGTQAPITFLDVLINVHRSLHQRITHDDFNRLSLSQERAVTKAYYR # RCRAAGSFETAERGQGVKRVDYLLDRKWFRGCILDWDAGVFRLVVA] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g589 ### # start gene g590 Scaffold_19 AUGUSTUS gene 294316 294723 0.79 - . g590 Scaffold_19 AUGUSTUS transcript 294316 294723 0.79 - . g590.t1 Scaffold_19 AUGUSTUS stop_codon 294316 294318 . - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_19 AUGUSTUS CDS 294316 294723 0.79 - 0 transcript_id "g590.t1"; gene_id "g590"; Scaffold_19 AUGUSTUS start_codon 294721 294723 . - 0 transcript_id "g590.t1"; gene_id "g590"; # protein sequence = [MVLKEYLQIDDPSDWQQFTVPAEELGSFLADPHSYELKLVSDMKLDTSAKTAHDMRRSPWNQTVISLLTTKASEYASE # KSEYYGNDGQEVDWRGLFNNRVYRLLLEVVKAKAGVRDNHYEAQKQESKKRRVREYV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g590 ### # start gene g591 Scaffold_19 AUGUSTUS gene 295180 296403 0.18 - . g591 Scaffold_19 AUGUSTUS transcript 295180 296403 0.18 - . g591.t1 Scaffold_19 AUGUSTUS stop_codon 295180 295182 . - 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_19 AUGUSTUS CDS 295180 295643 0.84 - 2 transcript_id "g591.t1"; gene_id "g591"; Scaffold_19 AUGUSTUS CDS 295772 296183 0.43 - 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_19 AUGUSTUS CDS 296296 296403 0.45 - 0 transcript_id "g591.t1"; gene_id "g591"; Scaffold_19 AUGUSTUS start_codon 296401 296403 . - 0 transcript_id "g591.t1"; gene_id "g591"; # protein sequence = [MPTNDLGFDADDEDNSDQEVRQPLDNDDAEPSDVSRELARDLLREGFNVRNLWAIFARDGIKLETLENYIKDPIANGP # KLRNTRLDKFAADVKSMKASAWNRALTYKLSEKAKEIVAACGDGRFGSAPIDWNKLFSDRLYTVYKEIIDARLLPQEDNEARVLRLALKHDQRNRQRG # DPAGVEFWSYALNVNEILGDQGQSDEEDTTIDVDIEGVVVKQSVKKVLRVYWRHPWLESLFRIMNQAPALEKLIFHRAGAKRIPRIYSDTISHRAPIT # GYPREFFREAFLSALLPHDIAALNLAEYSFPLADFSGYNPSTTSGDGEPMQTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g591 ### # start gene g592 Scaffold_19 AUGUSTUS gene 298823 299268 0.84 - . g592 Scaffold_19 AUGUSTUS transcript 298823 299268 0.84 - . g592.t1 Scaffold_19 AUGUSTUS stop_codon 298823 298825 . - 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_19 AUGUSTUS CDS 298823 299041 0.91 - 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_19 AUGUSTUS CDS 299092 299268 0.85 - 0 transcript_id "g592.t1"; gene_id "g592"; Scaffold_19 AUGUSTUS start_codon 299266 299268 . - 0 transcript_id "g592.t1"; gene_id "g592"; # protein sequence = [MTIEAGEKAIETAQEVKKIEEKERMATKKVHEIANALEEDNQQLLNDHGLLKEDHEHSQEELRKVKDQLKQTETEKLE # TETRLTRAQDRLDQLGRETLVVTQESEQREHKLQAEIDGLKVEHFIGCHHLAC] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g592 ### # start gene g593 Scaffold_19 AUGUSTUS gene 306234 308383 0.37 - . g593 Scaffold_19 AUGUSTUS transcript 306234 308383 0.37 - . g593.t1 Scaffold_19 AUGUSTUS stop_codon 306234 306236 . - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_19 AUGUSTUS CDS 306234 308076 0.39 - 1 transcript_id "g593.t1"; gene_id "g593"; Scaffold_19 AUGUSTUS CDS 308163 308383 0.37 - 0 transcript_id "g593.t1"; gene_id "g593"; Scaffold_19 AUGUSTUS start_codon 308381 308383 . - 0 transcript_id "g593.t1"; gene_id "g593"; # protein sequence = [MSVSSLHDAASDLKTRLDDLSRTQTTAEIQSILCAVEDGSETLRREIASSTAAVSVKAKEVRGVLDSIEQSVQLITDL # MAGKCFFDPGQDKNSPTIIAYCIALVARVFERTAQRGATFILKMIKIFGYTLATLGGRNLNTDQEIALAEIPESIERLEKKFNLDVDCVPYAVCPKCS # KTYAPSFPNGASHPVYPPICLERQTPSEEPCSTSLLSYGKPAKIFEYYPFFDWFGKFISLPGIEEYGDKFCEAVESHQNVPNKKVDQTDGCFVHEFPG # ADAQLFIADRGSEGRWLFTLNADFFNAEGNRIRGKKSSTGMMAMSCLNLPLKMRNDHAYLYIPGIIQGPQEPNAINAEHRHYLKPLIDDLLTGYTRGI # RPYATHRTYGQNCPYDRVFRVALALVLMDFKAARPFSGFLDVTSHHFCYMCDCWHVSHLGRTDYEEWKSADDAFLRKGAELWRDAPDIKKRKILEDIF # GTRASEFWRLPYWKASIQLGIDPMHTMFLILLQRYFRDILGLDNPDDPKRTPKKPKFKFAFYYDFTPPPPLSSLVNQEDATRLRTSIIGYDSQPIDDN # LLSLLEWPHLSMEHSAYRWARLQSLQVQVANDSRAQQAVLDILNDLSERAPTTEAQRHQLYSRIQRHKWSAILYVCDNLAIFPNASGPDLRNSSQITQ # KDVTKRELSNILLHWVRIQLF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g593 ### # start gene g594 Scaffold_19 AUGUSTUS gene 315978 317535 0.24 - . g594 Scaffold_19 AUGUSTUS transcript 315978 317535 0.24 - . g594.t1 Scaffold_19 AUGUSTUS stop_codon 315978 315980 . - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_19 AUGUSTUS CDS 315978 316952 0.91 - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_19 AUGUSTUS CDS 317067 317348 0.31 - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_19 AUGUSTUS CDS 317449 317535 0.27 - 0 transcript_id "g594.t1"; gene_id "g594"; Scaffold_19 AUGUSTUS start_codon 317533 317535 . - 0 transcript_id "g594.t1"; gene_id "g594"; # protein sequence = [MLLADIHLLNGWGDDVSGRSLSSETSMGYHIKAWGALAEKSLLIRPYMSAFSAQHSTPSQPKSDTRVQVMIASQDVEY # TTEKFKLNGVVGDGNTKGRRDMLVDMIHELSGRKDLVFGDLIGIGGKCGSPEVCISSFYLFLLLNSHTDAAHVHSPTGGQGLNSGVQDAFNLCWKLSL # VHKGKSTSNKLMASYTEERMRVVKAMLNVTTRLLRQAFGVNEDKTVNIEVNSAQTTISTTTTSTNSPDKKQPSGINNIVRGFELRMFGINYRGSSIVL # DEVAPPAEVLDPYKMSPEEPVRGGDRAPEAPDLKILHENSSDGITSLFEIFDTTKHTALVFFKSPLAIQEFSRALANYPNGTMRIVVIHPQGSTERVL # IDGKQEGDVVEVLDTKGHAYGSYLRGVDFNAVVASEGAVSQETGGLVIVIRPDGHVGAIVKDVAGVDRYRRKVFT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g594 ### # start gene g595 Scaffold_19 AUGUSTUS gene 332423 332950 0.54 + . g595 Scaffold_19 AUGUSTUS transcript 332423 332950 0.54 + . g595.t1 Scaffold_19 AUGUSTUS start_codon 332423 332425 . + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_19 AUGUSTUS CDS 332423 332950 0.54 + 0 transcript_id "g595.t1"; gene_id "g595"; Scaffold_19 AUGUSTUS stop_codon 332948 332950 . + 0 transcript_id "g595.t1"; gene_id "g595"; # protein sequence = [MSRYSASNHIPSRAHLTPQIHNGQTFLVPQATGTVAQPSSYYPPPQPNTTDLLAHRIMDAIAPILNAHQAGTMSRLEN # FEQAIRGVLEPLENNVKNVEKSQASIQKTIFESSNALHETLIAQTKSLKNIISRVHVLELVIGKGDETSSIADKVDAINYSMGEFLERALDPYAPIG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g595 ### # start gene g596 Scaffold_19 AUGUSTUS gene 333423 334484 0.79 + . g596 Scaffold_19 AUGUSTUS transcript 333423 334484 0.79 + . g596.t1 Scaffold_19 AUGUSTUS start_codon 333423 333425 . + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_19 AUGUSTUS CDS 333423 334484 0.79 + 0 transcript_id "g596.t1"; gene_id "g596"; Scaffold_19 AUGUSTUS stop_codon 334482 334484 . + 0 transcript_id "g596.t1"; gene_id "g596"; # protein sequence = [MNIYTEASSQSPQSSTTSFPLTAVDWSMCSKCISPRSNYDSLIYSVAPGDSNPVAAARVDFFTPDLSPEGRKGYSSLS # NWDSAQPVESPAELPSPRGSHVPSSRTPSPIPPRDAPFPTPPNDNPPSTPAVSSTMRDNLTNRDTALLPESPPTATRIAKIHTDGSPSPSVLDEAFVL # QMVNSPGSSMHDTKSSKSMALDIDQENIEGQVHPSAVSSQHTHNTISLPVVSALFSATLDDELSDLTSISDSNSDRAGGEVEDTERPRKRPRLSRQAS # VASRFQVKQEKPSPSKRGRQLKVPKSVGPRSASVPKIKQKPGRKRKSMVVVVWPNRLLNEAGSCGTVSRFTVKIERRSN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g596 ### # start gene g597 Scaffold_19 AUGUSTUS gene 336110 336850 0.17 + . g597 Scaffold_19 AUGUSTUS transcript 336110 336850 0.17 + . g597.t1 Scaffold_19 AUGUSTUS start_codon 336110 336112 . + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_19 AUGUSTUS CDS 336110 336850 0.17 + 0 transcript_id "g597.t1"; gene_id "g597"; Scaffold_19 AUGUSTUS stop_codon 336848 336850 . + 0 transcript_id "g597.t1"; gene_id "g597"; # protein sequence = [MAYTSFPFPPETPVFPRAHVVETYLESYAKRFNLLPHIQLATAVDAVERLLDGQDQWKVKLSTGQIEVFDFLIVCNGH # YRVPRYPDIPGLASWRASKKAMHSAWYRHPMQDYGNIVLVIGAGPSGLDISSEMAENGTTVIHSVRGSSSEDLGNIKRRGSVVEFKNNGAVLFEDGTI # EQGITFCIIATGYEIAFPFLPDPSIIRNTLPPPIPPIPKSLYNSTFHLFPLAKHIFPLSYQHPTIASWGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g597 ### # start gene g598 Scaffold_19 AUGUSTUS gene 336955 337353 0.26 + . g598 Scaffold_19 AUGUSTUS transcript 336955 337353 0.26 + . g598.t1 Scaffold_19 AUGUSTUS start_codon 336955 336957 . + 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_19 AUGUSTUS CDS 336955 337353 0.26 + 0 transcript_id "g598.t1"; gene_id "g598"; Scaffold_19 AUGUSTUS stop_codon 337351 337353 . + 0 transcript_id "g598.t1"; gene_id "g598"; # protein sequence = [MARYASLSSVLGSEDPLEIAQSWHRFEDHEQFDYRDDLYEFADTSTQEGTSGIEGRIVVPDWEKKMYDAKGVLRQFWV # SLEKKGLAEEWVEGVGRNGLYEWVELLERMLREATKDSGESAKGETIEADQSKL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g598 ### # start gene g599 Scaffold_19 AUGUSTUS gene 340487 342362 0.62 + . g599 Scaffold_19 AUGUSTUS transcript 340487 342362 0.62 + . g599.t1 Scaffold_19 AUGUSTUS start_codon 340487 340489 . + 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_19 AUGUSTUS CDS 340487 340881 0.81 + 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_19 AUGUSTUS CDS 340961 341057 0.8 + 1 transcript_id "g599.t1"; gene_id "g599"; Scaffold_19 AUGUSTUS CDS 341829 342362 1 + 0 transcript_id "g599.t1"; gene_id "g599"; Scaffold_19 AUGUSTUS stop_codon 342360 342362 . + 0 transcript_id "g599.t1"; gene_id "g599"; # protein sequence = [MIALVSPQETSSAIVEYDALESATDAKESLQGQCYAQYRINAEYIVLPDASPIPPVPAFSEFDDFEIKFDRTLARNSF # FSNSAPPSRTQSRNHSSAFQHKRPLQDISNSSNYLQHFAPPSALYAPKSGPLPRWNNDPTQCYSSRIQYPYPSQMQTNGYKAQDRVLGELIDRPNPTF # TLEILSKVFKHLIEDCSWPSHRIHLFGFAQGGSVALEFGIKFWRQQQEKAKESTPEFDIPTYSLGSIVSISGPLLSYPTLSSSSPTPVLAVYRPPPAE # PSLSPTNLAALKKGYSSVREAKLGARGPGMPSSKDEWEPIMRFWSEKLSRRQVDGLYEVMSGISAPK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g599 ### # start gene g600 Scaffold_19 AUGUSTUS gene 342854 343249 0.42 - . g600 Scaffold_19 AUGUSTUS transcript 342854 343249 0.42 - . g600.t1 Scaffold_19 AUGUSTUS stop_codon 342854 342856 . - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_19 AUGUSTUS CDS 342854 343249 0.42 - 0 transcript_id "g600.t1"; gene_id "g600"; Scaffold_19 AUGUSTUS start_codon 343247 343249 . - 0 transcript_id "g600.t1"; gene_id "g600"; # protein sequence = [MATMSTIGSMSSMGSMGTNITTPDMSLLNPGSGATTPGSVKDVNNPSSGTASANVPGASTLTPVSALPLPSPSPNPHS # GSSPVSTTSYEDDLQLAQLGLAKVAEPDTDAFMTYAAIVGEYARLDGVVIRGT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g600 ### # start gene g601 Scaffold_19 AUGUSTUS gene 343876 345030 0.43 - . g601 Scaffold_19 AUGUSTUS transcript 343876 345030 0.43 - . g601.t1 Scaffold_19 AUGUSTUS stop_codon 343876 343878 . - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_19 AUGUSTUS CDS 343876 345030 0.43 - 0 transcript_id "g601.t1"; gene_id "g601"; Scaffold_19 AUGUSTUS start_codon 345028 345030 . - 0 transcript_id "g601.t1"; gene_id "g601"; # protein sequence = [MAIRVGTCAQASLVAAQLLMVREAWPQEVWARTGRIQVASAFLSSLVCGKWVPMSEAEACATGLWVHGVNGQQGYWDE # GVLDIVGGSREEGRRVRGWLGEVDVSGGGRKVGNVSRYLVDRFGFDPETIVTSFTSDYLASYLSCVPSSDPSTGATAVLQFGPMDMLLTPAARYIPSQ # SYSLFPHPAQDPTEKRRYVAVLTSRNADIPRALVRDMYTKSWSAFDRLVAIVPPGGSIGLDDKLFSFWHLQADSYPYSHVKGIYRFESGVKVSEFRDL # RANPRCLIESQVLAFRIRWMSIVANGVQGTASMNGEGGSAALSNPFASLGLSFNPYTSTPLPRRVICTGAATNFPSVANLVGDAFNATIYVPASQVDS # AQVSQNSWILKY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g601 ### # start gene g602 Scaffold_19 AUGUSTUS gene 356414 357583 0.99 - . g602 Scaffold_19 AUGUSTUS transcript 356414 357583 0.99 - . g602.t1 Scaffold_19 AUGUSTUS stop_codon 356414 356416 . - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_19 AUGUSTUS CDS 356414 357583 0.99 - 0 transcript_id "g602.t1"; gene_id "g602"; Scaffold_19 AUGUSTUS start_codon 357581 357583 . - 0 transcript_id "g602.t1"; gene_id "g602"; # protein sequence = [MSAFWSALAFAFDPSDGDDGVNYSLPAPLTWGVIKGLQLRNIRYWAHTQPGAFDRSGILTLGFAYPNHNLLENYNSPG # SPYWACKAFICLALPETSLFWTEEEEDYPSSLLNTTKVLKHALQITTNIGGHTYLLSSGQQCSYPVKQSAAKYGKLAYSAAFGYSVPVASLTLEELGG # DSTLAISGDGEETWKCRRVTKEARFEGTDERQWLRSMWYPFPDVEIETWLIPPTLDAPLWHLRVHRIRMHNGDRVLSTAEGGWAIYGQGQDERALEPV # QYGEHSESEGTFAAGGLARLVSRAGVAGIVDLSPEAIRKGQALRTDANTNLIAARAVLPVLRAGYKEKDTDIWLVSAVFGLPFDRGDSNKNKGWMVEW # MKRPVLPKEILERISKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g602 ### # start gene g603 Scaffold_19 AUGUSTUS gene 357977 358563 0.69 - . g603 Scaffold_19 AUGUSTUS transcript 357977 358563 0.69 - . g603.t1 Scaffold_19 AUGUSTUS stop_codon 357977 357979 . - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_19 AUGUSTUS CDS 357977 358445 0.7 - 1 transcript_id "g603.t1"; gene_id "g603"; Scaffold_19 AUGUSTUS CDS 358559 358563 0.69 - 0 transcript_id "g603.t1"; gene_id "g603"; Scaffold_19 AUGUSTUS start_codon 358561 358563 . - 0 transcript_id "g603.t1"; gene_id "g603"; # protein sequence = [MDDVASFLTSILDALEPYTSPNGARIHLGYTATHFDEVAAQLEGFSRPIWGLASLIAGRGSYDGVSRWRSGLASGSDP # KSEEFWGNMRDKDQRMVECSAIGYALSVAGQELWAPLSETAKENIGNWLGGMNDKEMPNTNWLWFRVQRFVTIFLTLTD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g603 ### # start gene g604 Scaffold_19 AUGUSTUS gene 362373 362678 0.6 - . g604 Scaffold_19 AUGUSTUS transcript 362373 362678 0.6 - . g604.t1 Scaffold_19 AUGUSTUS stop_codon 362373 362375 . - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_19 AUGUSTUS CDS 362373 362678 0.6 - 0 transcript_id "g604.t1"; gene_id "g604"; Scaffold_19 AUGUSTUS start_codon 362676 362678 . - 0 transcript_id "g604.t1"; gene_id "g604"; # protein sequence = [MPTGELQTSEILRSILEIGLSHDLMANGYFSERPSSVGNKSLFVPKVTQTGAMEFLKVENQSDLDALPSGKWGIREPS # YESDAGPRLNGLFKFVVSSTASL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g604 ### # start gene g605 Scaffold_19 AUGUSTUS gene 363212 364663 0.49 - . g605 Scaffold_19 AUGUSTUS transcript 363212 364663 0.49 - . g605.t1 Scaffold_19 AUGUSTUS stop_codon 363212 363214 . - 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_19 AUGUSTUS CDS 363212 363618 0.55 - 2 transcript_id "g605.t1"; gene_id "g605"; Scaffold_19 AUGUSTUS CDS 363781 364663 0.86 - 0 transcript_id "g605.t1"; gene_id "g605"; Scaffold_19 AUGUSTUS start_codon 364661 364663 . - 0 transcript_id "g605.t1"; gene_id "g605"; # protein sequence = [MNDQLDPNSFSPSNIQSPSSTSSLTIPYSFPQSPSTLTHTSYPQSSLRYALCDPDPEYQPRGTSAQRDKESDSMQKNG # AYKVYQSYSTGLPSFQEDSCETDCELGATGSGLAPPKNDVHAAYEHPQNISDIISWHNPYDSHMVDSPVVLSPSARRNFESSMMTSFESATGHRGYFE # QDTNRARSPSILINTGNSWHSTNTPCRDIRRRPSPYALLPALQFPDELQPRSPDTEESTSVTPVDNHTRQAIPDHDANEPTAAVKKKKAKMHACKLCG # KNFPRPSGLKTHMNAHNNHKPSMVPRSTAPDFEVNFDEPVVQDHDHELNSVVPQLKWMPPSLSSRTNAASLRSISEDSDSDWEDGKEDPIVEHCALSL # PIPLQPVVPSERGIPMQEPYVEEQVEERNSYEEAGIYPYHASQVPLLDLLYRTDIHD] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g605 ### # start gene g606 Scaffold_19 AUGUSTUS gene 365733 367897 0.54 - . g606 Scaffold_19 AUGUSTUS transcript 365733 367897 0.54 - . g606.t1 Scaffold_19 AUGUSTUS stop_codon 365733 365735 . - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_19 AUGUSTUS CDS 365733 366955 0.91 - 2 transcript_id "g606.t1"; gene_id "g606"; Scaffold_19 AUGUSTUS CDS 367077 367201 0.56 - 1 transcript_id "g606.t1"; gene_id "g606"; Scaffold_19 AUGUSTUS CDS 367257 367897 0.94 - 0 transcript_id "g606.t1"; gene_id "g606"; Scaffold_19 AUGUSTUS start_codon 367895 367897 . - 0 transcript_id "g606.t1"; gene_id "g606"; # protein sequence = [MLPPRWPSNSSRCVVTRFSLALLIVSAQALRAESVQYIVAPYEADAQLAFLERQGIVSAILTEDSDLLVFGCKNVLLK # FDPVARTVVSISRADFASVTATSLDSNGISLVGWSDNQFRAMAILSGCDYLPSIPGIGLKTACAMLRRWKTPQAVVRQIALEGKKRVPKGYLDQFRLA # EKCFLHQRVYDPSSEKLVYLSDVDLQSWDDLAEAYIGGDLEATLAKKLATGDLDPITLEPMIDINPGFRPSRMIRDIDKVIIFLIYRTKPYHTSATQV # SFKTDNDCWQGQRQANSGRGDGSRRGYEEEKILVLCPNITGTSSKFFVQSGVRRTSSATVQSRAGRSYSRAEKENIASEEMEPAFDGDSLIAQPCVDS # EIEEDFQFEASSVEQEDGYISPTPSISKDEEDFSSPPKPHPKHRVSPLADKDDFVDPISSPPAAQPSVSLQRPRRLFHSPSPVHIDLVKVLVEASPDK # RLEVKGGIVDLRDCFGDDPSSEIDYSGSDEDSATPPYPSPLTPDELIHQSQNRALITDSNFEELEPEDPEEKELKASASRTQDVAARWQERWAHGSSY # PNTAFLKRRETNITPTGRHRLQPHSQRTAYGDVYRSTLDSPVDTNRNRKSLTFFDGNWDDNGKGKFNTKMLDFDTENTEISAQARTRLKVERFR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g606 ### # start gene g607 Scaffold_19 AUGUSTUS gene 376380 377147 0.25 + . g607 Scaffold_19 AUGUSTUS transcript 376380 377147 0.25 + . g607.t1 Scaffold_19 AUGUSTUS start_codon 376380 376382 . + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_19 AUGUSTUS CDS 376380 377147 0.25 + 0 transcript_id "g607.t1"; gene_id "g607"; Scaffold_19 AUGUSTUS stop_codon 377145 377147 . + 0 transcript_id "g607.t1"; gene_id "g607"; # protein sequence = [MIFQSTFSTFCSEDAVMQANNDVTEALQRTLSLMQGELERSVLTTQMLGMSARKQDFSYAQVPHNLDSSMSTLRATSS # THDVLSNAMDASKQLITALQKSDRMDRLLIFFGLILFFLSVSIVLKERVLDRSVRLAFWWTRFLPSGKSPVFVPNVSSSVVSGASASLSETTIIAYTS # SVLATATAAATSATSLTSILLPTHESASDGDFLSSATVDSTQALSIISTESSREPSSSSTTDAERVLASSITVNPPDEL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g607 ### # start gene g608 Scaffold_19 AUGUSTUS gene 380354 381543 0.7 + . g608 Scaffold_19 AUGUSTUS transcript 380354 381543 0.7 + . g608.t1 Scaffold_19 AUGUSTUS start_codon 380354 380356 . + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_19 AUGUSTUS CDS 380354 380727 0.76 + 0 transcript_id "g608.t1"; gene_id "g608"; Scaffold_19 AUGUSTUS CDS 380829 381543 0.73 + 1 transcript_id "g608.t1"; gene_id "g608"; Scaffold_19 AUGUSTUS stop_codon 381541 381543 . + 0 transcript_id "g608.t1"; gene_id "g608"; # protein sequence = [MASSSSFRNHRILVASLFLPHTAVLGPDPADERVLSIDYPSEDDGATTPIEPNTPSDVSAPESVRTFQNEKASTILTS # SGSMTQSAAGFIAGQPLSIIEDLRDRAAAEESVQERADRLATHYLDEKFQLTLPSTGNNPSPLSHTAAPDGINEPSSVSFSSPASRSSTVAHAAALKR # NLSRQRNRNIVSPKRSSSRTAKHTPSASIASLASASSVASFDSLESISTRLDEEIEEGEEEFHIAPNPHVNGGLKNAIDSVSAAMMHGFTPQAASAPP # TKTSFSAKSHVPGHARSMSSTSVSAAYGQSSEFSRLWIGCLGTKTDDWNLKLKERVEEALPRQEGGVEVPVWLRIVFLRDVMMNFVIR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g608 ### # start gene g609 Scaffold_19 AUGUSTUS gene 383229 383681 0.46 + . g609 Scaffold_19 AUGUSTUS transcript 383229 383681 0.46 + . g609.t1 Scaffold_19 AUGUSTUS start_codon 383229 383231 . + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_19 AUGUSTUS CDS 383229 383681 0.46 + 0 transcript_id "g609.t1"; gene_id "g609"; Scaffold_19 AUGUSTUS stop_codon 383679 383681 . + 0 transcript_id "g609.t1"; gene_id "g609"; # protein sequence = [MPRDEARTRWEELHNHVITQTAQAFVVNFLTRCLRANGEHIFHKDIERAGAVRVLDEKAILDKWSSQTQGRKLILVDW # EGTLIGDYLPAGAPGATPEREIQKEEEFKAATTILKKLVAQEEKNEVWLLSGLPIKVLERISKEVGGRIGIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g609 ### # start gene g610 Scaffold_19 AUGUSTUS gene 389354 392564 0.76 - . g610 Scaffold_19 AUGUSTUS transcript 389354 392564 0.76 - . g610.t1 Scaffold_19 AUGUSTUS stop_codon 389354 389356 . - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_19 AUGUSTUS CDS 389354 390026 0.81 - 1 transcript_id "g610.t1"; gene_id "g610"; Scaffold_19 AUGUSTUS CDS 390202 392564 0.8 - 0 transcript_id "g610.t1"; gene_id "g610"; Scaffold_19 AUGUSTUS start_codon 392562 392564 . - 0 transcript_id "g610.t1"; gene_id "g610"; # protein sequence = [MLNQLSEPLKEALTKSLHPDSAKIPLYSTSSSDLRTKAARDADYWVHNMVSPVHLKSAVDAAAEDGYRIFIEVSSHPI # VMHSVIETLVARNIDENDFATFSTMKRDTLASKTISNAVAQLYTKGAHINFEALLGPKQLWSKTVPGTPWVHKSYWKQVESGPLGEGITHDVEKHTLL # GQRVPVAGSETIVYTTKLDDKTKPFPGTHPLDGTEIIPAAVYINTFHYATGATELSNISLRVPVSSEYRFFPVDNNLLTNVLVGPETRNVQIIVQGDT # VSVASSAISDADKQSWVSHGSVKWSNVHRVAPPDQPFDVESIKKRIGTRLPNSFSVDYLTKIGVAGIAFPWQVVEHYGNEKEMIAKVDMDPAVEKLPW # DERSWAPMLDAATSIGSTIYFNDPKLRIVSQIDTVSLYATGSIPKIGYLFVEEAADAKGPASHVSVLDEQGVILAKFTSMRFSEVEGASGSGGGLDSL # VHHISWIPPKFSEKPRVLDQVVLVSTDSEVLDTYAKQLEPQVKKLFKLSSVEQLENPDILSALGEKDCTSPVLKLRLLWVLGEKGSAVFYIPSSVETL # EEVSAASKDFIWNTTSIAKLLLEKSLASSCKFYVITNRAYAGETTTGLAHSALYGLCRIIAAEHPDIWGGLIDNESSTVFPLLATKYVQNQDIIRVVD # GMPRCAMMRPLPRDQRYTPQNAKTLLPKPEGTYVITGGLGDLGLETINFLVEKGARRIVTVSRSGLPPRSTWLDRSSDDPKFAAMVQRIQEFETLGAT # IYALSLDISTPDASDKLLAAIDSLIGQLVGTAGQASYGSGNAFLDGLAMYRRAHGDNAVAFQWTAWRGKGMATSTDFLTLELQSKGITDISSEEAFRA # WEHVGKYNVETAVITRCLVLDEGEAVSVPMLDQVVVRRSRATNGSAPATEEGSNTSSDARPTAPAELEKWLNVKIRECIGAVLMIPDIDDIDPLVPLG # ELGVDSVMTVALRQKLQSALKVKVPPTLTWNHPTVNHLVPWFMAKFKEESG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g610 ### # start gene g611 Scaffold_19 AUGUSTUS gene 392702 394402 0.7 - . g611 Scaffold_19 AUGUSTUS transcript 392702 394402 0.7 - . g611.t1 Scaffold_19 AUGUSTUS stop_codon 392702 392704 . - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_19 AUGUSTUS CDS 392702 394402 0.7 - 0 transcript_id "g611.t1"; gene_id "g611"; Scaffold_19 AUGUSTUS start_codon 394400 394402 . - 0 transcript_id "g611.t1"; gene_id "g611"; # protein sequence = [MGVDSDDYSRLLLEDLANIEAWMGIGTAAHGIPNRISYHLDLMGPSTAVDCACASSLTAVHMGCRAITNGESRVAIVG # GVNVLLAPALTRMLGKAGALSPEGICRSFDDEANGYARGEGGAIVILKSVASAIADGDNILAIVKGSAIAQDGKTNGIMAPNAKAQELVARQALARAG # VDPLTVSFIEAHATSTPLGDPTEISAIQAVYGEGAGRDALKPAMMGSIKPNVGHLEAAAGIIGLVKAVLSVNKGQLAPQTRLNKLNSRVDWEKSGLQV # VREVTNWSNESGPRRAAVCSYGYGGTVSHAIIEEFVGRTFEALLDPKPPTAGPTLLVLSAQQEKRLAQQAKSLAEWLSSAGKSEDLNAVANTLAQRRA # HHDYRAAFFVNNQSEAIEALNKFAAGNQDDADPIASGRVLGNGAGLARHAVWVFSGHGAQWKDMGKELINNLVFRRVIDLLEPIYQNEAGFSLVQALE # HGDFETSDRVQSVTYAIQIGLLHVLKATGLEPEAVIGHSVGEIAASVAAGCLTLEEGALVVIRRAKLYAKVQGLGVWHLLIFRSLRLQRSSKAEQT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g611 ### # start gene g612 Scaffold_19 AUGUSTUS gene 399625 400677 0.36 + . g612 Scaffold_19 AUGUSTUS transcript 399625 400677 0.36 + . g612.t1 Scaffold_19 AUGUSTUS start_codon 399625 399627 . + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_19 AUGUSTUS CDS 399625 400677 0.36 + 0 transcript_id "g612.t1"; gene_id "g612"; Scaffold_19 AUGUSTUS stop_codon 400675 400677 . + 0 transcript_id "g612.t1"; gene_id "g612"; # protein sequence = [MENRGNNERRTPRRLFSFDSVKSSSTRRSSSDTPYNIERKASKGSLHTIASEQSEGNTNWTLPDITESPRSVTPRPTT # PFSERDKRKGPRPPLPPVVVDATARSVTPDGLPPPSPSSIRWNSLRQHVLPPSKSTHSQQSSSASLTSISTQAAASRTGHAKQSSKFAQRLGFRNVVD # QAKQVMVDEIQQFAHDIQRACMAAYHIELPPAVKSRIDPLHIPVGSTLSLPFISSSNLTVGGITGSANPSRSDLRQPSVSSSIAAGRVRPLYQTLINY # AGPFADASSPLPQLPLESLVISTLLVPFLTTDSASATEEDRWLGIEAFQIVIKTWNPTTEVCLHCSTLVRTLLIKI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g612 ### # start gene g613 Scaffold_19 AUGUSTUS gene 401731 402144 0.72 + . g613 Scaffold_19 AUGUSTUS transcript 401731 402144 0.72 + . g613.t1 Scaffold_19 AUGUSTUS start_codon 401731 401733 . + 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_19 AUGUSTUS CDS 401731 402144 0.72 + 0 transcript_id "g613.t1"; gene_id "g613"; Scaffold_19 AUGUSTUS stop_codon 402142 402144 . + 0 transcript_id "g613.t1"; gene_id "g613"; # protein sequence = [MSFLQRLVDEPPPYPCLPLSSLLDSLSQSYPQIFYKPLFQCAASTREHVVVKHLCTLTALARFIPDFWIKDAEMMSIA # IMGDMGMKIPGSGTTQGIPGVVEPWGTARLGQSVLIVELIAQVQSMRRVRENSTVSKNS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g613 ### # start gene g614 Scaffold_19 AUGUSTUS gene 403137 404522 0.47 + . g614 Scaffold_19 AUGUSTUS transcript 403137 404522 0.47 + . g614.t1 Scaffold_19 AUGUSTUS start_codon 403137 403139 . + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_19 AUGUSTUS CDS 403137 404522 0.47 + 0 transcript_id "g614.t1"; gene_id "g614"; Scaffold_19 AUGUSTUS stop_codon 404520 404522 . + 0 transcript_id "g614.t1"; gene_id "g614"; # protein sequence = [MSTLANSRFQIMSQHVIADRAHRPFKVARPPLPFVTTDIGSGTFVLELDPSEVQDKLPLELRKKLAEIGWEDGGSPVN # QQLEWIRTPMSNLPPLQVEKLDSSGNVPPSPNLSPVSSPSRSPILGEKAEELGLLRRNSTSGGPLSGFKRRAIFVPSLLQILPRIAAMTCDRSPVVAH # AARTMILDLMRNDPGLLTRPVWDFLTGEGQDLSIAVTTLRAFLHSRRVLPPSMAHVMLNTLAGFLKDLAKHTENAHTLQYFAQTVPIIAKLVPQVYEM # SVRDLRRNKVDVFLIPSGSLWFSSPAPPGPMFPRGPGVFDNPFDDCTTRIVSITLIRISQNMLFFAMLKRNPSEVQAVRKSMTKLVFPSLTGAEEPDP # QLRDLVPSKKPSVPASSAIDVEIRGLSLTLSRSFILLVAQIFRCLSRHLNDRTELSILVESLNRILLAHGNDVGIVAQTLIGTIFLCIL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g614 ### # start gene g615 Scaffold_19 AUGUSTUS gene 405040 407109 0.89 + . g615 Scaffold_19 AUGUSTUS transcript 405040 407109 0.89 + . g615.t1 Scaffold_19 AUGUSTUS start_codon 405040 405042 . + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_19 AUGUSTUS CDS 405040 407109 0.89 + 0 transcript_id "g615.t1"; gene_id "g615"; Scaffold_19 AUGUSTUS stop_codon 407107 407109 . + 0 transcript_id "g615.t1"; gene_id "g615"; # protein sequence = [MSNFIRLFLTVIAHDLSIARAEQFLKLFRYLVPSLYETSASARTVLKDGLVALGAILLRPTLSKARAAEYSRQNDAQF # EKGYPSEMHLADLSKLPSDMASMRMDYLWSLVSFAEIGGELNPDTVRTAFDLVKTILRESPTTALYESIASFLAAFSKRSMEGGKRLKTVVHFLRDLA # PILNEHAHAIDFTEVFDTVSQLSKNPMYFNDSIFCNLVVNQICAAGLRACDAAASEDSLQSLPGRRSLISLIKNAILLPGADIFNQIEGSKASHNFLA # LVILPLALTMKTLNEMNSDGAQRDPVQRALQARAWSRLLLYVISCCRKTQGKGSPNLERSKSQDKHNSTIGYGTHLPSLLVALQVIKVIVIRAGEDLN # HSLPDMWLRLAVFLREVLGDGNAEFSLRSDENSPNPSPTPSPRSSGQFNIPFLRPNTANFGVSRGFMSPRIVDYCLWSFLELLCVYRNPLFIQLRAFV # HEKVRILDQELRYQQDSHTPISSRARRPSSVFTKSRRRTSNISASNSPEASPRLTSLATPDLSFSGNFSLYQNLPTPSATSYSPLRESSPSAPRPRIV # HLGLVSNTNTFRRSLSPGGTSAMRHMVKSTKVKSLILVRKTYLRIRVVQTCMGYQSELLPLPQTSIDSASGMDDIPVATPWTKRRALHEVVNETRELL # VEFDETNELESEGVLIQDIDALQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g615 ### # start gene g616 Scaffold_19 AUGUSTUS gene 407516 408001 0.8 - . g616 Scaffold_19 AUGUSTUS transcript 407516 408001 0.8 - . g616.t1 Scaffold_19 AUGUSTUS stop_codon 407516 407518 . - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_19 AUGUSTUS CDS 407516 408001 0.8 - 0 transcript_id "g616.t1"; gene_id "g616"; Scaffold_19 AUGUSTUS start_codon 407999 408001 . - 0 transcript_id "g616.t1"; gene_id "g616"; # protein sequence = [MGGSIGRRAGTPAAEYLRWNGPESPYSPSKSFVDVPAQEDEDDLDFELHGDSFSDDGFEGLENVRACCDGRHTVGHSG # KHHHHHHHHHESDSQNGDHNHTGSSNNGPIRPVSPSAWSFRSRTGSANSHEGGSASLFSWGRGRTEDGKSKFGSRRSTKTVQS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g616 ### # start gene g617 Scaffold_19 AUGUSTUS gene 408890 411508 0.27 - . g617 Scaffold_19 AUGUSTUS transcript 408890 411508 0.27 - . g617.t1 Scaffold_19 AUGUSTUS stop_codon 408890 408892 . - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_19 AUGUSTUS CDS 408890 410532 0.93 - 2 transcript_id "g617.t1"; gene_id "g617"; Scaffold_19 AUGUSTUS CDS 410680 410707 0.82 - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_19 AUGUSTUS CDS 410873 411508 0.29 - 0 transcript_id "g617.t1"; gene_id "g617"; Scaffold_19 AUGUSTUS start_codon 411506 411508 . - 0 transcript_id "g617.t1"; gene_id "g617"; # protein sequence = [MSELGAYDDAFGDEFADSPEGSPLPGSPFRSANHPLNEIEVLQQRLAHAQRQILTLKGTLQREKKEKLDLRRKYEVQG # PEEEDDAEKDMDMEEEEVGDDTVGPNSTLNPVSGKRRGLMTFKVGVGRGIRGTGRGRGRGRGGITLTERLNFAAHDQDDEDRFSLERDTSMPAVPAMP # VHFTDEDAFDGLEGEDEDQVPDQMGFQASPSQPPRTEDEREVVLLETAEFGCQTEPEPIIIPVPAPSLPQKLMSEASVQHEPEPEPLTIPVPAPSVSQ # KLMSEASVQHEPELELVLELPPIPVPDLVEASMQTAPEPVVDRDEVGVQHFPPLVSMSTSTEPPPTKYDVEVEARMEEAIRERRDTLVPGDVSIGSSV # GDSTIKNAPGRAFLSSSAVGHGDEIDDGGEETETGPDTEIDTDDYEDATQSIIPSTASASRDDFHSMMTMTDSEVSDSDDDGESIKASRLPVRRPHAP # SLFRTSSFYETPAGSSSEARVMTPPTLYDSKSVEVDILPELPTIAPKPEVKEMSTQTDDWVPSVLAPVGLSPAGSSAPSSGSPALYRVGSSSKHQFQF # IPPAPLQAPYSAPVSVPTPSPSTNVFKETPTGFATIMSNTRSSHDRRQSMDSVVSSVIDDVANTGTRSRIPSTLLVDKTRPPMMSLPPPPRAPPPPGS # MPPPSFIPERRIPTNSTGSSDAPPPRPSSPPPPELIQRATTPTFGSVLSVPGGKGSGFALRQHGSSMPPSQAGLRQPPSTSSFRSAANATAYHQHGAH # VIPR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g617 ### # start gene g618 Scaffold_19 AUGUSTUS gene 411762 412097 0.98 - . g618 Scaffold_19 AUGUSTUS transcript 411762 412097 0.98 - . g618.t1 Scaffold_19 AUGUSTUS stop_codon 411762 411764 . - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_19 AUGUSTUS CDS 411762 412097 0.98 - 0 transcript_id "g618.t1"; gene_id "g618"; Scaffold_19 AUGUSTUS start_codon 412095 412097 . - 0 transcript_id "g618.t1"; gene_id "g618"; # protein sequence = [MKEEKDDLEASVESLRKALKQQEQSAGKLAEVLCFFHTLRYLNIHLDKYKEENWNLEVTLQDLRTQLSNAQSTNSRLD # SNRSVSPNSLLLLGTLPSSSRMRLANYKVPLRN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g618 ### # start gene g619 Scaffold_19 AUGUSTUS gene 414773 416089 0.19 - . g619 Scaffold_19 AUGUSTUS transcript 414773 416089 0.19 - . g619.t1 Scaffold_19 AUGUSTUS stop_codon 414773 414775 . - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_19 AUGUSTUS CDS 414773 415723 0.62 - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_19 AUGUSTUS CDS 415829 415866 0.23 - 2 transcript_id "g619.t1"; gene_id "g619"; Scaffold_19 AUGUSTUS CDS 415954 416089 0.28 - 0 transcript_id "g619.t1"; gene_id "g619"; Scaffold_19 AUGUSTUS start_codon 416087 416089 . - 0 transcript_id "g619.t1"; gene_id "g619"; # protein sequence = [MSTQYDLVGKPFPPMTSPNSAYSFDFGRDNISAPTTERWHNSHRSLIPPHRTLSRTHYLALHGGVAHHLHHLPLFSTP # YTFSSPFVKKEEPDSPKFIIEPLLPSSLVTKRSSSSSPEPCSSPTQAELESQLLLSQALAPPTEVPLRATQACDDMRQMMRSFRLNPFSIFTSNGKDL # KSDISDCSDLDPVVTWCGEIAKPLDEEPLIFEWQLDDYRSGLEGELPQLIVLDDVEGSLDITDPEDSILEATPREDPESPMIFSPSESLLSSEVASRS # GFSTPVETEFQRTHVDLPATLPNTISFFPNFGPKQVETKQQRDGSYDSGYESNASLTNPLPVYDSECLANSFHGRSLDSGTYNPSYKKPRFSFHADDS # ER] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g619 ### # start gene g620 Scaffold_19 AUGUSTUS gene 423283 424758 0.43 - . g620 Scaffold_19 AUGUSTUS transcript 423283 424758 0.43 - . g620.t1 Scaffold_19 AUGUSTUS stop_codon 423283 423285 . - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_19 AUGUSTUS CDS 423283 424758 0.43 - 0 transcript_id "g620.t1"; gene_id "g620"; Scaffold_19 AUGUSTUS start_codon 424756 424758 . - 0 transcript_id "g620.t1"; gene_id "g620"; # protein sequence = [MDLPCTNPCSDDPRSEADGQVFFINKFAKPLLELMVEAVPGERRFRLSRSTRRPNSIWSVELQPHLDQCQDNLRLWQS # RQVDVKPVLETAEKTNSADFLPASSSASLISTTSSSSTRRRRDDYLTAFPLALPKHHPYRNISHVDRIQYSPVGEDDGGPEKDVNSQDIVETAQECPD # FDRIATSLLPRSSTSTATSATLVWPSSAIIGSNQQKDQSCLSPPSQNVALPRAQPTNEEGGKHAGRSASSSSSASASASFSNSSLSSPYESGSDISSS # SVSGDSEYMSVADWNSISGESHGVASSYRTSGDGYDHITGVDRIGGNSNRGRNDSISSQSQDHQFVRGHLRSITSTISSANEATSGSCSYGTTHIQDP # HAGLRAAAVSAQPMLRKQRSMLNRKSWGAPGEYAARSSSNCVSSSACTVASLHNASLRPPPLSSPAALGDGFGKSQLIPSESPSARTTPKATKNLRRP # TIVIAQPHSHPREIGVNLLPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g620 ### # start gene g621 Scaffold_19 AUGUSTUS gene 431383 432868 0.14 - . g621 Scaffold_19 AUGUSTUS transcript 431383 432868 0.14 - . g621.t1 Scaffold_19 AUGUSTUS stop_codon 431383 431385 . - 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_19 AUGUSTUS CDS 431383 431762 0.99 - 2 transcript_id "g621.t1"; gene_id "g621"; Scaffold_19 AUGUSTUS CDS 431830 432022 0.95 - 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_19 AUGUSTUS CDS 432072 432179 0.88 - 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_19 AUGUSTUS CDS 432629 432868 0.14 - 0 transcript_id "g621.t1"; gene_id "g621"; Scaffold_19 AUGUSTUS start_codon 432866 432868 . - 0 transcript_id "g621.t1"; gene_id "g621"; # protein sequence = [MASSLNSLEGEIETQNALFNELRLSGSDPAGLEEVKKKLGELKKSLGQAKAKAAADGATASGSKEVAGKKKERILLKT # AKDFDISGTWDPMIPDAEIISLICTILSKIDVGEFTIKINHRKILDGIFEVCGVPADKIRTISSAVDKLDKLPWADVKTEMTEEKGLDPSVADKIGEY # VKHKELLAKLLADSALSANPSAKQGLDDMGLLFTYLSAYNVIDKISFDMSLARGLDYYTGIIYEAIVDASAPPGFKANPSVGSSTTPSPALPKKKVTK # KLRTKTAKKKKKLMNLKLASDRLLRVVVTTGS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g621 ### # start gene g622 Scaffold_19 AUGUSTUS gene 436307 437593 0.62 + . g622 Scaffold_19 AUGUSTUS transcript 436307 437593 0.62 + . g622.t1 Scaffold_19 AUGUSTUS start_codon 436307 436309 . + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_19 AUGUSTUS CDS 436307 437593 0.62 + 0 transcript_id "g622.t1"; gene_id "g622"; Scaffold_19 AUGUSTUS stop_codon 437591 437593 . + 0 transcript_id "g622.t1"; gene_id "g622"; # protein sequence = [MSFPRAVGRHSALFTALIDQERGTIAAFYNAKLAEVEGQLKAALDETEFLRMRNSKTSLSQQKLQQQLEVTKQTGRDE # VRRTRSVARVLISFLRKCAAKLDAVQEESKRQLAALEDKQFTRRELDAICAGYISQVQALERDRQDALEAKSSAMREANNFKATIVQLEESLAEANTA # NSSLRKYAFTFREQKLALERELSNVRESSKVEQHHLSQEIAQLQRDLTSCSEKAIHDASSHESKVKEAVERTNTLLRQLERERRESGSIFIALRRQAE # GASLASQQKDHQLSSLRAQHLQTEIALAEATQKIERYAQEVGDLRSALSRTEIACRTVETERDTALSSIERGTPAAETCSVLQELVVSLAFLRRSQLS # DVRAHAEQQMAELRRQLSIVQEQGQLERKALDKRISELVAVLYHHEFGSFDLELDV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g622 ### # start gene g623 Scaffold_19 AUGUSTUS gene 437915 438637 0.29 + . g623 Scaffold_19 AUGUSTUS transcript 437915 438637 0.29 + . g623.t1 Scaffold_19 AUGUSTUS start_codon 437915 437917 . + 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_19 AUGUSTUS CDS 437915 438206 0.29 + 0 transcript_id "g623.t1"; gene_id "g623"; Scaffold_19 AUGUSTUS CDS 438264 438637 0.69 + 2 transcript_id "g623.t1"; gene_id "g623"; Scaffold_19 AUGUSTUS stop_codon 438635 438637 . + 0 transcript_id "g623.t1"; gene_id "g623"; # protein sequence = [MTDNAYFDEGNITEAERPFLETTGLNLSVVDPEHLPFSENISSKSVDVLEISKKISDGDTTTTTSPKRKRRPPEKDSK # SARKVPWTESPPVRQILMVPKTTLVIKRSRESQNDSTGERNPHKRSRKDKETVALTSTSTPAGSSTGSPTVAPGRKFAYVEIISSRKPSSSRSRIRTS # GVGPTSSATDSSTENVTAMNTVSKDRRVTTMRPAGIIRKVSPEVL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g623 ### # start gene g624 Scaffold_19 AUGUSTUS gene 442391 443875 1 + . g624 Scaffold_19 AUGUSTUS transcript 442391 443875 1 + . g624.t1 Scaffold_19 AUGUSTUS start_codon 442391 442393 . + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_19 AUGUSTUS CDS 442391 443875 1 + 0 transcript_id "g624.t1"; gene_id "g624"; Scaffold_19 AUGUSTUS stop_codon 443873 443875 . + 0 transcript_id "g624.t1"; gene_id "g624"; # protein sequence = [MQIAHPVALASGQRIRREGLRSAEKIISAENTTQTGSSESSQVAESPIIVQPHVQSVSCSPPSSPSTHLSSDDEIMSI # RVNESGRIELSSNKNGPCVKPGSVLSPEDLDDLYEDARRYAKSRAKDDIENVREVIAEAFSAQVHRDWFRSEKNVHLALALESIDSADASAPSTFPFL # DVLRRKFCGHDWAQVHAARRDELHMNVGGVGCFDEYLSQVEGCNSRLKGVGNYLTPPQLLTILARGITPTLTAILSEQGIVIDEDTTYKSWVSACRDL # EVRFKTRLSSADRQGRRGALPYNSGYSSANNNPTHKRNATSEPSSYPNKRPSSAGGSATNGSNGVFYMKSFKSMPEALQKEQRELLGRIKACPKCRTA # WATCGSNLDNCPGATLSVPWRPLTTEMVDWAISAHKSTNRPILYNAILKQAATKTPVASIHGPPLEDISAYVDNGGNRAPVAAAIYGTLPVSHVAQGT # EVYGSFAAPALLRSHSVASSSRAN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g624 ### # start gene g625 Scaffold_19 AUGUSTUS gene 444517 445938 0.42 + . g625 Scaffold_19 AUGUSTUS transcript 444517 445938 0.42 + . g625.t1 Scaffold_19 AUGUSTUS start_codon 444517 444519 . + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_19 AUGUSTUS CDS 444517 445938 0.42 + 0 transcript_id "g625.t1"; gene_id "g625"; Scaffold_19 AUGUSTUS stop_codon 445936 445938 . + 0 transcript_id "g625.t1"; gene_id "g625"; # protein sequence = [MELKKTVLLEFQGYVRDHPKLLLSDPVRPIDVAAAVRARVEQLSEIERLGKLSDDIKHRFADVFGDIPHLEELPTDIT # CNISLKDANLTMQSRGYASPRKYREAWSVLIEKHLNAGRIRPSSSQYSSPAFLVPKADPTALPRWVNDFRKLNANTIPDRHPLPRIDSILSDCAKGKI # WGKMDMTDSFFQSRMDPASVPLVSVQTPLGQYEWLVMPQGLRNAPAIQQRCVTQALREFIGRFCHVYLDDIIIWSKDEAEHAHHVQLILQALRDAKLF # CNPKKCQFFQLEIDFLGHHISQRGVEAQNNKCEAIVNYPSPSSASEVRRFLGMVRFVAGYLENLAEYTRILTPLTKKECDKCFPGWTLEHEDAFIAIK # TLVLSRNCLTTIDHDNPGDNHIFLVTDASDWRHGAVLMWGPTLDTARPVAFDSAQFSGPELNYPVHEKELLAIVPLLTQMACRPFGDACSCPHRPSNL # GEF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g625 ### # start gene g626 Scaffold_19 AUGUSTUS gene 445985 447688 0.45 + . g626 Scaffold_19 AUGUSTUS transcript 445985 447688 0.45 + . g626.t1 Scaffold_19 AUGUSTUS start_codon 445985 445987 . + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_19 AUGUSTUS CDS 445985 447688 0.45 + 0 transcript_id "g626.t1"; gene_id "g626"; Scaffold_19 AUGUSTUS stop_codon 447686 447688 . + 0 transcript_id "g626.t1"; gene_id "g626"; # protein sequence = [MSQFDLEIAYIAGEYNAAADALSRIKAGALPSDCPAADISLDEGNVQAWKANPFVCSSVLSLSADATFLSHIKEGYVS # DPFVKKLIESGSLVPGVEHKDGLWFVEGRLVIPAYLTLREDLFHLAHDTCGHFGGDKCYAMLADSYYWPNMRRDLYKYYIPGCEDCQRNKGRTARNGK # GPLHPLPVPESRCASVAMDFIGPLPVDQGFDCILTMTDRLGSDLKIIPTNVDVSAPALARLVFDHWYCDNGLPSEWVSDRDKLFMSEFWSVLNKLSGV # KIKMSSSFHPETDGSSERSNKTVNQAIRFYVERNQIGWVNALPKIRFDLMNSVNASTGLSMFQLRYGRVPRVLPPLIPMEDFVKSDPSSNAGDAHAFL # AHIKSTVQEARDNLTLAKVVQAYQADKVRGPCELFEAGEWVMLLTWHRREIFKKSGEKRVAKFFPHFDGPYEVLKAYPETSHYTLDMPNHPNAFPSFY # VDQLKRYVPNKSDLFPGRGRVIPEPTIVDGFEEFEIDRILDSRRRGRGWQFLVRWVDQGPSEDRWLSYSSLHKCAALDDWVRNGGDGPPVLLDSVDL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g626 ### # start gene g627 Scaffold_19 AUGUSTUS gene 460980 461825 0.96 + . g627 Scaffold_19 AUGUSTUS transcript 460980 461825 0.96 + . g627.t1 Scaffold_19 AUGUSTUS start_codon 460980 460982 . + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_19 AUGUSTUS CDS 460980 461825 0.96 + 0 transcript_id "g627.t1"; gene_id "g627"; Scaffold_19 AUGUSTUS stop_codon 461823 461825 . + 0 transcript_id "g627.t1"; gene_id "g627"; # protein sequence = [MSAILICKRVQVHRCVHFSKVIHIDTTSGASTDGNMKSKVSCTVVHHASCFVRDSEETLHQFQEQFVNASGPDYWGLP # ALEVDEGADAEKERLEGEEGAGKIKGYEKMGIDLAVSSPHHSQEQGIEFLMKPLQKLGTAEKKSTMAAEISSQSHVLAASLEGSSISSPQVRNMDSTW # ERDEQALLPRSLAEEMMFAEQAQVEQYHHDDEGVLVLSHQILADEDDEDIDVVDAEEDTEEDTEDAFEVVEIDEGGSVVLKEESKRKRGSNCDDIESV # SSSVCIV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g627 ### # start gene g628 Scaffold_19 AUGUSTUS gene 463957 464702 0.23 + . g628 Scaffold_19 AUGUSTUS transcript 463957 464702 0.23 + . g628.t1 Scaffold_19 AUGUSTUS start_codon 463957 463959 . + 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_19 AUGUSTUS CDS 463957 464231 0.23 + 0 transcript_id "g628.t1"; gene_id "g628"; Scaffold_19 AUGUSTUS CDS 464300 464702 0.74 + 1 transcript_id "g628.t1"; gene_id "g628"; Scaffold_19 AUGUSTUS stop_codon 464700 464702 . + 0 transcript_id "g628.t1"; gene_id "g628"; # protein sequence = [MGPASGGPPSSISAGGGVPPFNDPYFSRNDRDRDRDNVRERERNERIERDRERDAMRDRERDRAVDSRDPKRMKADRM # KSERPGMFQTPNLPPASLPKLPPPGSSSGPPPPSGPGQLSSGPGLPPPGSSHGLPLSSHPPGSSSAGPSPMMDVHPPANNGAVVPINTPGGGFPDEAD # LASLPAEYKREGTDWFIVYNPKVEKVFNVNLVHTLMHERYVHILFSVRG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g628 ### # start gene g629 Scaffold_19 AUGUSTUS gene 468846 469376 0.99 + . g629 Scaffold_19 AUGUSTUS transcript 468846 469376 0.99 + . g629.t1 Scaffold_19 AUGUSTUS start_codon 468846 468848 . + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_19 AUGUSTUS CDS 468846 469376 0.99 + 0 transcript_id "g629.t1"; gene_id "g629"; Scaffold_19 AUGUSTUS stop_codon 469374 469376 . + 0 transcript_id "g629.t1"; gene_id "g629"; # protein sequence = [MPPKTRAQSRANSEENTFFTTAQSFAPFSDSISAIGQPHRRNRGFGPATVPTMSTLPEAMEEEQQFEYSTLYTGDGQP # VQVLTPRRGQPPVVAPARGRSTTRIDSPILQAIACRTGKQPQRRAASESPRDPPPHFNLDAGDHDDQDPPVDPDDPGADNNNDDLDDDSGGLPRGEPW] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g629 ### # start gene g630 Scaffold_19 AUGUSTUS gene 469585 470622 0.94 + . g630 Scaffold_19 AUGUSTUS transcript 469585 470622 0.94 + . g630.t1 Scaffold_19 AUGUSTUS start_codon 469585 469587 . + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_19 AUGUSTUS CDS 469585 470622 0.94 + 0 transcript_id "g630.t1"; gene_id "g630"; Scaffold_19 AUGUSTUS stop_codon 470620 470622 . + 0 transcript_id "g630.t1"; gene_id "g630"; # protein sequence = [MLELLSGFKGSIETLGTVLAALGRPSDSSESKSKVKEPEVFDGSDPRKLKTFFVNLALVFNDRPKYFTDQRKVNYTLS # YLSGSAKEWLVPDILDPDLDSLPAWTSSFKALVKELQDNFGVYDAQGEAEDSLGNLKMKETENIQFNTLAASTNWDSAALKWAYGRGLAECIKDEMAR # LPEPATLADYRQEVLRIHNRYWKREETRKREAGKPFVARNPKKGSLDFKTGSSNQHNNSQPSGSSAPFTPKPKPFSGGKPNNNGKPQNSSNSGQSGGQ # RPAFNHLGADGKVLPSEKERRMKNNLCLFCGGKHQIADCNKRKARESKGCAAEVEETPEATVEAVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g630 ### # start gene g631 Scaffold_19 AUGUSTUS gene 475510 476943 0.89 - . g631 Scaffold_19 AUGUSTUS transcript 475510 476943 0.89 - . g631.t1 Scaffold_19 AUGUSTUS stop_codon 475510 475512 . - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_19 AUGUSTUS CDS 475510 476943 0.89 - 0 transcript_id "g631.t1"; gene_id "g631"; Scaffold_19 AUGUSTUS start_codon 476941 476943 . - 0 transcript_id "g631.t1"; gene_id "g631"; # protein sequence = [MFATSSYDSHPSCTISSIRELNSTSPHFRIHARLRGRNHSITTAAMVDCGATALFLNQDFVTRNHVRCAPLHKPIDVF # NIDGTPNRAGRITHFARLALTVDNQERWMDFLITNLGGEDIILGLPWLRKVNPEIDWEKGRLSVKPPRVTIEEVPDEEILYSHLAATHTETPILELPE # LEPPAENPHIEVPLEATLEPSESAAVEEPPIHRIRANHKTRRAWVKAGILEEQTEEVWCAAGFTYSQQLAEEANRDKPVKTFEEMVPEQYRDFKKVFS # ESASERLPAHQPWDHAIDLVPGAPATMRTKIYPMSLNEQEELDRFLEENLRKGYIVPSKSPISSPVFFVKKKDGKLRFVQDYRKLNEYTVKNRYPLPL # VADIISRLQGARYFTKFDVRWGYNNIRIKKGHEWKGAFATTRGLFEPKVMFFGLTNSPATFQALMNAIFADLIAAGKVAVYLDDILIFSNDLEEHRRM # VREVLTG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g631 ### # start gene g632 Scaffold_19 AUGUSTUS gene 476994 478160 0.88 - . g632 Scaffold_19 AUGUSTUS transcript 476994 478160 0.88 - . g632.t1 Scaffold_19 AUGUSTUS stop_codon 476994 476996 . - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_19 AUGUSTUS CDS 476994 478160 0.88 - 0 transcript_id "g632.t1"; gene_id "g632"; Scaffold_19 AUGUSTUS start_codon 478158 478160 . - 0 transcript_id "g632.t1"; gene_id "g632"; # protein sequence = [MSTPIPPAPNTSAEDLMAQLIRQVANLATAMEERSSSKSSMNKPEVFKGKDGAEARRFMAQFQNWASEQPDLAKSQVK # LIKSALGFFTESAGDWATPHLLHFNAENPPFGGNWEAFLKEFSQRFEPMDPGMEARSEIKNLRQSKGQTVAEFAQKFKDIGDRTEMSDIDLRERFFTA # LLPEIRQHLITVNIAQGIAPTLKEAIKRAISVDVYLHDPTMTGRNSGYPPTHTAHTTPADPHAMDIDATHTSNGNTREAFLARMRGRCFGCGAQGHVK # QNCPHRETTCRYCGRRGHLEAVCQDKFMGLGRDRGRRQQPRRQQISATGPAPFSLFPNESVQIASSTPTSAPAPVAATPSPPNQDFSNQIGQIRELLD # RANAMSSSSSGFQQGF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g632 ### # start gene g633 Scaffold_19 AUGUSTUS gene 483794 484183 0.45 + . g633 Scaffold_19 AUGUSTUS transcript 483794 484183 0.45 + . g633.t1 Scaffold_19 AUGUSTUS start_codon 483794 483796 . + 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_19 AUGUSTUS CDS 483794 484183 0.45 + 0 transcript_id "g633.t1"; gene_id "g633"; Scaffold_19 AUGUSTUS stop_codon 484181 484183 . + 0 transcript_id "g633.t1"; gene_id "g633"; # protein sequence = [MLQERRRKEGQYPSWWRGKKDETVTQNPTSSMAIGEPTLHYAMAASDSLHGTGDLYADSGATDHFFRDQNDFMTYTEC # DRMGQSSEISTGLVIKGVGKARRRLWKMGRSWYSSLKGHSIAPTFHPTSSP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g633 ### # start gene g634 Scaffold_19 AUGUSTUS gene 485137 485892 1 + . g634 Scaffold_19 AUGUSTUS transcript 485137 485892 1 + . g634.t1 Scaffold_19 AUGUSTUS start_codon 485137 485139 . + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_19 AUGUSTUS CDS 485137 485892 1 + 0 transcript_id "g634.t1"; gene_id "g634"; Scaffold_19 AUGUSTUS stop_codon 485890 485892 . + 0 transcript_id "g634.t1"; gene_id "g634"; # protein sequence = [MVGYKERGVYLLYLQNGTIITSRDVIFEEGIPQRTLAPGGGEEEEDQGNDEHVPILPPNATDTSDATDTLEKTMPTKP # DQILQIPNQNTTRQTRTKFQPDPSIPLRRSNRLSTPSQIPHPQQSQTNPPTQHRCSPGFRSAGIDEVSSEYNSALTAIGITPVPKSYSKAMEDPDRWS # PAIEKEIQRMKEFGIFGPLQDPPTGATILVPLWVLAHKFDGNGKIVEEKARLVVKRKDSGRGERLPPYVRSGTSF] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g634 ### # start gene g635 Scaffold_19 AUGUSTUS gene 489468 489776 0.51 - . g635 Scaffold_19 AUGUSTUS transcript 489468 489776 0.51 - . g635.t1 Scaffold_19 AUGUSTUS stop_codon 489468 489470 . - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_19 AUGUSTUS CDS 489468 489776 0.51 - 0 transcript_id "g635.t1"; gene_id "g635"; Scaffold_19 AUGUSTUS start_codon 489774 489776 . - 0 transcript_id "g635.t1"; gene_id "g635"; # protein sequence = [MSSKTAHTKKPPAVTVDAEDIWKQSAKTSSWDLDKTEADANRYLLRTRAILPFPNESVQIASSTSTSAPAPVAATPSP # PNQDFSNQIGQDKGPGCGGLAIYT] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g635 ### # start gene g636 Scaffold_19 AUGUSTUS gene 493645 494840 0.95 - . g636 Scaffold_19 AUGUSTUS transcript 493645 494840 0.95 - . g636.t1 Scaffold_19 AUGUSTUS stop_codon 493645 493647 . - 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_19 AUGUSTUS CDS 493645 494294 0.98 - 2 transcript_id "g636.t1"; gene_id "g636"; Scaffold_19 AUGUSTUS CDS 494348 494840 0.95 - 0 transcript_id "g636.t1"; gene_id "g636"; Scaffold_19 AUGUSTUS start_codon 494838 494840 . - 0 transcript_id "g636.t1"; gene_id "g636"; # protein sequence = [MEFSARVVKPKVDEIERGGSYSALMELHKEIAGMGLHGLTVPAKNLGLELGYTHHLLAMEALSYSSASLALSYGAHSN # LCVNQLSRWGSEAQKSEWLPGLLDGRYLGALAMSESGAGSDVLGCMKTVAKKVDGGYLLNGNKFWITNGPKADVFIVYAKDVVEHGAKQTYTTFLVPR # TTPGFTTGKPLHKFGMRGSPTCELIFTDVFLPPSSILGDSQHHGAKVLMSGLDLERLVLSGGPLGIMQAAYDTALEYVHQREQFGVRVGTIGSMQAKI # ADMYTKLNTARAFVYSVARAVDYHTQEAAPGYPVFQRRDCAAAILYATDKAIEVALECMQCLGGNGYINEYPAARYLADARLYAVGAGTQEVRRWLIG # REVNSDFE] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g636 ### # start gene g637 Scaffold_19 AUGUSTUS gene 497536 498569 0.68 + . g637 Scaffold_19 AUGUSTUS transcript 497536 498569 0.68 + . g637.t1 Scaffold_19 AUGUSTUS start_codon 497536 497538 . + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_19 AUGUSTUS CDS 497536 497706 0.68 + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_19 AUGUSTUS CDS 497808 498569 1 + 0 transcript_id "g637.t1"; gene_id "g637"; Scaffold_19 AUGUSTUS stop_codon 498567 498569 . + 0 transcript_id "g637.t1"; gene_id "g637"; # protein sequence = [MESSLRRCASDSHISLANRPVMLSTVIEPKNKTIIPSSLTPVLTSLLLPGDQQHIKADLPASSQDVLVSNSPQILPTS # QDSMPITAPNSQSPDSKNSLLQSVTVPAEEAPAPSNRTSTGLLHDLKRMLHRTNRASTTPQQPLSRLLSLDSLKKKVKLSSIFPKDKFSEKDLSPFPS # SGSASNSELNRSRSPLPPYTLKFRSHHFQNSSHLTRPININHAHLHKKYGRWGRVLGSGAGGTVRLIKGSQKNGGAIFAVKQFRPKRKDESEKEYQTK # VTAEFCVGSALNHTNIIEVVDIITENGHYYEVSPTL] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g637 ### # start gene g638 Scaffold_19 AUGUSTUS gene 498994 499701 0.59 + . g638 Scaffold_19 AUGUSTUS transcript 498994 499701 0.59 + . g638.t1 Scaffold_19 AUGUSTUS start_codon 498994 498996 . + 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_19 AUGUSTUS CDS 498994 499701 0.59 + 0 transcript_id "g638.t1"; gene_id "g638"; Scaffold_19 AUGUSTUS stop_codon 499699 499701 . + 0 transcript_id "g638.t1"; gene_id "g638"; # protein sequence = [MKTDASFRAFVDAQNDLSMPKSTKSKGVISSSQLELELSTTAKVDVEMDPSVIRLGRPGNSTESLPEFTTFSTSKSSP # TTTISGYVAETLKESIGFQEVTLQRSNSVATLHSGEAGSIFSLLPRETKPTLRRMLHVDPSARCTLTSLLKGWGKAVSGFDLNSNMSTLTGTVNGGGS # IDEHSDSASTLTFNTVPCVNYDCKAEEEDGGDPWLTSIATCSTPGVKPTHVHVKVTRKQ] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g638 ### # start gene g639 Scaffold_19 AUGUSTUS gene 500412 501410 0.38 - . g639 Scaffold_19 AUGUSTUS transcript 500412 501410 0.38 - . g639.t1 Scaffold_19 AUGUSTUS stop_codon 500412 500414 . - 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_19 AUGUSTUS CDS 500412 501410 0.38 - 0 transcript_id "g639.t1"; gene_id "g639"; Scaffold_19 AUGUSTUS start_codon 501408 501410 . - 0 transcript_id "g639.t1"; gene_id "g639"; # protein sequence = [MAFTKCFLPHTSNQRIPVQNSIYINSITICDHHISPFFTLHSESCRESWSGSRSEEFAQGSPEASKTEPISPLFLPHE # LYPMEIATVKAQNGKISFPYIPVAVFIGGTSGIGRATAEALARYTNGNANIIIVGRNRAAADSIIASFPRPSFPSVKHEFIQCDVTLLKNVRQATNEI # LSRHSKINVLVISTGEMELFNREITEDGLDRIVVLAYHSRWKFIHGLMPALAKAKEANEDAKVLSVASAGLGGKVDLEDLELKKVSLIPFLRSISTYN # DLMVEVSYIYILSPLGFCFTLSFYDFHTLQPWEGSYSFRIKFFLNTLPNAVFPHQLPV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g639 ### # start gene g640 Scaffold_19 AUGUSTUS gene 508976 510332 0.27 + . g640 Scaffold_19 AUGUSTUS transcript 508976 510332 0.27 + . g640.t1 Scaffold_19 AUGUSTUS start_codon 508976 508978 . + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_19 AUGUSTUS CDS 508976 509056 1 + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_19 AUGUSTUS CDS 509162 509678 0.37 + 0 transcript_id "g640.t1"; gene_id "g640"; Scaffold_19 AUGUSTUS CDS 509746 510199 0.98 + 2 transcript_id "g640.t1"; gene_id "g640"; Scaffold_19 AUGUSTUS CDS 510311 510332 0.76 + 1 transcript_id "g640.t1"; gene_id "g640"; Scaffold_19 AUGUSTUS stop_codon 510330 510332 . + 0 transcript_id "g640.t1"; gene_id "g640"; # protein sequence = [MSLPKTFKAAVINSAGSDFEIIEKTLEVRTSFCESNITTDKRSITPQRWHGQIWNGPPSRVAGHEIIGDVVAVPSGET # RWKVGDRVGSGWHGGHCNQCSSCKESDFITCSAEAINGSVSFNTSPQIIDALTRFSLYSVTKDGGYAEYTTLRTEAVLPVPTELDPAEAAPLLCAGIT # TFNSLRNIPDLKKGDLVAVHGLGGLGHLGIQYAKQMGYKVVALSQSSAKKELATKLGADYYLDGSQVNQVEELMKLGGAKVIVATAPQGEAIATLLGG # LKIGGTMLVLASKHGILFFLEYFADLRCFSVVDLKFSTIALIGKRASIKGWPSGHAKDSEDAVAFAQKHNVKTLIEKSDSVLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/4 # CDS introns: 0/3 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g640 ### # start gene g641 Scaffold_19 AUGUSTUS gene 511782 512159 0.64 - . g641 Scaffold_19 AUGUSTUS transcript 511782 512159 0.64 - . g641.t1 Scaffold_19 AUGUSTUS stop_codon 511782 511784 . - 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_19 AUGUSTUS CDS 511782 512159 0.64 - 0 transcript_id "g641.t1"; gene_id "g641"; Scaffold_19 AUGUSTUS start_codon 512157 512159 . - 0 transcript_id "g641.t1"; gene_id "g641"; # protein sequence = [MNEYGRGRGWTVEGGGEWVGREMEAEKRGRGLREALITDFFGGVVEVDVDGEGESVLQLFEDLECPPVFKEPTPPPIK # TYSPPPPAPVSSTSLFNEYPFLRPSLAFVILGALFAFVFSGVISGRS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g641 ### # start gene g642 Scaffold_19 AUGUSTUS gene 513421 515046 0.77 + . g642 Scaffold_19 AUGUSTUS transcript 513421 515046 0.77 + . g642.t1 Scaffold_19 AUGUSTUS start_codon 513421 513423 . + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_19 AUGUSTUS CDS 513421 515046 0.77 + 0 transcript_id "g642.t1"; gene_id "g642"; Scaffold_19 AUGUSTUS stop_codon 515044 515046 . + 0 transcript_id "g642.t1"; gene_id "g642"; # protein sequence = [MTRKGHQKPFEPRVKVDNLALNERLRSSYGIIDNAKIKGLLNQAEEDLAGYDLEMERVRMAYEEEMHRLRLRRQGLHI # YMTNLTALQSPIRRLPEELLSLIFLHCCKENDLTADHEGCRESMAMTISCVCTRWRRLALPCPVFWSNLTITFAYSNSKEEEAKLVHKLSIYLERSKT # HPLTLELTANMFEPTTHKALALIARESHRWQYIFFRGDFFGGDNFPFLEPLRLPILETMIFDKFEDTFFFKEPHSEPFTGTMNLKHVVFGSLELGNGA # IALSLPLETITSLDYASRTDIVKSLSLVKRCTNLRHLRIDLWVDYDLNDYSDLEIIPQILSIDTLEVDIYEAREHSNSLALFTFPNLVNLTLTGGAPP # SFSKSFAALKSLLARSKCHLQVLTIREYHCLADTDVVTLLLQFPTLQELCIEEDNYSSEPQPISTSFITSLHTWKQGFLRCSSAPLVPQLRVLTLKTV # AEDFDPSSFVEMITSRWLPDECSEREIGAVCLRSVELHLPGIVDAKPYEPLTHIDKAGMRVVVKCEEGYLV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g642 ### # start gene g643 Scaffold_19 AUGUSTUS gene 521043 522146 0.85 - . g643 Scaffold_19 AUGUSTUS transcript 521043 522146 0.85 - . g643.t1 Scaffold_19 AUGUSTUS stop_codon 521043 521045 . - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_19 AUGUSTUS CDS 521043 521380 0.91 - 2 transcript_id "g643.t1"; gene_id "g643"; Scaffold_19 AUGUSTUS CDS 521645 522146 0.88 - 0 transcript_id "g643.t1"; gene_id "g643"; Scaffold_19 AUGUSTUS start_codon 522144 522146 . - 0 transcript_id "g643.t1"; gene_id "g643"; # protein sequence = [MFSQSRCSLQLTCLLSRAATASAPTPASDAAEAAPPSSVPPPSSRPRIALGNGTRGGRGGKSMFGLVLGTLNKAKIES # KEREASDAAKRRQLLEARLQAKLRNETAEVRRQEEAKKDKTLAVRKEEELGVRVSVYRLRRTRTPYLANFLCTSDVIVDEQTMEEDVEQTEWSAFAAE # RDASVQEIRQLREKVSHAQAIEREEKKERNGNAEGDGGDATSMDVDGSNKDGDKDAKQSTEPASAPTTADITSEDKDKTAAMDVDMKPSSTQPENDND # DAVEY] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g643 ### # start gene g644 Scaffold_19 AUGUSTUS gene 522511 524136 1 + . g644 Scaffold_19 AUGUSTUS transcript 522511 524136 1 + . g644.t1 Scaffold_19 AUGUSTUS start_codon 522511 522513 . + 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_19 AUGUSTUS CDS 522511 524136 1 + 0 transcript_id "g644.t1"; gene_id "g644"; Scaffold_19 AUGUSTUS stop_codon 524134 524136 . + 0 transcript_id "g644.t1"; gene_id "g644"; # protein sequence = [MLWSLSHSATDDFSIGIGVRLSIYIPAILVTLNSGYVAAQVCVDGLTGKLSEYFSSASLRPSSEDSDDSDSNSPSDIE # LVDLEAAAQPSQSSSSIGSDTSSWYSDGTNERNFERTSRGYLNYLSDHPHYFESSRSLERSLFLVGSAIIVSAFLDARRVTSNIGLPPYHALLVLNLS # FLNNLAGSILLPFRIMAVCAEMWFGDREEEDVVLPDSLWNIAVFIDVFGLAVLQTLVIIAFGIWFWVSTTFFHSFSGYSMTVDKLLSSASFNSTIAAS # SNGPSDPSQCLSQTIYWAFRNVPVESTLSLQIISLIFYIGTAVFPIFGPFVYVVPTVVIIRSVPLVLAVMLSGVIYLFGVTLPRILTRLIYTLPPKLY # HLSITIPYARRRLFPTVLSPSAVSTKFIFFSIVISNLSTVLYLIISTEKTISINSASRSGPVVVSGKQWTYGQTLALLTTVIGVLMYVAELVGQWKEV # LLQRRKRLRERENDENVVHVAGDVDDPNGKTQTGDDDARSDNTGNDDKMFSWTSTGTRRRTCNQRERANSI] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g644 ### # start gene g645 Scaffold_19 AUGUSTUS gene 524599 526687 0.5 + . g645 Scaffold_19 AUGUSTUS transcript 524599 526687 0.5 + . g645.t1 Scaffold_19 AUGUSTUS start_codon 524599 524601 . + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_19 AUGUSTUS CDS 524599 525860 0.5 + 0 transcript_id "g645.t1"; gene_id "g645"; Scaffold_19 AUGUSTUS CDS 525919 526687 0.99 + 1 transcript_id "g645.t1"; gene_id "g645"; Scaffold_19 AUGUSTUS stop_codon 526685 526687 . + 0 transcript_id "g645.t1"; gene_id "g645"; # protein sequence = [MKTKQKADNSSVITVFLFTIGSGNCRLFRLSSPPSFSCFRVCAFAALFLIIFSTSLLFTALTTESTLKILFPLPHKLR # IPWSADNTPFRAGTGPLVPRFDELDPVTSSENKESIYVLSLPHRTDRRARMEYLQNYLGLNWTYMDATYADAEIIGTIMGNVRKIREEAMKARLELQR # IRDEKAREKENVDDEFALIVYPDDLEPYSIPNIASPSSPLLHQASQLFSGVKLLFQWPASTFTNISASSEPLLSQLSSKAQILDYLQAFDIYASNHSS # NEILGTWRTGSNPSSFVDDIEDHDYFYRFLSNIDTKAANARAYSMVNLELVCTTKDFSLVPYSTTLPYHKYLTAARVAVWHSHLRVLRLIAEEEGLRQ # KNFWKQEIERSDDKNTTTPRSIKEEEDMGRIEARARTGMRWMRRYTDGRRELNESDSEEDSVGVLETPKSDHPRTNDELFNAAESQPKSGRDKYREHI # SIILEDDIDMEKDIRRRLHRIWINLPDDWDIVFLGHCWSNESFWPAISLPTELLETQYTSTKGVSENTLHPSYSPKCTHAYALSPPGVHKLLAHLEYP # PFAYSRAIDQAYAWLVSSGRINAYSVVGSVVVQVKGTVTDPGSSNDKGDEAHESGEGEESIGIGDVWRPGRKEDKAGTGSGNGIEALPVVSTSSWTEE # LFNGVFSGLP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g645 ### # start gene g646 Scaffold_19 AUGUSTUS gene 529184 531355 0.43 - . g646 Scaffold_19 AUGUSTUS transcript 529184 531355 0.43 - . g646.t1 Scaffold_19 AUGUSTUS stop_codon 529184 529186 . - 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_19 AUGUSTUS CDS 529184 529881 1 - 2 transcript_id "g646.t1"; gene_id "g646"; Scaffold_19 AUGUSTUS CDS 529941 530100 0.98 - 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_19 AUGUSTUS CDS 530339 531355 0.44 - 0 transcript_id "g646.t1"; gene_id "g646"; Scaffold_19 AUGUSTUS start_codon 531353 531355 . - 0 transcript_id "g646.t1"; gene_id "g646"; # protein sequence = [MWTLLACSTVAIFRIGLNAGSPPMTFTSSEPSSSHPSTLTYSTHPITRMMDEAEEKFRAKVERQSKTLPEAIEEYKRR # YGMPPPKGFEGWWEYTRKYDVVLVDEYDTLMRDLAPFYALRGQKELGDYTDADEDPLLPGSGLDRHGWALGGGPEMRRRIAEVAGVSSIDLVRVRNGV # PSTVSINKDGFVDDEVSARARGLKSMLGKCVAVLPDMDFPVNAKAEGRVIVPWDRWEVAGQDGSSSSKVGLGMGNRTYIEDDTPDDDKNKVHPLSTFR # PDWRGEGNVWDTWRRTCPPNSTARKFYASIRSAMLDITSSSNKPAGNHGKFFYFIPISRIFSYAFIPSHYYYGSTDAYTYGWDEVNLELQPTDRGEVA # WGDETDLGPDGEGGVDDRDLVIDPSYDGHTNTANPPRNRKTGKESKRNKIFWRGATTGGGNSPPGFAALYQRHRAVRMTGWDVEGDVEVWVPSTSPFS # NISLSTSATSSASQIQLADVPLTAHKIPAATLNKALMDIAFVKAANADQYPGGMEKLMQEHRFSGSVYLGEFEQQSFRITADCFFICKVVTGNTNTSS # TSTECPTLVDLCPSLPLTQYRSRVQCTKSSSQSGLSPGEYQDALHHSHSRIESDSR] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g646 ### # start gene g647 Scaffold_19 AUGUSTUS gene 531995 532429 0.93 - . g647 Scaffold_19 AUGUSTUS transcript 531995 532429 0.93 - . g647.t1 Scaffold_19 AUGUSTUS stop_codon 531995 531997 . - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_19 AUGUSTUS CDS 531995 532429 0.93 - 0 transcript_id "g647.t1"; gene_id "g647"; Scaffold_19 AUGUSTUS start_codon 532427 532429 . - 0 transcript_id "g647.t1"; gene_id "g647"; # protein sequence = [MSYSGRFMSFLSSDSVPIKSTVYEEFFSEWIEPWLHYIPLSSSYEEIYNIFGYFSGIPAEVMEQIYGNAVNPATGTPF # FPPGSKIPAIPGAPDGDARLQRIAQAGKEWKNTIGRKVDMESYVYRLALEWARLNAEDREMMTMKV] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g647 ### # start gene g648 Scaffold_19 AUGUSTUS gene 533401 534279 0.31 - . g648 Scaffold_19 AUGUSTUS transcript 533401 534279 0.31 - . g648.t1 Scaffold_19 AUGUSTUS stop_codon 533401 533403 . - 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_19 AUGUSTUS CDS 533401 534279 0.31 - 0 transcript_id "g648.t1"; gene_id "g648"; Scaffold_19 AUGUSTUS start_codon 534277 534279 . - 0 transcript_id "g648.t1"; gene_id "g648"; # protein sequence = [MAEAERRFQAKVNRQSKTLPEAIKEYKRRYGMSPPIGFDDWWEFASKNDVILVDEFDTLMRDLAPFYALRGQKEMGDY # ADTDEDPARLGSGLDRYGWALGGGSEMRRRIVEVASVASIDMVRIRNGTLSTVSISKDGFVDDEVSARAKGLKSMLGVSAPKLPDIDFPVNAKAEGRV # IVPWDRWEVAGQNGMNGDKIGRGMGNRSYMEDTAPHDTKDTLHPLATFHPDWRGAGNVWDKWRRTCPPNSTARKSYTSLRSALIDSMSLSHIAASEKS # GGKFLVFNALFYHILTAM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g648 ### # start gene g649 Scaffold_19 AUGUSTUS gene 542837 543642 0.65 - . g649 Scaffold_19 AUGUSTUS transcript 542837 543642 0.65 - . g649.t1 Scaffold_19 AUGUSTUS stop_codon 542837 542839 . - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_19 AUGUSTUS CDS 542837 543135 0.83 - 2 transcript_id "g649.t1"; gene_id "g649"; Scaffold_19 AUGUSTUS CDS 543225 543642 0.68 - 0 transcript_id "g649.t1"; gene_id "g649"; Scaffold_19 AUGUSTUS start_codon 543640 543642 . - 0 transcript_id "g649.t1"; gene_id "g649"; # protein sequence = [MHNYCIIDSNKNGSYQHVNQTLEQYIRIYCSYQQDDWLHLLPIAEFAYNNAPNASTGITPFFANKGYHPNITVRPEAD # MKSDLARDFVVNLNELHVFLREEILLAQSRYKEQADRKRISHPEFLIGSKVFVLAKHIQSTYYLCQIHPVFHVSQLEPVMSNLFLNRMQSPPPPIEVD # GEEEYNVAEILDSKLDRRYKCCPLHSYIQWAGYEGTDDEFSWVAADELVPAFHAQYPLKPGP] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g649 ### # start gene g650 Scaffold_19 AUGUSTUS gene 546720 547223 0.73 - . g650 Scaffold_19 AUGUSTUS transcript 546720 547223 0.73 - . g650.t1 Scaffold_19 AUGUSTUS stop_codon 546720 546722 . - 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_19 AUGUSTUS CDS 546720 547223 0.73 - 0 transcript_id "g650.t1"; gene_id "g650"; Scaffold_19 AUGUSTUS start_codon 547221 547223 . - 0 transcript_id "g650.t1"; gene_id "g650"; # protein sequence = [MTSATNIVDAKATVPLLEPSPLVLLTILENPPGDSLRSRSQSKQAKPLLSKFPFEPIYSYAMVSQFAAQLETPEVDIA # LVSAAVFNRACKDAGMEPILLCAIHSEVTARAADRSSTAPTVPPLHHSIPKEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGALPPLS] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g650 ### # start gene g651 Scaffold_19 AUGUSTUS gene 550990 552027 0.88 - . g651 Scaffold_19 AUGUSTUS transcript 550990 552027 0.88 - . g651.t1 Scaffold_19 AUGUSTUS stop_codon 550990 550992 . - 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_19 AUGUSTUS CDS 550990 551426 0.96 - 2 transcript_id "g651.t1"; gene_id "g651"; Scaffold_19 AUGUSTUS CDS 551550 552027 0.88 - 0 transcript_id "g651.t1"; gene_id "g651"; Scaffold_19 AUGUSTUS start_codon 552025 552027 . - 0 transcript_id "g651.t1"; gene_id "g651"; # protein sequence = [MVTPARGRSITRIESPILQAIAHHTGKQPQHRANSPSPRDPPPHFDLDTGNHDDQNPPVNPNDPGVDNDNPNNDDLDD # DSGSLPHGEPGDPSGPGGPSGPSGPCTPISPDIPNEQRDMLETLSGFKGSIETLGTVLAALGRPSDSSESKSKVKKPEVFGAKEWFVPILDPDLDCLP # TWTSLFKALVKELQDNFGVYDAQGEAEDSLSNLKMKETKNIRKYNIRFNTLAASTNWDLAALKWAYGRGLAEHIKDEMAHLPELAMLADYHQEVLHID # DRYWKHEETKKREASKPFIAWNLMTRLNFG] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g651 ### # start gene g652 Scaffold_19 AUGUSTUS gene 555879 556502 0.86 + . g652 Scaffold_19 AUGUSTUS transcript 555879 556502 0.86 + . g652.t1 Scaffold_19 AUGUSTUS start_codon 555879 555881 . + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_19 AUGUSTUS CDS 555879 556502 0.86 + 0 transcript_id "g652.t1"; gene_id "g652"; Scaffold_19 AUGUSTUS stop_codon 556500 556502 . + 0 transcript_id "g652.t1"; gene_id "g652"; # protein sequence = [MKETENIRFNTLAASTNWDSAALKWAYGRGLAERIKDEMARLPEPATLADYRQEVLRIDNRYWKREETRKREAGKPFI # ARNPKKGSSDFKTGSTNQQNNSQPSGSSAPFTPKPKPFSGGNLITMVSPRTFRIPANPAVSPRIQPSWCRWESLPSERERRMKNNLCLFCGGKHQIAD # CNKRKARESKGRAAEVEEKATIEVVEEESEN] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g652 ### # start gene g653 Scaffold_19 AUGUSTUS gene 557120 561520 0.29 + . g653 Scaffold_19 AUGUSTUS transcript 557120 561520 0.29 + . g653.t1 Scaffold_19 AUGUSTUS start_codon 557120 557122 . + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_19 AUGUSTUS CDS 557120 558241 0.99 + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_19 AUGUSTUS CDS 558994 559018 0.71 + 0 transcript_id "g653.t1"; gene_id "g653"; Scaffold_19 AUGUSTUS CDS 560286 561520 0.73 + 2 transcript_id "g653.t1"; gene_id "g653"; Scaffold_19 AUGUSTUS stop_codon 561518 561520 . + 0 transcript_id "g653.t1"; gene_id "g653"; # protein sequence = [MLRAKPLSSKFPFEPIYSYPTVSQFAAPLETPEVDIALVSAAVFNRACKDAGMEPILLRAIHSEVAARAADRSSTAPT # VPPLHHSIPEEYAEFADVFDEIAADSLPEHRPYDLKIDLEEGASPPLGRIYPLSEKELVALKDFIDKQLATGAITPSSSPHSAPVLFVLKKDGKLCLC # VDFRGLNRITKKDRYPLPLISDLLDAPKRAKIYTKLDLAHAYHLVRIAEGDEWKTTFRTRYGSYEWKVMPFGLMNAPAAFQRFVNDIFSDMLDVCVIV # YLDDILIYSDTPEEHREHVKEVLWRLRKHRLYANPEKCEFNMDTVEYLGYILSPDGLTMSKEKVQTVLEWPVPRKFKDIQSFLGFANFYRRFIYNYSD # IVSNRPIKSHGKPRTSKNSEKAGVLTPEEYRKAGVVFGRSTFGTSARTSLLNPTNESSRPSSSQIPTEESRGSSVSRGTGSSISRGRLTSLPRNLKKS # NLDPKRKRKEINPIDIEEDIIELIAPESISTSSTSIESTRLIDTLHQTISQTSNTIEPVKMTTNNYGMPALSAEAKAEIDKASAKLPRKYKTAPLFDI # TDPSQMIPWFEATESIFEHGGITSDEAKVRLALEWTSYKTRQALRVFDSVKKPNWDQFKKDLKNMFPQSVGDERGSRLLLEQLVHQFNPIDAGEQEKM # RIFRLLFDAEMKKLMDEPKMITNSDAVRLFLAPMTPEVRRGVLETVVKDVSVTSMSDRRKEDPFKIDEVMNAAEKYMIGSSFDNYYQTLSIASSSPPI # NNPNSFSRGHINLPFAADVPKTDRNYLQH] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g653 ### # start gene g654 Scaffold_19 AUGUSTUS gene 561894 562253 0.7 + . g654 Scaffold_19 AUGUSTUS transcript 561894 562253 0.7 + . g654.t1 Scaffold_19 AUGUSTUS start_codon 561894 561896 . + 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_19 AUGUSTUS CDS 561894 562253 0.7 + 0 transcript_id "g654.t1"; gene_id "g654"; Scaffold_19 AUGUSTUS stop_codon 562251 562253 . + 0 transcript_id "g654.t1"; gene_id "g654"; # protein sequence = [MSTLAGIYEKGWMMPEGGDSKRYKLRDNARMPRDDPNVPRYKKIEQMAKDLGWDRAESYFANMEDDEDDKVMDQQMNP # NVNLAVWMTRIEELSDRLGNLEAHREDDVRVFNQDSSNGKK] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/1 # CDS introns: 0/0 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g654 ### # start gene g655 Scaffold_19 AUGUSTUS gene 562283 563685 0.19 + . g655 Scaffold_19 AUGUSTUS transcript 562283 563685 0.19 + . g655.t1 Scaffold_19 AUGUSTUS start_codon 562283 562285 . + 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_19 AUGUSTUS CDS 562283 563006 0.56 + 0 transcript_id "g655.t1"; gene_id "g655"; Scaffold_19 AUGUSTUS CDS 563057 563685 0.19 + 2 transcript_id "g655.t1"; gene_id "g655"; Scaffold_19 AUGUSTUS stop_codon 563683 563685 . + 0 transcript_id "g655.t1"; gene_id "g655"; # protein sequence = [MRTLRSNAVAPEESEKAKRNQFNENTKRLVFDGVHIPKKPGLIPGKLVETTNGNQKTVRFEAPKSIDRPLKKPSVTIE # DVNESDDEDTIKLIPSSRPTNKINSEHRPYDHVQPRTYRPIQINTPTKVPRDQTNQIDSHGYTPAYKIRNEVSRPGVEEDIAKKIFDAKVDLSTEELA # ALSPAIRKIIMRKIRNRRVRPRTKTNNYVSTLSEDGETEILDDPSRVQMIDTCIRIEIFGRIRRILQKDIVESFLRDLSIDDERRNIAIVANQSVAYE # DHSDHPVVVANQSNGLRAVTPEINNKDEEIESVLDQGSQIVVIDRLIAIGLGITWDPEFTIRMQDASGKLNQTLGLARNIPFKFGEVTVYLQLHVQNK # APFQVLLGRPFDVLVESEIKTFGNGDSEITISDPNSHKRVTVGTYPRGQKGRNIQINTSRYNEPKNVTPDNEKSTGET] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/2 # CDS introns: 0/1 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g655 ### # start gene g656 Scaffold_19 AUGUSTUS gene 564044 566054 0.14 + . g656 Scaffold_19 AUGUSTUS transcript 564044 566054 0.14 + . g656.t1 Scaffold_19 AUGUSTUS start_codon 564044 564046 . + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_19 AUGUSTUS CDS 564044 564066 0.27 + 0 transcript_id "g656.t1"; gene_id "g656"; Scaffold_19 AUGUSTUS CDS 564122 564403 0.37 + 1 transcript_id "g656.t1"; gene_id "g656"; Scaffold_19 AUGUSTUS CDS 564566 566054 0.52 + 1 transcript_id "g656.t1"; gene_id "g656"; Scaffold_19 AUGUSTUS stop_codon 566052 566054 . + 0 transcript_id "g656.t1"; gene_id "g656"; # protein sequence = [MEGSSLNPLGENCDKSESTETTQNQCNNENTSETIRDDNWNKPKNSQRTRKRMVRYEILKRGTESFQRSQPSFEKVRY # ESRQRKKGKAQDSKDKKENVQQMYINQLKKVNPIKATLPDEFRIERHIHGDPLLELPELSKHPKPFVPTGRYTEERKEIIDKNHPEGFLWEQERDLMH # EMMCKQEAGFAWEPSEAGTFKNEFFPPVKVPVIPHEPWVERNIPIPPGIFEDVCKIIKSKIDSGIYEPSNASYRSKWFCVIKKDGKSLRLVHSLEPLN # KVTIQHSGVPPATADLARSFSGRSCGGTLDLYVGYDERELDQLSRDMTTFQTPYGPHRLVKLPMGWTNSVPIFHDDVTYILRDEIPHVTIPYIDDVPV # KGPSTRYELPEGGYETIPENPGIRRFVWEHFQNMNRVIQRMKYAGGTFSGTKAFLCCEETIVVGHRCTYEGRYAEEHIAQVVLEWPSCRDKTEVRAFL # GTASQLRMFIANFAKKAAPLTKLTSNVPFEWNEKCDKAMDELKDGIRDCPALRPINFDWDVYLAVDTSYKAVGWYIYQIDPTEKKKFFNYFGSMTLNE # REARFSQSKRELYGLKLALEASYYHVLWM] # Evidence for and against this transcript: # % of transcript supported by hints (any source): 0 # CDS exons: 0/3 # CDS introns: 0/2 # 5'UTR exons and introns: 0/0 # 3'UTR exons and introns: 0/0 # hint groups fully obeyed: 0 # incompatible hint groups: 0 # end gene g656 ### # command line: # augustus --species=saccharomyces split/input_1/input_1.fa_chunk_0000000